diff options
Diffstat (limited to 'src')
492 files changed, 11919 insertions, 14930 deletions
diff --git a/src/bytes/bytes_test.go b/src/bytes/bytes_test.go index 0f6cf4993a..03f01582c5 100644 --- a/src/bytes/bytes_test.go +++ b/src/bytes/bytes_test.go @@ -693,14 +693,14 @@ func bmIndexRuneUnicode(rt *unicode.RangeTable, needle rune) func(b *testing.B, for _, r16 := range rt.R16 { for r := rune(r16.Lo); r <= rune(r16.Hi); r += rune(r16.Stride) { if r != needle { - rs = append(rs, rune(r)) + rs = append(rs, r) } } } for _, r32 := range rt.R32 { for r := rune(r32.Lo); r <= rune(r32.Hi); r += rune(r32.Stride) { if r != needle { - rs = append(rs, rune(r)) + rs = append(rs, r) } } } diff --git a/src/cmd/api/testdata/src/pkg/p1/golden.txt b/src/cmd/api/testdata/src/pkg/p1/golden.txt index 65c4f35d2c..cf089f6858 100644 --- a/src/cmd/api/testdata/src/pkg/p1/golden.txt +++ b/src/cmd/api/testdata/src/pkg/p1/golden.txt @@ -1,6 +1,6 @@ +pkg p1, const A //deprecated pkg p1, const A = 1 pkg p1, const A ideal-int -pkg p1, const A //deprecated pkg p1, const A64 = 1 pkg p1, const A64 int64 pkg p1, const AIsLowerA = 11 @@ -25,8 +25,8 @@ pkg p1, func TakesFunc(func(int) int) pkg p1, method (*B) JustOnB() pkg p1, method (*B) OnBothTandBPtr() pkg p1, method (*Embedded) OnEmbedded() -pkg p1, method (*S2) SMethod(int8, int16, int64) pkg p1, method (*S2) SMethod //deprecated +pkg p1, method (*S2) SMethod(int8, int16, int64) pkg p1, method (*T) JustOnT() pkg p1, method (*T) OnBothTandBPtr() pkg p1, method (B) OnBothTandBVal() @@ -53,8 +53,8 @@ pkg p1, type Error interface { Error, Temporary } pkg p1, type Error interface, Error() string pkg p1, type Error interface, Temporary() bool pkg p1, type FuncType func(int, int, string) (*B, error) -pkg p1, type I interface, Get(string) int64 pkg p1, type I interface, Get //deprecated +pkg p1, type I interface, Get(string) int64 pkg p1, type I interface, GetNamed(string) int64 pkg p1, type I interface, Name() string pkg p1, type I interface, PackageTwoMeth() @@ -63,9 +63,9 @@ pkg p1, type I interface, unexported methods pkg p1, type MyInt int pkg p1, type Namer interface { Name } pkg p1, type Namer interface, Name() string +pkg p1, type Private //deprecated pkg p1, type Private interface, X() pkg p1, type Private interface, unexported methods -pkg p1, type Private //deprecated pkg p1, type Public interface { X, Y } pkg p1, type Public interface, X() pkg p1, type Public interface, Y() @@ -84,8 +84,8 @@ pkg p1, type TPtrExported struct pkg p1, type TPtrExported struct, embedded *Embedded pkg p1, type TPtrUnexported struct pkg p1, type Time struct -pkg p1, type URL struct pkg p1, type URL //deprecated +pkg p1, type URL struct pkg p1, var Byte uint8 pkg p1, var ByteConv []uint8 pkg p1, var ByteFunc func(uint8) int32 @@ -97,8 +97,8 @@ pkg p1, var StrConv string pkg p1, var V string pkg p1, var V1 uint64 pkg p1, var V2 p2.Twoer -pkg p1, var VError Error pkg p1, var VError //deprecated +pkg p1, var VError Error pkg p1, var X I pkg p1, var X0 int64 pkg p1, var Y int diff --git a/src/cmd/api/testdata/src/pkg/p2/golden.txt b/src/cmd/api/testdata/src/pkg/p2/golden.txt index 735d668166..0f7de5047e 100644 --- a/src/cmd/api/testdata/src/pkg/p2/golden.txt +++ b/src/cmd/api/testdata/src/pkg/p2/golden.txt @@ -1,8 +1,7 @@ -pkg p2, func F() string pkg p2, func F //deprecated +pkg p2, func F() string pkg p2, func G() Twoer pkg p2, func NewError(string) error pkg p2, type Twoer interface { PackageTwoMeth } -pkg p2, type Twoer interface, PackageTwoMeth() pkg p2, type Twoer interface, PackageTwoMeth //deprecated - +pkg p2, type Twoer interface, PackageTwoMeth() diff --git a/src/cmd/api/testdata/src/pkg/p4/golden.txt b/src/cmd/api/testdata/src/pkg/p4/golden.txt index 1ceae17386..3195f4228d 100644 --- a/src/cmd/api/testdata/src/pkg/p4/golden.txt +++ b/src/cmd/api/testdata/src/pkg/p4/golden.txt @@ -1,6 +1,6 @@ +pkg p4, func Clone //deprecated +pkg p4, func Clone[$0 interface{ ~[]$1 }, $1 interface{}]($0) $0 pkg p4, func NewPair[$0 interface{ M }, $1 interface{ ~int }]($0, $1) Pair[$0, $1] -pkg p4, method (Pair[$0, $1]) Second() $1 pkg p4, method (Pair[$0, $1]) First() $0 +pkg p4, method (Pair[$0, $1]) Second() $1 pkg p4, type Pair[$0 interface{ M }, $1 interface{ ~int }] struct -pkg p4, func Clone[$0 interface{ ~[]$1 }, $1 interface{}]($0) $0 -pkg p4, func Clone //deprecated diff --git a/src/cmd/asm/internal/asm/testdata/loong64enc1.s b/src/cmd/asm/internal/asm/testdata/loong64enc1.s index bfff555782..8363996683 100644 --- a/src/cmd/asm/internal/asm/testdata/loong64enc1.s +++ b/src/cmd/asm/internal/asm/testdata/loong64enc1.s @@ -510,6 +510,16 @@ lable2: VMOVQ V3.W[1], V7.W4 // 67e4f772 VMOVQ V4.V[0], V6.V2 // 86f0f772 + // Load data from memory and broadcast to each element of a vector register: VMOVQ offset(Rj), <Vd>.<T> + VMOVQ (R4), V0.B16 // 80008030 + VMOVQ 1(R4), V1.H8 // 81044030 + VMOVQ 2(R4), V2.W4 // 82082030 + VMOVQ 3(R4), V3.V2 // 830c1030 + XVMOVQ (R4), X0.B32 // 80008032 + XVMOVQ 1(R4), X1.H16 // 81044032 + XVMOVQ 2(R4), X2.W8 // 82082032 + XVMOVQ 3(R4), X3.V4 // 830c1032 + // VSEQ{B,H,W,V}, XVSEQ{B,H,W,V} instruction VSEQB V1, V2, V3 // 43040070 VSEQH V1, V2, V3 // 43840070 @@ -1035,3 +1045,53 @@ lable2: PRELD (R4), $0 // 8000c02a PRELD -1(R4), $8 // 88fcff2a PRELD 8(R4), $31 // 9f20c02a + + // [X]{VBITCLR/VBITSET/VBITREV}{B,H,W,V} instructions + VBITCLRB V1, V2, V3 // 43040c71 + VBITCLRH V1, V2, V3 // 43840c71 + VBITCLRW V1, V2, V3 // 43040d71 + VBITCLRV V1, V2, V3 // 43840d71 + VBITSETB V1, V2, V3 // 43040e71 + VBITSETH V1, V2, V3 // 43840e71 + VBITSETW V1, V2, V3 // 43040f71 + VBITSETV V1, V2, V3 // 43840f71 + VBITREVB V1, V2, V3 // 43041071 + VBITREVH V1, V2, V3 // 43841071 + VBITREVW V1, V2, V3 // 43041171 + VBITREVV V1, V2, V3 // 43841171 + XVBITCLRB X3, X2, X1 // 410c0c75 + XVBITCLRH X3, X2, X1 // 418c0c75 + XVBITCLRW X3, X2, X1 // 410c0d75 + XVBITCLRV X3, X2, X1 // 418c0d75 + XVBITSETB X3, X2, X1 // 410c0e75 + XVBITSETH X3, X2, X1 // 418c0e75 + XVBITSETW X3, X2, X1 // 410c0f75 + XVBITSETV X3, X2, X1 // 418c0f75 + XVBITREVB X3, X2, X1 // 410c1075 + XVBITREVH X3, X2, X1 // 418c1075 + XVBITREVW X3, X2, X1 // 410c1175 + XVBITREVV X3, X2, X1 // 418c1175 + VBITCLRB $7, V2, V3 // 433c1073 + VBITCLRH $15, V2, V3 // 437c1073 + VBITCLRW $31, V2, V3 // 43fc1073 + VBITCLRV $63, V2, V3 // 43fc1173 + VBITSETB $7, V2, V3 // 433c1473 + VBITSETH $15, V2, V3 // 437c1473 + VBITSETW $31, V2, V3 // 43fc1473 + VBITSETV $63, V2, V3 // 43fc1573 + VBITREVB $7, V2, V3 // 433c1873 + VBITREVH $15, V2, V3 // 437c1873 + VBITREVW $31, V2, V3 // 43fc1873 + VBITREVV $63, V2, V3 // 43fc1973 + XVBITCLRB $7, X2, X1 // 413c1077 + XVBITCLRH $15, X2, X1 // 417c1077 + XVBITCLRW $31, X2, X1 // 41fc1077 + XVBITCLRV $63, X2, X1 // 41fc1177 + XVBITSETB $7, X2, X1 // 413c1477 + XVBITSETH $15, X2, X1 // 417c1477 + XVBITSETW $31, X2, X1 // 41fc1477 + XVBITSETV $63, X2, X1 // 41fc1577 + XVBITREVB $7, X2, X1 // 413c1877 + XVBITREVH $15, X2, X1 // 417c1877 + XVBITREVW $31, X2, X1 // 41fc1877 + XVBITREVV $63, X2, X1 // 41fc1977 diff --git a/src/cmd/asm/internal/asm/testdata/s390x.s b/src/cmd/asm/internal/asm/testdata/s390x.s index 95a8c50dab..93c3ec9ea7 100644 --- a/src/cmd/asm/internal/asm/testdata/s390x.s +++ b/src/cmd/asm/internal/asm/testdata/s390x.s @@ -263,10 +263,15 @@ TEXT main·foo(SB),DUPOK|NOSPLIT,$16-0 // TEXT main.foo(SB), DUPOK|NOSPLIT, $16- NC $8, (R15), n-8(SP) // d407f010f000 OC $8, (R15), n-8(SP) // d607f010f000 MVC $8, (R15), n-8(SP) // d207f010f000 + MVC $256, 8192(R1), 8192(R2) // b90400a2c2a800002000b90400b1c2b800002000d2ffa000b000 MVCIN $8, (R15), n-8(SP) // e807f010f000 CLC $8, (R15), n-8(SP) // d507f000f010 XC $256, -8(R15), -8(R15) // b90400afc2a8fffffff8d7ffa000a000 - MVC $256, 8192(R1), 8192(R2) // b90400a2c2a800002000b90400b1c2b800002000d2ffa000b000 + MVCLE 0, R4, R6 // a8640000 + MVCLE 4095, R4, R6 // a8640fff + MVCLE $4095, R4, R6 // a8640fff + MVCLE (R3), R4, R6 // a8643000 + MVCLE 10(R3), R4, R6 // a864300a CMP R1, R2 // b9200012 CMP R3, $32767 // a73f7fff @@ -535,6 +540,18 @@ TEXT main·foo(SB),DUPOK|NOSPLIT,$16-0 // TEXT main.foo(SB), DUPOK|NOSPLIT, $16- VSTRCZBS V18, V20, V22, V24 // e78240306f8a VSTRCZHS V18, V20, V22, V24 // e78241306f8a VSTRCZFS V18, V20, V22, V24 // e78242306f8a + VFMAXSB $1, V2, V3, V4 // e742301020ef + WFMAXSB $2, V5, V6, V7 // e775602820ef + WFMAXSB $2, F5, F6, F7 // e775602820ef + VFMAXDB $3, V8, V9, V10 // e7a8903030ef + WFMAXDB $4, V11, V12, V13 // e7dbc04830ef + WFMAXDB $4, F11, F12, F13 // e7dbc04830ef + VFMINSB $7, V14, V15, V16 // e70ef07028ee + WFMINSB $8, V17, V18, V19 // e73120882eee + WFMINSB $8, F1, F2, F3 // e731208820ee + VFMINDB $9, V20, V21, V22 // e76450903eee + WFMINDB $10, V23, V24, V25 // e79780a83eee + WFMINDB $10, F7, F8, F9 // e79780a830ee RET RET foo(SB) diff --git a/src/cmd/cgo/internal/test/test.go b/src/cmd/cgo/internal/test/test.go index 844b2dd42c..fb4a8250a2 100644 --- a/src/cmd/cgo/internal/test/test.go +++ b/src/cmd/cgo/internal/test/test.go @@ -245,7 +245,7 @@ static void *thread(void *p) { return NULL; } void testSendSIG() { - const int N = 20; + enum { N = 20 }; int i; pthread_t tid[N]; for (i = 0; i < N; i++) { diff --git a/src/cmd/cgo/out.go b/src/cmd/cgo/out.go index 10870b7c85..dfa54e41d3 100644 --- a/src/cmd/cgo/out.go +++ b/src/cmd/cgo/out.go @@ -1812,7 +1812,7 @@ void _cgoPREFIX_Cfunc__Cmalloc(void *v) { void *ret; _cgo_tsan_acquire(); ret = malloc(a->p0); - if (ret == 0 && a->p0 == 0) { + if (ret == NULL && a->p0 == 0) { ret = malloc(1); } a->r1 = ret; diff --git a/src/cmd/compile/internal/amd64/ggen.go b/src/cmd/compile/internal/amd64/ggen.go index 1dc952a455..853a10cb9a 100644 --- a/src/cmd/compile/internal/amd64/ggen.go +++ b/src/cmd/compile/internal/amd64/ggen.go @@ -5,113 +5,23 @@ package amd64 import ( - "cmd/compile/internal/ir" "cmd/compile/internal/objw" - "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/x86" ) -// DUFFZERO consists of repeated blocks of 4 MOVUPSs + LEAQ, -// See runtime/mkduff.go. -const ( - dzBlocks = 16 // number of MOV/ADD blocks - dzBlockLen = 4 // number of clears per block - dzBlockSize = 23 // size of instructions in a single block - dzMovSize = 5 // size of single MOV instruction w/ offset - dzLeaqSize = 4 // size of single LEAQ instruction - dzClearStep = 16 // number of bytes cleared by each MOV instruction - - dzClearLen = dzClearStep * dzBlockLen // bytes cleared by one block - dzSize = dzBlocks * dzBlockSize -) - -// dzOff returns the offset for a jump into DUFFZERO. -// b is the number of bytes to zero. -func dzOff(b int64) int64 { - off := int64(dzSize) - off -= b / dzClearLen * dzBlockSize - tailLen := b % dzClearLen - if tailLen >= dzClearStep { - off -= dzLeaqSize + dzMovSize*(tailLen/dzClearStep) - } - return off -} - -// duffzeroDI returns the pre-adjustment to DI for a call to DUFFZERO. -// b is the number of bytes to zero. -func dzDI(b int64) int64 { - tailLen := b % dzClearLen - if tailLen < dzClearStep { - return 0 - } - tailSteps := tailLen / dzClearStep - return -dzClearStep * (dzBlockLen - tailSteps) -} - func zerorange(pp *objw.Progs, p *obj.Prog, off, cnt int64, state *uint32) *obj.Prog { - const ( - r13 = 1 << iota // if R13 is already zeroed. - ) - - if cnt == 0 { - return p + if cnt%8 != 0 { + panic("zeroed region not aligned") } - - if cnt == 8 { + for cnt >= 16 { + p = pp.Append(p, x86.AMOVUPS, obj.TYPE_REG, x86.REG_X15, 0, obj.TYPE_MEM, x86.REG_SP, off) + off += 16 + cnt -= 16 + } + if cnt != 0 { p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_X15, 0, obj.TYPE_MEM, x86.REG_SP, off) - } else if cnt <= int64(8*types.RegSize) { - for i := int64(0); i < cnt/16; i++ { - p = pp.Append(p, x86.AMOVUPS, obj.TYPE_REG, x86.REG_X15, 0, obj.TYPE_MEM, x86.REG_SP, off+i*16) - } - - if cnt%16 != 0 { - p = pp.Append(p, x86.AMOVUPS, obj.TYPE_REG, x86.REG_X15, 0, obj.TYPE_MEM, x86.REG_SP, off+cnt-int64(16)) - } - } else if cnt <= int64(128*types.RegSize) { - // Save DI to r12. With the amd64 Go register abi, DI can contain - // an incoming parameter, whereas R12 is always scratch. - p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_DI, 0, obj.TYPE_REG, x86.REG_R12, 0) - // Emit duffzero call - p = pp.Append(p, leaptr, obj.TYPE_MEM, x86.REG_SP, off+dzDI(cnt), obj.TYPE_REG, x86.REG_DI, 0) - p = pp.Append(p, obj.ADUFFZERO, obj.TYPE_NONE, 0, 0, obj.TYPE_ADDR, 0, dzOff(cnt)) - p.To.Sym = ir.Syms.Duffzero - if cnt%16 != 0 { - p = pp.Append(p, x86.AMOVUPS, obj.TYPE_REG, x86.REG_X15, 0, obj.TYPE_MEM, x86.REG_DI, -int64(8)) - } - // Restore DI from r12 - p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_R12, 0, obj.TYPE_REG, x86.REG_DI, 0) - - } else { - // When the register ABI is in effect, at this point in the - // prolog we may have live values in all of RAX,RDI,RCX. Save - // them off to registers before the REPSTOSQ below, then - // restore. Note that R12 and R13 are always available as - // scratch regs; here we also use R15 (this is safe to do - // since there won't be any globals accessed in the prolog). - // See rewriteToUseGot() in obj6.go for more on r15 use. - - // Save rax/rdi/rcx - p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_DI, 0, obj.TYPE_REG, x86.REG_R12, 0) - p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_AX, 0, obj.TYPE_REG, x86.REG_R13, 0) - p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_CX, 0, obj.TYPE_REG, x86.REG_R15, 0) - - // Set up the REPSTOSQ and kick it off. - p = pp.Append(p, x86.AXORL, obj.TYPE_REG, x86.REG_AX, 0, obj.TYPE_REG, x86.REG_AX, 0) - p = pp.Append(p, x86.AMOVQ, obj.TYPE_CONST, 0, cnt/int64(types.RegSize), obj.TYPE_REG, x86.REG_CX, 0) - p = pp.Append(p, leaptr, obj.TYPE_MEM, x86.REG_SP, off, obj.TYPE_REG, x86.REG_DI, 0) - p = pp.Append(p, x86.AREP, obj.TYPE_NONE, 0, 0, obj.TYPE_NONE, 0, 0) - p = pp.Append(p, x86.ASTOSQ, obj.TYPE_NONE, 0, 0, obj.TYPE_NONE, 0, 0) - - // Restore rax/rdi/rcx - p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_R12, 0, obj.TYPE_REG, x86.REG_DI, 0) - p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_R13, 0, obj.TYPE_REG, x86.REG_AX, 0) - p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_R15, 0, obj.TYPE_REG, x86.REG_CX, 0) - - // Record the fact that r13 is no longer zero. - *state &= ^uint32(r13) } - return p } diff --git a/src/cmd/compile/internal/amd64/ssa.go b/src/cmd/compile/internal/amd64/ssa.go index 9e772a7169..8847580e25 100644 --- a/src/cmd/compile/internal/amd64/ssa.go +++ b/src/cmd/compile/internal/amd64/ssa.go @@ -17,6 +17,7 @@ import ( "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/x86" + "internal/abi" ) // ssaMarkMoves marks any MOVXconst ops that need to avoid clobbering flags. @@ -147,6 +148,15 @@ func memIdx(a *obj.Addr, v *ssa.Value) { // DUFFZERO consists of repeated blocks of 4 MOVUPSs + LEAQ, // See runtime/mkduff.go. +const ( + dzBlocks = 16 // number of MOV/ADD blocks + dzBlockLen = 4 // number of clears per block + dzBlockSize = 23 // size of instructions in a single block + dzMovSize = 5 // size of single MOV instruction w/ offset + dzLeaqSize = 4 // size of single LEAQ instruction + dzClearStep = 16 // number of bytes cleared by each MOV instruction +) + func duffStart(size int64) int64 { x, _ := duff(size) return x @@ -1001,26 +1011,103 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { ssagen.AddAux(&p.From, v) p.To.Type = obj.TYPE_REG p.To.Reg = v.Reg() - case ssa.OpAMD64DUFFZERO: + + case ssa.OpAMD64LoweredZero: if s.ABI != obj.ABIInternal { // zero X15 manually opregreg(s, x86.AXORPS, x86.REG_X15, x86.REG_X15) } - off := duffStart(v.AuxInt) - adj := duffAdj(v.AuxInt) - var p *obj.Prog - if adj != 0 { - p = s.Prog(x86.ALEAQ) - p.From.Type = obj.TYPE_MEM - p.From.Offset = adj - p.From.Reg = x86.REG_DI - p.To.Type = obj.TYPE_REG - p.To.Reg = x86.REG_DI + ptrReg := v.Args[0].Reg() + n := v.AuxInt + if n < 16 { + v.Fatalf("Zero too small %d", n) } - p = s.Prog(obj.ADUFFZERO) - p.To.Type = obj.TYPE_ADDR - p.To.Sym = ir.Syms.Duffzero - p.To.Offset = off + zero16 := func(off int64) { + zero16(s, ptrReg, off) + } + + // Generate zeroing instructions. + var off int64 + for n >= 16 { + zero16(off) + off += 16 + n -= 16 + } + if n != 0 { + // use partially overlapped write. + // TODO: n <= 8, use smaller write? + zero16(off + n - 16) + } + + case ssa.OpAMD64LoweredZeroLoop: + if s.ABI != obj.ABIInternal { + // zero X15 manually + opregreg(s, x86.AXORPS, x86.REG_X15, x86.REG_X15) + } + ptrReg := v.Args[0].Reg() + countReg := v.RegTmp() + n := v.AuxInt + loopSize := int64(64) + if n < 3*loopSize { + // - a loop count of 0 won't work. + // - a loop count of 1 is useless. + // - a loop count of 2 is a code size ~tie + // 4 instructions to implement the loop + // 4 instructions in the loop body + // vs + // 8 instructions in the straightline code + // Might as well use straightline code. + v.Fatalf("ZeroLoop size too small %d", n) + } + zero16 := func(off int64) { + zero16(s, ptrReg, off) + } + + // Put iteration count in a register. + // MOVL $n, countReg + p := s.Prog(x86.AMOVL) + p.From.Type = obj.TYPE_CONST + p.From.Offset = n / loopSize + p.To.Type = obj.TYPE_REG + p.To.Reg = countReg + cntInit := p + + // Zero loopSize bytes starting at ptrReg. + for i := range loopSize / 16 { + zero16(i * 16) + } + // ADDQ $loopSize, ptrReg + p = s.Prog(x86.AADDQ) + p.From.Type = obj.TYPE_CONST + p.From.Offset = loopSize + p.To.Type = obj.TYPE_REG + p.To.Reg = ptrReg + // DECL countReg + p = s.Prog(x86.ADECL) + p.To.Type = obj.TYPE_REG + p.To.Reg = countReg + // Jump to first instruction in loop if we're not done yet. + // JNE head + p = s.Prog(x86.AJNE) + p.To.Type = obj.TYPE_BRANCH + p.To.SetTarget(cntInit.Link) + + // Multiples of the loop size are now done. + n %= loopSize + + // Write any fractional portion. + var off int64 + for n >= 16 { + zero16(off) + off += 16 + n -= 16 + } + if n != 0 { + // Use partially-overlapping write. + // TODO: n <= 8, use smaller write? + zero16(off + n - 16) + } + case ssa.OpAMD64DUFFCOPY: p := s.Prog(obj.ADUFFCOPY) p.To.Type = obj.TYPE_ADDR @@ -1151,12 +1238,91 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { // AuxInt encodes how many buffer entries we need. p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1] - case ssa.OpAMD64LoweredPanicBoundsA, ssa.OpAMD64LoweredPanicBoundsB, ssa.OpAMD64LoweredPanicBoundsC: - p := s.Prog(obj.ACALL) + case ssa.OpAMD64LoweredPanicBoundsRR, ssa.OpAMD64LoweredPanicBoundsRC, ssa.OpAMD64LoweredPanicBoundsCR, ssa.OpAMD64LoweredPanicBoundsCC: + // Compute the constant we put in the PCData entry for this call. + code, signed := ssa.BoundsKind(v.AuxInt).Code() + xIsReg := false + yIsReg := false + xVal := 0 + yVal := 0 + switch v.Op { + case ssa.OpAMD64LoweredPanicBoundsRR: + xIsReg = true + xVal = int(v.Args[0].Reg() - x86.REG_AX) + yIsReg = true + yVal = int(v.Args[1].Reg() - x86.REG_AX) + case ssa.OpAMD64LoweredPanicBoundsRC: + xIsReg = true + xVal = int(v.Args[0].Reg() - x86.REG_AX) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + if yVal == xVal { + yVal = 1 + } + p := s.Prog(x86.AMOVQ) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(yVal) + } + case ssa.OpAMD64LoweredPanicBoundsCR: + yIsReg = true + yVal := int(v.Args[0].Reg() - x86.REG_AX) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + xIsReg = true + if xVal == yVal { + xVal = 1 + } + p := s.Prog(x86.AMOVQ) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(xVal) + } + case ssa.OpAMD64LoweredPanicBoundsCC: + c := v.Aux.(ssa.PanicBoundsCC).Cx + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + xIsReg = true + p := s.Prog(x86.AMOVQ) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(xVal) + } + c = v.Aux.(ssa.PanicBoundsCC).Cy + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + yVal = 1 + p := s.Prog(x86.AMOVQ) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(yVal) + } + } + c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal) + + p := s.Prog(obj.APCDATA) + p.From.SetConst(abi.PCDATA_PanicBounds) + p.To.SetConst(int64(c)) + p = s.Prog(obj.ACALL) p.To.Type = obj.TYPE_MEM p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt] - s.UseArgs(int64(2 * types.PtrSize)) // space used in callee args area by assembly stubs + p.To.Sym = ir.Syms.PanicBounds case ssa.OpAMD64NEGQ, ssa.OpAMD64NEGL, ssa.OpAMD64BSWAPQ, ssa.OpAMD64BSWAPL, @@ -1931,6 +2097,17 @@ func spillArgReg(pp *objw.Progs, p *obj.Prog, f *ssa.Func, t *types.Type, reg in return p } +// zero 16 bytes at reg+off. +func zero16(s *ssagen.State, reg int16, off int64) { + // MOVUPS X15, off(ptrReg) + p := s.Prog(x86.AMOVUPS) + p.From.Type = obj.TYPE_REG + p.From.Reg = x86.REG_X15 + p.To.Type = obj.TYPE_MEM + p.To.Reg = reg + p.To.Offset = off +} + // XXX maybe make this part of v.Reg? // On the other hand, it is architecture-specific. func simdReg(v *ssa.Value) int16 { diff --git a/src/cmd/compile/internal/arm/ssa.go b/src/cmd/compile/internal/arm/ssa.go index f129ab493d..91ef31c215 100644 --- a/src/cmd/compile/internal/arm/ssa.go +++ b/src/cmd/compile/internal/arm/ssa.go @@ -18,6 +18,7 @@ import ( "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/arm" + "internal/abi" ) // loadByType returns the load instruction of the given type. @@ -712,18 +713,167 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { p.To.Name = obj.NAME_EXTERN // AuxInt encodes how many buffer entries we need. p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1] - case ssa.OpARMLoweredPanicBoundsA, ssa.OpARMLoweredPanicBoundsB, ssa.OpARMLoweredPanicBoundsC: - p := s.Prog(obj.ACALL) - p.To.Type = obj.TYPE_MEM - p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt] - s.UseArgs(8) // space used in callee args area by assembly stubs - case ssa.OpARMLoweredPanicExtendA, ssa.OpARMLoweredPanicExtendB, ssa.OpARMLoweredPanicExtendC: - p := s.Prog(obj.ACALL) + + case ssa.OpARMLoweredPanicBoundsRR, ssa.OpARMLoweredPanicBoundsRC, ssa.OpARMLoweredPanicBoundsCR, ssa.OpARMLoweredPanicBoundsCC, + ssa.OpARMLoweredPanicExtendRR, ssa.OpARMLoweredPanicExtendRC: + // Compute the constant we put in the PCData entry for this call. + code, signed := ssa.BoundsKind(v.AuxInt).Code() + xIsReg := false + yIsReg := false + xVal := 0 + yVal := 0 + extend := false + switch v.Op { + case ssa.OpARMLoweredPanicBoundsRR: + xIsReg = true + xVal = int(v.Args[0].Reg() - arm.REG_R0) + yIsReg = true + yVal = int(v.Args[1].Reg() - arm.REG_R0) + case ssa.OpARMLoweredPanicExtendRR: + extend = true + xIsReg = true + hi := int(v.Args[0].Reg() - arm.REG_R0) + lo := int(v.Args[1].Reg() - arm.REG_R0) + xVal = hi<<2 + lo // encode 2 register numbers + yIsReg = true + yVal = int(v.Args[2].Reg() - arm.REG_R0) + case ssa.OpARMLoweredPanicBoundsRC: + xIsReg = true + xVal = int(v.Args[0].Reg() - arm.REG_R0) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + if yVal == xVal { + yVal = 1 + } + p := s.Prog(arm.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = arm.REG_R0 + int16(yVal) + } + case ssa.OpARMLoweredPanicExtendRC: + extend = true + xIsReg = true + hi := int(v.Args[0].Reg() - arm.REG_R0) + lo := int(v.Args[1].Reg() - arm.REG_R0) + xVal = hi<<2 + lo // encode 2 register numbers + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + for yVal == hi || yVal == lo { + yVal++ + } + p := s.Prog(arm.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = arm.REG_R0 + int16(yVal) + } + case ssa.OpARMLoweredPanicBoundsCR: + yIsReg = true + yVal := int(v.Args[0].Reg() - arm.REG_R0) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else if signed && int64(int32(c)) == c || !signed && int64(uint32(c)) == c { + // Move constant to a register + xIsReg = true + if xVal == yVal { + xVal = 1 + } + p := s.Prog(arm.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = arm.REG_R0 + int16(xVal) + } else { + // Move constant to two registers + extend = true + xIsReg = true + hi := 0 + lo := 1 + if hi == yVal { + hi = 2 + } + if lo == yVal { + lo = 2 + } + xVal = hi<<2 + lo + p := s.Prog(arm.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c >> 32 + p.To.Type = obj.TYPE_REG + p.To.Reg = arm.REG_R0 + int16(hi) + p = s.Prog(arm.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = int64(int32(c)) + p.To.Type = obj.TYPE_REG + p.To.Reg = arm.REG_R0 + int16(lo) + } + case ssa.OpARMLoweredPanicBoundsCC: + c := v.Aux.(ssa.PanicBoundsCC).Cx + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else if signed && int64(int32(c)) == c || !signed && int64(uint32(c)) == c { + // Move constant to a register + xIsReg = true + p := s.Prog(arm.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = arm.REG_R0 + int16(xVal) + } else { + // Move constant to two registers + extend = true + xIsReg = true + hi := 0 + lo := 1 + xVal = hi<<2 + lo + p := s.Prog(arm.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c >> 32 + p.To.Type = obj.TYPE_REG + p.To.Reg = arm.REG_R0 + int16(hi) + p = s.Prog(arm.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = int64(int32(c)) + p.To.Type = obj.TYPE_REG + p.To.Reg = arm.REG_R0 + int16(lo) + } + c = v.Aux.(ssa.PanicBoundsCC).Cy + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + yVal = 2 + p := s.Prog(arm.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = arm.REG_R0 + int16(yVal) + } + } + c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal) + + p := s.Prog(obj.APCDATA) + p.From.SetConst(abi.PCDATA_PanicBounds) + p.To.SetConst(int64(c)) + p = s.Prog(obj.ACALL) p.To.Type = obj.TYPE_MEM p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.ExtendCheckFunc[v.AuxInt] - s.UseArgs(12) // space used in callee args area by assembly stubs + if extend { + p.To.Sym = ir.Syms.PanicExtend + } else { + p.To.Sym = ir.Syms.PanicBounds + } + case ssa.OpARMDUFFZERO: p := s.Prog(obj.ADUFFZERO) p.To.Type = obj.TYPE_MEM diff --git a/src/cmd/compile/internal/arm64/ggen.go b/src/cmd/compile/internal/arm64/ggen.go index a681adcb7f..1402746700 100644 --- a/src/cmd/compile/internal/arm64/ggen.go +++ b/src/cmd/compile/internal/arm64/ggen.go @@ -5,9 +5,7 @@ package arm64 import ( - "cmd/compile/internal/ir" "cmd/compile/internal/objw" - "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/arm64" ) @@ -22,47 +20,20 @@ func padframe(frame int64) int64 { } func zerorange(pp *objw.Progs, p *obj.Prog, off, cnt int64, _ *uint32) *obj.Prog { - if cnt == 0 { - return p + if cnt%8 != 0 { + panic("zeroed region not aligned") } - if cnt < int64(4*types.PtrSize) { - for i := int64(0); i < cnt; i += int64(types.PtrSize) { - p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGZERO, 0, obj.TYPE_MEM, arm64.REGSP, 8+off+i) - } - } else if cnt <= int64(128*types.PtrSize) { - if cnt%(2*int64(types.PtrSize)) != 0 { - p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGZERO, 0, obj.TYPE_MEM, arm64.REGSP, 8+off) - off += int64(types.PtrSize) - cnt -= int64(types.PtrSize) - } - p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGSP, 0, obj.TYPE_REG, arm64.REG_R20, 0) - p = pp.Append(p, arm64.AADD, obj.TYPE_CONST, 0, 8+off, obj.TYPE_REG, arm64.REG_R20, 0) - p.Reg = arm64.REG_R20 - p = pp.Append(p, obj.ADUFFZERO, obj.TYPE_NONE, 0, 0, obj.TYPE_MEM, 0, 0) - p.To.Name = obj.NAME_EXTERN - p.To.Sym = ir.Syms.Duffzero - p.To.Offset = 4 * (64 - cnt/(2*int64(types.PtrSize))) - } else { - // Not using REGTMP, so this is async preemptible (async preemption clobbers REGTMP). - // We are at the function entry, where no register is live, so it is okay to clobber - // other registers - const rtmp = arm64.REG_R20 - p = pp.Append(p, arm64.AMOVD, obj.TYPE_CONST, 0, 8+off-8, obj.TYPE_REG, rtmp, 0) - p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGSP, 0, obj.TYPE_REG, arm64.REGRT1, 0) - p = pp.Append(p, arm64.AADD, obj.TYPE_REG, rtmp, 0, obj.TYPE_REG, arm64.REGRT1, 0) - p.Reg = arm64.REGRT1 - p = pp.Append(p, arm64.AMOVD, obj.TYPE_CONST, 0, cnt, obj.TYPE_REG, rtmp, 0) - p = pp.Append(p, arm64.AADD, obj.TYPE_REG, rtmp, 0, obj.TYPE_REG, arm64.REGRT2, 0) - p.Reg = arm64.REGRT1 - p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGZERO, 0, obj.TYPE_MEM, arm64.REGRT1, int64(types.PtrSize)) - p.Scond = arm64.C_XPRE - p1 := p - p = pp.Append(p, arm64.ACMP, obj.TYPE_REG, arm64.REGRT1, 0, obj.TYPE_NONE, 0, 0) - p.Reg = arm64.REGRT2 - p = pp.Append(p, arm64.ABNE, obj.TYPE_NONE, 0, 0, obj.TYPE_BRANCH, 0, 0) - p.To.SetTarget(p1) + off += 8 // return address was ignored in offset calculation + for cnt >= 16 && off < 512 { + p = pp.Append(p, arm64.ASTP, obj.TYPE_REGREG, arm64.REGZERO, arm64.REGZERO, obj.TYPE_MEM, arm64.REGSP, off) + off += 16 + cnt -= 16 + } + for cnt != 0 { + p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGZERO, 0, obj.TYPE_MEM, arm64.REGSP, off) + off += 8 + cnt -= 8 } - return p } diff --git a/src/cmd/compile/internal/arm64/ssa.go b/src/cmd/compile/internal/arm64/ssa.go index 753cef743b..be7887318a 100644 --- a/src/cmd/compile/internal/arm64/ssa.go +++ b/src/cmd/compile/internal/arm64/ssa.go @@ -16,6 +16,7 @@ import ( "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/arm64" + "internal/abi" ) // loadByType returns the load instruction of the given type. @@ -1122,12 +1123,91 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { // AuxInt encodes how many buffer entries we need. p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1] - case ssa.OpARM64LoweredPanicBoundsA, ssa.OpARM64LoweredPanicBoundsB, ssa.OpARM64LoweredPanicBoundsC: - p := s.Prog(obj.ACALL) + case ssa.OpARM64LoweredPanicBoundsRR, ssa.OpARM64LoweredPanicBoundsRC, ssa.OpARM64LoweredPanicBoundsCR, ssa.OpARM64LoweredPanicBoundsCC: + // Compute the constant we put in the PCData entry for this call. + code, signed := ssa.BoundsKind(v.AuxInt).Code() + xIsReg := false + yIsReg := false + xVal := 0 + yVal := 0 + switch v.Op { + case ssa.OpARM64LoweredPanicBoundsRR: + xIsReg = true + xVal = int(v.Args[0].Reg() - arm64.REG_R0) + yIsReg = true + yVal = int(v.Args[1].Reg() - arm64.REG_R0) + case ssa.OpARM64LoweredPanicBoundsRC: + xIsReg = true + xVal = int(v.Args[0].Reg() - arm64.REG_R0) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + if yVal == xVal { + yVal = 1 + } + p := s.Prog(arm64.AMOVD) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = arm64.REG_R0 + int16(yVal) + } + case ssa.OpARM64LoweredPanicBoundsCR: + yIsReg = true + yVal := int(v.Args[0].Reg() - arm64.REG_R0) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + if xVal == yVal { + xVal = 1 + } + p := s.Prog(arm64.AMOVD) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = arm64.REG_R0 + int16(xVal) + } + case ssa.OpARM64LoweredPanicBoundsCC: + c := v.Aux.(ssa.PanicBoundsCC).Cx + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + xIsReg = true + p := s.Prog(arm64.AMOVD) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = arm64.REG_R0 + int16(xVal) + } + c = v.Aux.(ssa.PanicBoundsCC).Cy + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + yVal = 1 + p := s.Prog(arm64.AMOVD) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = arm64.REG_R0 + int16(yVal) + } + } + c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal) + + p := s.Prog(obj.APCDATA) + p.From.SetConst(abi.PCDATA_PanicBounds) + p.To.SetConst(int64(c)) + p = s.Prog(obj.ACALL) p.To.Type = obj.TYPE_MEM p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt] - s.UseArgs(16) // space used in callee args area by assembly stubs + p.To.Sym = ir.Syms.PanicBounds + case ssa.OpARM64LoweredNilCheck: // Issue a load which will fault if arg is nil. p := s.Prog(arm64.AMOVB) diff --git a/src/cmd/compile/internal/dwarfgen/dwarf.go b/src/cmd/compile/internal/dwarfgen/dwarf.go index fa13f07fdf..6ab39d2aaa 100644 --- a/src/cmd/compile/internal/dwarfgen/dwarf.go +++ b/src/cmd/compile/internal/dwarfgen/dwarf.go @@ -203,7 +203,7 @@ func createDwarfVars(fnsym *obj.LSym, complexOK bool, fn *ir.Func, apDecls []*ir continue } if n.Class != ir.PPARAMOUT || !n.IsOutputParamInRegisters() { - panic("invalid ir.Name on debugInfo.RegOutputParams list") + base.Fatalf("invalid ir.Name on debugInfo.RegOutputParams list") } dcl = append(dcl, n) } @@ -248,11 +248,6 @@ func createDwarfVars(fnsym *obj.LSym, complexOK bool, fn *ir.Func, apDecls []*ir if n.Class == ir.PPARAM || n.Class == ir.PPARAMOUT { tag = dwarf.DW_TAG_formal_parameter } - if n.Esc() == ir.EscHeap { - // The variable in question has been promoted to the heap. - // Its address is in n.Heapaddr. - // TODO(thanm): generate a better location expression - } inlIndex := 0 if base.Flag.GenDwarfInl > 1 { if n.InlFormal() || n.InlLocal() { @@ -263,7 +258,7 @@ func createDwarfVars(fnsym *obj.LSym, complexOK bool, fn *ir.Func, apDecls []*ir } } declpos := base.Ctxt.InnermostPos(n.Pos()) - vars = append(vars, &dwarf.Var{ + dvar := &dwarf.Var{ Name: n.Sym().Name, IsReturnValue: isReturnValue, Tag: tag, @@ -277,8 +272,19 @@ func createDwarfVars(fnsym *obj.LSym, complexOK bool, fn *ir.Func, apDecls []*ir ChildIndex: -1, DictIndex: n.DictIndex, ClosureOffset: closureOffset(n, closureVars), - }) - // Record go type of to insure that it gets emitted by the linker. + } + if n.Esc() == ir.EscHeap { + if n.Heapaddr == nil { + base.Fatalf("invalid heap allocated var without Heapaddr") + } + debug := fn.DebugInfo.(*ssa.FuncDebug) + list := createHeapDerefLocationList(n, debug.EntryID) + dvar.PutLocationList = func(listSym, startPC dwarf.Sym) { + debug.PutLocationList(list, base.Ctxt, listSym.(*obj.LSym), startPC.(*obj.LSym)) + } + } + vars = append(vars, dvar) + // Record go type to ensure that it gets emitted by the linker. fnsym.Func().RecordAutoType(reflectdata.TypeLinksym(n.Type())) } @@ -550,11 +556,34 @@ func createComplexVar(fnsym *obj.LSym, fn *ir.Func, varID ssa.VarID, closureVars return dvar } +// createHeapDerefLocationList creates a location list for a heap-escaped variable +// that describes "dereference pointer at stack offset" +func createHeapDerefLocationList(n *ir.Name, entryID ssa.ID) []byte { + // Get the stack offset where the heap pointer is stored + heapPtrOffset := n.Heapaddr.FrameOffset() + if base.Ctxt.Arch.FixedFrameSize == 0 { + heapPtrOffset -= int64(types.PtrSize) + } + if buildcfg.FramePointerEnabled { + heapPtrOffset -= int64(types.PtrSize) + } + + // Create a location expression: DW_OP_fbreg <offset> DW_OP_deref + var locExpr []byte + var sizeIdx int + locExpr, sizeIdx = ssa.SetupLocList(base.Ctxt, entryID, locExpr, ssa.BlockStart.ID, ssa.FuncEnd.ID) + locExpr = append(locExpr, dwarf.DW_OP_fbreg) + locExpr = dwarf.AppendSleb128(locExpr, heapPtrOffset) + locExpr = append(locExpr, dwarf.DW_OP_deref) + base.Ctxt.Arch.ByteOrder.PutUint16(locExpr[sizeIdx:], uint16(len(locExpr)-sizeIdx-2)) + return locExpr +} + // RecordFlags records the specified command-line flags to be placed // in the DWARF info. func RecordFlags(flags ...string) { if base.Ctxt.Pkgpath == "" { - panic("missing pkgpath") + base.Fatalf("missing pkgpath") } type BoolFlag interface { diff --git a/src/cmd/compile/internal/escape/call.go b/src/cmd/compile/internal/escape/call.go index 58c44eb9bb..f9351de975 100644 --- a/src/cmd/compile/internal/escape/call.go +++ b/src/cmd/compile/internal/escape/call.go @@ -192,7 +192,7 @@ func (e *escape) call(ks []hole, call ir.Node) { e.discard(call.X) e.discard(call.Y) - case ir.ODELETE, ir.OPRINT, ir.OPRINTLN, ir.ORECOVERFP: + case ir.ODELETE, ir.OPRINT, ir.OPRINTLN, ir.ORECOVER: call := call.(*ir.CallExpr) for _, arg := range call.Args { e.discard(arg) diff --git a/src/cmd/compile/internal/escape/escape.go b/src/cmd/compile/internal/escape/escape.go index 72d40bd258..6b34830b3d 100644 --- a/src/cmd/compile/internal/escape/escape.go +++ b/src/cmd/compile/internal/escape/escape.go @@ -122,17 +122,24 @@ type escape struct { } func Funcs(all []*ir.Func) { - ir.VisitFuncsBottomUp(all, Batch) + // Make a cache of ir.ReassignOracles. The cache is lazily populated. + // TODO(thepudds): consider adding a field on ir.Func instead. We might also be able + // to use that field elsewhere, like in walk. See discussion in https://go.dev/cl/688075. + reassignOracles := make(map[*ir.Func]*ir.ReassignOracle) + + ir.VisitFuncsBottomUp(all, func(list []*ir.Func, recursive bool) { + Batch(list, reassignOracles) + }) } // Batch performs escape analysis on a minimal batch of // functions. -func Batch(fns []*ir.Func, recursive bool) { +func Batch(fns []*ir.Func, reassignOracles map[*ir.Func]*ir.ReassignOracle) { var b batch b.heapLoc.attrs = attrEscapes | attrPersists | attrMutates | attrCalls b.mutatorLoc.attrs = attrMutates b.calleeLoc.attrs = attrCalls - b.reassignOracles = make(map[*ir.Func]*ir.ReassignOracle) + b.reassignOracles = reassignOracles // Construct data-flow graph from syntax trees. for _, fn := range fns { @@ -531,19 +538,9 @@ func (b *batch) rewriteWithLiterals(n ir.Node, fn *ir.Func) { if n == nil || fn == nil { return } - if n.Op() != ir.OMAKESLICE && n.Op() != ir.OCONVIFACE { - return - } - // Look up a cached ReassignOracle for the function, lazily computing one if needed. - ro := b.reassignOracle(fn) - if ro == nil { - base.Fatalf("no ReassignOracle for function %v with closure parent %v", fn, fn.ClosureParent) - } - - assignTemp := func(n ir.Node, init *ir.Nodes) { + assignTemp := func(pos src.XPos, n ir.Node, init *ir.Nodes) { // Preserve any side effects of n by assigning it to an otherwise unused temp. - pos := n.Pos() tmp := typecheck.TempAt(pos, fn, n.Type()) init.Append(typecheck.Stmt(ir.NewDecl(pos, ir.ODCL, tmp))) init.Append(typecheck.Stmt(ir.NewAssignStmt(pos, tmp, n))) @@ -561,6 +558,11 @@ func (b *batch) rewriteWithLiterals(n ir.Node, fn *ir.Func) { } if (*r).Op() != ir.OLITERAL { + // Look up a cached ReassignOracle for the function, lazily computing one if needed. + ro := b.reassignOracle(fn) + if ro == nil { + base.Fatalf("no ReassignOracle for function %v with closure parent %v", fn, fn.ClosureParent) + } if s := ro.StaticValue(*r); s.Op() == ir.OLITERAL { lit, ok := s.(*ir.BasicLit) if !ok || lit.Val().Kind() != constant.Int { @@ -572,8 +574,8 @@ func (b *batch) rewriteWithLiterals(n ir.Node, fn *ir.Func) { return } // Preserve any side effects of the original expression, then replace it. - assignTemp(*r, n.PtrInit()) - *r = lit + assignTemp(n.Pos(), *r, n.PtrInit()) + *r = ir.NewBasicLit(n.Pos(), (*r).Type(), lit.Val()) } } } @@ -582,6 +584,12 @@ func (b *batch) rewriteWithLiterals(n ir.Node, fn *ir.Func) { // a literal to avoid heap allocating the underlying interface value. conv := n.(*ir.ConvExpr) if conv.X.Op() != ir.OLITERAL && !conv.X.Type().IsInterface() { + // TODO(thepudds): likely could avoid some work by tightening the check of conv.X's type. + // Look up a cached ReassignOracle for the function, lazily computing one if needed. + ro := b.reassignOracle(fn) + if ro == nil { + base.Fatalf("no ReassignOracle for function %v with closure parent %v", fn, fn.ClosureParent) + } v := ro.StaticValue(conv.X) if v != nil && v.Op() == ir.OLITERAL && ir.ValidTypeForConst(conv.X.Type(), v.Val()) { if !base.LiteralAllocHash.MatchPos(n.Pos(), nil) { @@ -592,9 +600,9 @@ func (b *batch) rewriteWithLiterals(n ir.Node, fn *ir.Func) { base.WarnfAt(n.Pos(), "rewriting OCONVIFACE value from %v (%v) to %v (%v)", conv.X, conv.X.Type(), v, v.Type()) } // Preserve any side effects of the original expression, then replace it. - assignTemp(conv.X, conv.PtrInit()) + assignTemp(conv.Pos(), conv.X, conv.PtrInit()) v := v.(*ir.BasicLit) - conv.X = ir.NewBasicLit(conv.X.Pos(), conv.X.Type(), v.Val()) + conv.X = ir.NewBasicLit(conv.Pos(), conv.X.Type(), v.Val()) typecheck.Expr(conv) } } diff --git a/src/cmd/compile/internal/escape/expr.go b/src/cmd/compile/internal/escape/expr.go index f479a2913a..1521c2edd1 100644 --- a/src/cmd/compile/internal/escape/expr.go +++ b/src/cmd/compile/internal/escape/expr.go @@ -139,7 +139,7 @@ func (e *escape) exprSkipInit(k hole, n ir.Node) { e.discard(n.X) case ir.OCALLMETH, ir.OCALLFUNC, ir.OCALLINTER, ir.OINLCALL, - ir.OLEN, ir.OCAP, ir.OMIN, ir.OMAX, ir.OCOMPLEX, ir.OREAL, ir.OIMAG, ir.OAPPEND, ir.OCOPY, ir.ORECOVERFP, + ir.OLEN, ir.OCAP, ir.OMIN, ir.OMAX, ir.OCOMPLEX, ir.OREAL, ir.OIMAG, ir.OAPPEND, ir.OCOPY, ir.ORECOVER, ir.OUNSAFEADD, ir.OUNSAFESLICE, ir.OUNSAFESTRING, ir.OUNSAFESTRINGDATA, ir.OUNSAFESLICEDATA: e.call([]hole{k}, n) diff --git a/src/cmd/compile/internal/escape/stmt.go b/src/cmd/compile/internal/escape/stmt.go index b766864a30..2388873caf 100644 --- a/src/cmd/compile/internal/escape/stmt.go +++ b/src/cmd/compile/internal/escape/stmt.go @@ -183,7 +183,7 @@ func (e *escape) stmt(n ir.Node) { dsts[i] = res.Nname.(*ir.Name) } e.assignList(dsts, n.Results, "return", n) - case ir.OCALLFUNC, ir.OCALLMETH, ir.OCALLINTER, ir.OINLCALL, ir.OCLEAR, ir.OCLOSE, ir.OCOPY, ir.ODELETE, ir.OPANIC, ir.OPRINT, ir.OPRINTLN, ir.ORECOVERFP: + case ir.OCALLFUNC, ir.OCALLMETH, ir.OCALLINTER, ir.OINLCALL, ir.OCLEAR, ir.OCLOSE, ir.OCOPY, ir.ODELETE, ir.OPANIC, ir.OPRINT, ir.OPRINTLN, ir.ORECOVER: e.call(nil, n) case ir.OGO, ir.ODEFER: n := n.(*ir.GoDeferStmt) diff --git a/src/cmd/compile/internal/gc/main.go b/src/cmd/compile/internal/gc/main.go index 20899df04d..918d3f3514 100644 --- a/src/cmd/compile/internal/gc/main.go +++ b/src/cmd/compile/internal/gc/main.go @@ -104,12 +104,10 @@ func Main(archInit func(*ssagen.ArchInfo)) { ir.Pkgs.Runtime = types.NewPkg("go.runtime", "runtime") ir.Pkgs.Runtime.Prefix = "runtime" - if buildcfg.Experiment.SwissMap { - // Pseudo-package that contains the compiler's builtin - // declarations for maps. - ir.Pkgs.InternalMaps = types.NewPkg("go.internal/runtime/maps", "internal/runtime/maps") - ir.Pkgs.InternalMaps.Prefix = "internal/runtime/maps" - } + // Pseudo-package that contains the compiler's builtin + // declarations for maps. + ir.Pkgs.InternalMaps = types.NewPkg("go.internal/runtime/maps", "internal/runtime/maps") + ir.Pkgs.InternalMaps.Prefix = "internal/runtime/maps" // pseudo-packages used in symbol tables ir.Pkgs.Itab = types.NewPkg("go.itab", "go.itab") diff --git a/src/cmd/compile/internal/importer/gcimporter_test.go b/src/cmd/compile/internal/importer/gcimporter_test.go index 965c5d1a84..11e4ee6b58 100644 --- a/src/cmd/compile/internal/importer/gcimporter_test.go +++ b/src/cmd/compile/internal/importer/gcimporter_test.go @@ -673,3 +673,50 @@ type S struct { } wg.Wait() } + +func TestIssue63285(t *testing.T) { + testenv.MustHaveGoBuild(t) + + // This package only handles gc export data. + if runtime.Compiler != "gc" { + t.Skipf("gc-built packages not available (compiler = %s)", runtime.Compiler) + } + + tmpdir := t.TempDir() + testoutdir := filepath.Join(tmpdir, "testdata") + if err := os.Mkdir(testoutdir, 0700); err != nil { + t.Fatalf("making output dir: %v", err) + } + + compile(t, "testdata", "issue63285.go", testoutdir, nil) + + issue63285, err := Import(make(map[string]*types2.Package), "./testdata/issue63285", tmpdir, nil) + if err != nil { + t.Fatal(err) + } + + check := func(pkgname, src string, imports importMap) (*types2.Package, error) { + f, err := syntax.Parse(syntax.NewFileBase(pkgname), strings.NewReader(src), nil, nil, 0) + if err != nil { + return nil, err + } + config := &types2.Config{ + Importer: imports, + } + return config.Check(pkgname, []*syntax.File{f}, nil) + } + + const pSrc = `package p + +import "issue63285" + +var _ issue63285.A[issue63285.B[any]] +` + + importer := importMap{ + "issue63285": issue63285, + } + if _, err := check("p", pSrc, importer); err != nil { + t.Errorf("Check failed: %v", err) + } +} diff --git a/src/cmd/compile/internal/importer/testdata/issue63285.go b/src/cmd/compile/internal/importer/testdata/issue63285.go new file mode 100644 index 0000000000..54a06b7b88 --- /dev/null +++ b/src/cmd/compile/internal/importer/testdata/issue63285.go @@ -0,0 +1,11 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package issue63285 + +type A[_ B[any]] struct{} + +type B[_ any] interface { + f() A[B[any]] +} diff --git a/src/cmd/compile/internal/importer/ureader.go b/src/cmd/compile/internal/importer/ureader.go index 6012d283ac..f6df56b70e 100644 --- a/src/cmd/compile/internal/importer/ureader.go +++ b/src/cmd/compile/internal/importer/ureader.go @@ -67,7 +67,8 @@ type reader struct { p *pkgReader - dict *readerDict + dict *readerDict + delayed []func() } type readerDict struct { @@ -420,7 +421,7 @@ func (pr *pkgReader) objIdx(idx pkgbits.Index) (*types2.Package, string) { pos := r.pos() var tparams []*types2.TypeParam if r.Version().Has(pkgbits.AliasTypeParamNames) { - tparams = r.typeParamNames() + tparams = r.typeParamNames(false) } typ := r.typ() return newAliasTypeName(pr.enableAlias, pos, objPkg, objName, typ, tparams) @@ -433,28 +434,28 @@ func (pr *pkgReader) objIdx(idx pkgbits.Index) (*types2.Package, string) { case pkgbits.ObjFunc: pos := r.pos() - tparams := r.typeParamNames() + tparams := r.typeParamNames(false) sig := r.signature(nil, nil, tparams) return types2.NewFunc(pos, objPkg, objName, sig) case pkgbits.ObjType: pos := r.pos() - return types2.NewTypeNameLazy(pos, objPkg, objName, func(named *types2.Named) (tparams []*types2.TypeParam, underlying types2.Type, methods []*types2.Func) { - tparams = r.typeParamNames() + return types2.NewTypeNameLazy(pos, objPkg, objName, func(_ *types2.Named) ([]*types2.TypeParam, types2.Type, []*types2.Func, []func()) { + tparams := r.typeParamNames(true) // TODO(mdempsky): Rewrite receiver types to underlying is an // Interface? The go/types importer does this (I think because // unit tests expected that), but cmd/compile doesn't care // about it, so maybe we can avoid worrying about that here. - underlying = r.typ().Underlying() + underlying := r.typ().Underlying() - methods = make([]*types2.Func, r.Len()) + methods := make([]*types2.Func, r.Len()) for i := range methods { - methods[i] = r.method() + methods[i] = r.method(true) } - return + return tparams, underlying, methods, r.delayed }) case pkgbits.ObjVar: @@ -497,7 +498,7 @@ func (pr *pkgReader) objDictIdx(idx pkgbits.Index) *readerDict { return &dict } -func (r *reader) typeParamNames() []*types2.TypeParam { +func (r *reader) typeParamNames(isLazy bool) []*types2.TypeParam { r.Sync(pkgbits.SyncTypeParamNames) // Note: This code assumes it only processes objects without @@ -523,19 +524,38 @@ func (r *reader) typeParamNames() []*types2.TypeParam { r.dict.tparams[i] = types2.NewTypeParam(tname, nil) } - for i, bound := range r.dict.bounds { - r.dict.tparams[i].SetConstraint(r.p.typIdx(bound, r.dict)) + // Type parameters that are read by lazy loaders cannot have their + // constraints set eagerly; do them after loading (go.dev/issue/63285). + if isLazy { + // The reader dictionary will continue mutating before we have time + // to call delayed functions; must make a local copy of both the type + // parameters and their (unexpanded) constraints. + bounds := make([]types2.Type, len(r.dict.bounds)) + for i, bound := range r.dict.bounds { + bounds[i] = r.p.typIdx(bound, r.dict) + } + + tparams := r.dict.tparams + r.delayed = append(r.delayed, func() { + for i, bound := range bounds { + tparams[i].SetConstraint(bound) + } + }) + } else { + for i, bound := range r.dict.bounds { + r.dict.tparams[i].SetConstraint(r.p.typIdx(bound, r.dict)) + } } return r.dict.tparams } -func (r *reader) method() *types2.Func { +func (r *reader) method(isLazy bool) *types2.Func { r.Sync(pkgbits.SyncMethod) pos := r.pos() pkg, name := r.selector() - rtparams := r.typeParamNames() + rtparams := r.typeParamNames(isLazy) sig := r.signature(r.param(), rtparams, nil) _ = r.pos() // TODO(mdempsky): Remove; this is a hacker for linker.go. diff --git a/src/cmd/compile/internal/inline/inl.go b/src/cmd/compile/internal/inline/inl.go index 459c2498fc..c06f76fe9f 100644 --- a/src/cmd/compile/internal/inline/inl.go +++ b/src/cmd/compile/internal/inline/inl.go @@ -605,10 +605,7 @@ opSwitch: v.budget -= inlineExtraPanicCost case ir.ORECOVER: - base.FatalfAt(n.Pos(), "ORECOVER missed typecheck") - case ir.ORECOVERFP: - // recover matches the argument frame pointer to find - // the right panic value, so it needs an argument frame. + // TODO: maybe we could allow inlining of recover() now? v.reason = "call to recover" return true diff --git a/src/cmd/compile/internal/inline/inlheur/analyze_func_flags.go b/src/cmd/compile/internal/inline/inlheur/analyze_func_flags.go index d86fd7d71b..22312e2241 100644 --- a/src/cmd/compile/internal/inline/inlheur/analyze_func_flags.go +++ b/src/cmd/compile/internal/inline/inlheur/analyze_func_flags.go @@ -335,7 +335,7 @@ func (ffa *funcFlagsAnalyzer) nodeVisitPost(n ir.Node) { ir.OPRINTLN, ir.OPRINT, ir.OLABEL, ir.OCALLINTER, ir.ODEFER, ir.OSEND, ir.ORECV, ir.OSELRECV2, ir.OGO, ir.OAPPEND, ir.OAS2DOTTYPE, ir.OAS2MAPR, ir.OGETG, ir.ODELETE, ir.OINLMARK, ir.OAS2RECV, - ir.OMIN, ir.OMAX, ir.OMAKE, ir.ORECOVERFP, ir.OGETCALLERSP: + ir.OMIN, ir.OMAX, ir.OMAKE, ir.OGETCALLERSP: // these should all be benign/uninteresting case ir.OTAILCALL, ir.OJUMPTABLE, ir.OTYPESW: // don't expect to see these at all. diff --git a/src/cmd/compile/internal/ir/expr.go b/src/cmd/compile/internal/ir/expr.go index e27e4336c9..d07e522d95 100644 --- a/src/cmd/compile/internal/ir/expr.go +++ b/src/cmd/compile/internal/ir/expr.go @@ -213,7 +213,7 @@ func (n *CallExpr) SetOp(op Op) { ODELETE, OGETG, OGETCALLERSP, OMAKE, OMAX, OMIN, OPRINT, OPRINTLN, - ORECOVER, ORECOVERFP: + ORECOVER: n.op = op } } @@ -912,12 +912,12 @@ FindRHS: break FindRHS } } - base.Fatalf("%v missing from LHS of %v", n, defn) + base.FatalfAt(defn.Pos(), "%v missing from LHS of %v", n, defn) default: return nil } if rhs == nil { - base.Fatalf("RHS is nil: %v", defn) + base.FatalfAt(defn.Pos(), "RHS is nil: %v", defn) } if Reassigned(n) { diff --git a/src/cmd/compile/internal/ir/node.go b/src/cmd/compile/internal/ir/node.go index 058ada5ac3..003ec15de1 100644 --- a/src/cmd/compile/internal/ir/node.go +++ b/src/cmd/compile/internal/ir/node.go @@ -234,7 +234,6 @@ const ( OSLICEHEADER // sliceheader{Ptr, Len, Cap} (Ptr is unsafe.Pointer, Len is length, Cap is capacity) OSTRINGHEADER // stringheader{Ptr, Len} (Ptr is unsafe.Pointer, Len is length) ORECOVER // recover() - ORECOVERFP // recover(Args) w/ explicit FP argument ORECV // <-X ORUNESTR // Type(X) (Type is string, X is rune) OSELRECV2 // like OAS2: Lhs = Rhs where len(Lhs)=2, len(Rhs)=1, Rhs[0].Op = ORECV (appears as .Var of OCASE) diff --git a/src/cmd/compile/internal/ir/op_string.go b/src/cmd/compile/internal/ir/op_string.go index a1806d1349..7494beee4c 100644 --- a/src/cmd/compile/internal/ir/op_string.go +++ b/src/cmd/compile/internal/ir/op_string.go @@ -108,62 +108,61 @@ func _() { _ = x[OSLICEHEADER-97] _ = x[OSTRINGHEADER-98] _ = x[ORECOVER-99] - _ = x[ORECOVERFP-100] - _ = x[ORECV-101] - _ = x[ORUNESTR-102] - _ = x[OSELRECV2-103] - _ = x[OMIN-104] - _ = x[OMAX-105] - _ = x[OREAL-106] - _ = x[OIMAG-107] - _ = x[OCOMPLEX-108] - _ = x[OUNSAFEADD-109] - _ = x[OUNSAFESLICE-110] - _ = x[OUNSAFESLICEDATA-111] - _ = x[OUNSAFESTRING-112] - _ = x[OUNSAFESTRINGDATA-113] - _ = x[OMETHEXPR-114] - _ = x[OMETHVALUE-115] - _ = x[OBLOCK-116] - _ = x[OBREAK-117] - _ = x[OCASE-118] - _ = x[OCONTINUE-119] - _ = x[ODEFER-120] - _ = x[OFALL-121] - _ = x[OFOR-122] - _ = x[OGOTO-123] - _ = x[OIF-124] - _ = x[OLABEL-125] - _ = x[OGO-126] - _ = x[ORANGE-127] - _ = x[ORETURN-128] - _ = x[OSELECT-129] - _ = x[OSWITCH-130] - _ = x[OTYPESW-131] - _ = x[OINLCALL-132] - _ = x[OMAKEFACE-133] - _ = x[OITAB-134] - _ = x[OIDATA-135] - _ = x[OSPTR-136] - _ = x[OCFUNC-137] - _ = x[OCHECKNIL-138] - _ = x[ORESULT-139] - _ = x[OINLMARK-140] - _ = x[OLINKSYMOFFSET-141] - _ = x[OJUMPTABLE-142] - _ = x[OINTERFACESWITCH-143] - _ = x[ODYNAMICDOTTYPE-144] - _ = x[ODYNAMICDOTTYPE2-145] - _ = x[ODYNAMICTYPE-146] - _ = x[OTAILCALL-147] - _ = x[OGETG-148] - _ = x[OGETCALLERSP-149] - _ = x[OEND-150] + _ = x[ORECV-100] + _ = x[ORUNESTR-101] + _ = x[OSELRECV2-102] + _ = x[OMIN-103] + _ = x[OMAX-104] + _ = x[OREAL-105] + _ = x[OIMAG-106] + _ = x[OCOMPLEX-107] + _ = x[OUNSAFEADD-108] + _ = x[OUNSAFESLICE-109] + _ = x[OUNSAFESLICEDATA-110] + _ = x[OUNSAFESTRING-111] + _ = x[OUNSAFESTRINGDATA-112] + _ = x[OMETHEXPR-113] + _ = x[OMETHVALUE-114] + _ = x[OBLOCK-115] + _ = x[OBREAK-116] + _ = x[OCASE-117] + _ = x[OCONTINUE-118] + _ = x[ODEFER-119] + _ = x[OFALL-120] + _ = x[OFOR-121] + _ = x[OGOTO-122] + _ = x[OIF-123] + _ = x[OLABEL-124] + _ = x[OGO-125] + _ = x[ORANGE-126] + _ = x[ORETURN-127] + _ = x[OSELECT-128] + _ = x[OSWITCH-129] + _ = x[OTYPESW-130] + _ = x[OINLCALL-131] + _ = x[OMAKEFACE-132] + _ = x[OITAB-133] + _ = x[OIDATA-134] + _ = x[OSPTR-135] + _ = x[OCFUNC-136] + _ = x[OCHECKNIL-137] + _ = x[ORESULT-138] + _ = x[OINLMARK-139] + _ = x[OLINKSYMOFFSET-140] + _ = x[OJUMPTABLE-141] + _ = x[OINTERFACESWITCH-142] + _ = x[ODYNAMICDOTTYPE-143] + _ = x[ODYNAMICDOTTYPE2-144] + _ = x[ODYNAMICTYPE-145] + _ = x[OTAILCALL-146] + _ = x[OGETG-147] + _ = x[OGETCALLERSP-148] + _ = x[OEND-149] } -const _Op_name = "XXXNAMENONAMETYPELITERALNILADDSUBORXORADDSTRADDRANDANDAPPENDBYTES2STRBYTES2STRTMPRUNES2STRSTR2BYTESSTR2BYTESTMPSTR2RUNESSLICE2ARRSLICE2ARRPTRASAS2AS2DOTTYPEAS2FUNCAS2MAPRAS2RECVASOPCALLCALLFUNCCALLMETHCALLINTERCAPCLEARCLOSECLOSURECOMPLITMAPLITSTRUCTLITARRAYLITSLICELITPTRLITCONVCONVIFACECONVNOPCOPYDCLDCLFUNCDELETEDOTDOTPTRDOTMETHDOTINTERXDOTDOTTYPEDOTTYPE2EQNELTLEGEGTDEREFINDEXINDEXMAPKEYSTRUCTKEYLENMAKEMAKECHANMAKEMAPMAKESLICEMAKESLICECOPYMULDIVMODLSHRSHANDANDNOTNEWNOTBITNOTPLUSNEGORORPANICPRINTPRINTLNPARENSENDSLICESLICEARRSLICESTRSLICE3SLICE3ARRSLICEHEADERSTRINGHEADERRECOVERRECOVERFPRECVRUNESTRSELRECV2MINMAXREALIMAGCOMPLEXUNSAFEADDUNSAFESLICEUNSAFESLICEDATAUNSAFESTRINGUNSAFESTRINGDATAMETHEXPRMETHVALUEBLOCKBREAKCASECONTINUEDEFERFALLFORGOTOIFLABELGORANGERETURNSELECTSWITCHTYPESWINLCALLMAKEFACEITABIDATASPTRCFUNCCHECKNILRESULTINLMARKLINKSYMOFFSETJUMPTABLEINTERFACESWITCHDYNAMICDOTTYPEDYNAMICDOTTYPE2DYNAMICTYPETAILCALLGETGGETCALLERSPEND" +const _Op_name = "XXXNAMENONAMETYPELITERALNILADDSUBORXORADDSTRADDRANDANDAPPENDBYTES2STRBYTES2STRTMPRUNES2STRSTR2BYTESSTR2BYTESTMPSTR2RUNESSLICE2ARRSLICE2ARRPTRASAS2AS2DOTTYPEAS2FUNCAS2MAPRAS2RECVASOPCALLCALLFUNCCALLMETHCALLINTERCAPCLEARCLOSECLOSURECOMPLITMAPLITSTRUCTLITARRAYLITSLICELITPTRLITCONVCONVIFACECONVNOPCOPYDCLDCLFUNCDELETEDOTDOTPTRDOTMETHDOTINTERXDOTDOTTYPEDOTTYPE2EQNELTLEGEGTDEREFINDEXINDEXMAPKEYSTRUCTKEYLENMAKEMAKECHANMAKEMAPMAKESLICEMAKESLICECOPYMULDIVMODLSHRSHANDANDNOTNEWNOTBITNOTPLUSNEGORORPANICPRINTPRINTLNPARENSENDSLICESLICEARRSLICESTRSLICE3SLICE3ARRSLICEHEADERSTRINGHEADERRECOVERRECVRUNESTRSELRECV2MINMAXREALIMAGCOMPLEXUNSAFEADDUNSAFESLICEUNSAFESLICEDATAUNSAFESTRINGUNSAFESTRINGDATAMETHEXPRMETHVALUEBLOCKBREAKCASECONTINUEDEFERFALLFORGOTOIFLABELGORANGERETURNSELECTSWITCHTYPESWINLCALLMAKEFACEITABIDATASPTRCFUNCCHECKNILRESULTINLMARKLINKSYMOFFSETJUMPTABLEINTERFACESWITCHDYNAMICDOTTYPEDYNAMICDOTTYPE2DYNAMICTYPETAILCALLGETGGETCALLERSPEND" -var _Op_index = [...]uint16{0, 3, 7, 13, 17, 24, 27, 30, 33, 35, 38, 44, 48, 54, 60, 69, 81, 90, 99, 111, 120, 129, 141, 143, 146, 156, 163, 170, 177, 181, 185, 193, 201, 210, 213, 218, 223, 230, 237, 243, 252, 260, 268, 274, 278, 287, 294, 298, 301, 308, 314, 317, 323, 330, 338, 342, 349, 357, 359, 361, 363, 365, 367, 369, 374, 379, 387, 390, 399, 402, 406, 414, 421, 430, 443, 446, 449, 452, 455, 458, 461, 467, 470, 473, 479, 483, 486, 490, 495, 500, 507, 512, 516, 521, 529, 537, 543, 552, 563, 575, 582, 591, 595, 602, 610, 613, 616, 620, 624, 631, 640, 651, 666, 678, 694, 702, 711, 716, 721, 725, 733, 738, 742, 745, 749, 751, 756, 758, 763, 769, 775, 781, 787, 794, 802, 806, 811, 815, 820, 828, 834, 841, 854, 863, 878, 892, 907, 918, 926, 930, 941, 944} +var _Op_index = [...]uint16{0, 3, 7, 13, 17, 24, 27, 30, 33, 35, 38, 44, 48, 54, 60, 69, 81, 90, 99, 111, 120, 129, 141, 143, 146, 156, 163, 170, 177, 181, 185, 193, 201, 210, 213, 218, 223, 230, 237, 243, 252, 260, 268, 274, 278, 287, 294, 298, 301, 308, 314, 317, 323, 330, 338, 342, 349, 357, 359, 361, 363, 365, 367, 369, 374, 379, 387, 390, 399, 402, 406, 414, 421, 430, 443, 446, 449, 452, 455, 458, 461, 467, 470, 473, 479, 483, 486, 490, 495, 500, 507, 512, 516, 521, 529, 537, 543, 552, 563, 575, 582, 586, 593, 601, 604, 607, 611, 615, 622, 631, 642, 657, 669, 685, 693, 702, 707, 712, 716, 724, 729, 733, 736, 740, 742, 747, 749, 754, 760, 766, 772, 778, 785, 793, 797, 802, 806, 811, 819, 825, 832, 845, 854, 869, 883, 898, 909, 917, 921, 932, 935} func (i Op) String() string { if i >= Op(len(_Op_index)-1) { diff --git a/src/cmd/compile/internal/ir/reassignment.go b/src/cmd/compile/internal/ir/reassignment.go index ff54f708c2..ba14d078a2 100644 --- a/src/cmd/compile/internal/ir/reassignment.go +++ b/src/cmd/compile/internal/ir/reassignment.go @@ -178,12 +178,12 @@ FindRHS: break FindRHS } } - base.Fatalf("%v missing from LHS of %v", n, defn) + base.FatalfAt(defn.Pos(), "%v missing from LHS of %v", n, defn) default: return nil } if rhs == nil { - base.Fatalf("RHS is nil: %v", defn) + base.FatalfAt(defn.Pos(), "RHS is nil: %v", defn) } if _, ok := ro.singleDef[n]; !ok { diff --git a/src/cmd/compile/internal/ir/symtab.go b/src/cmd/compile/internal/ir/symtab.go index e2da710f02..ee0f52fbf3 100644 --- a/src/cmd/compile/internal/ir/symtab.go +++ b/src/cmd/compile/internal/ir/symtab.go @@ -37,6 +37,8 @@ type symsStruct struct { Msanmove *obj.LSym Newobject *obj.LSym Newproc *obj.LSym + PanicBounds *obj.LSym + PanicExtend *obj.LSym Panicdivide *obj.LSym Panicshift *obj.LSym PanicdottypeE *obj.LSym diff --git a/src/cmd/compile/internal/liveness/plive.go b/src/cmd/compile/internal/liveness/plive.go index b9d3030e96..6c1435c724 100644 --- a/src/cmd/compile/internal/liveness/plive.go +++ b/src/cmd/compile/internal/liveness/plive.go @@ -769,7 +769,7 @@ func (lv *Liveness) epilogue() { // its stack copy is not live. continue } - // Note: zeroing is handled by zeroResults in walk.go. + // Note: zeroing is handled by zeroResults in ../ssagen/ssa.go. livedefer.Set(int32(i)) } if n.IsOutputParamHeapAddr() { diff --git a/src/cmd/compile/internal/loong64/ssa.go b/src/cmd/compile/internal/loong64/ssa.go index a71a5c3e43..2d986a5ff4 100644 --- a/src/cmd/compile/internal/loong64/ssa.go +++ b/src/cmd/compile/internal/loong64/ssa.go @@ -16,6 +16,7 @@ import ( "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/loong64" + "internal/abi" ) // isFPreg reports whether r is an FP register. @@ -663,12 +664,92 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { p.From.Type = obj.TYPE_CONST p.From.Offset = 0x1A - case ssa.OpLOONG64LoweredPanicBoundsA, ssa.OpLOONG64LoweredPanicBoundsB, ssa.OpLOONG64LoweredPanicBoundsC: - p := s.Prog(obj.ACALL) + case ssa.OpLOONG64LoweredPanicBoundsRR, ssa.OpLOONG64LoweredPanicBoundsRC, ssa.OpLOONG64LoweredPanicBoundsCR, ssa.OpLOONG64LoweredPanicBoundsCC: + // Compute the constant we put in the PCData entry for this call. + code, signed := ssa.BoundsKind(v.AuxInt).Code() + xIsReg := false + yIsReg := false + xVal := 0 + yVal := 0 + switch v.Op { + case ssa.OpLOONG64LoweredPanicBoundsRR: + xIsReg = true + xVal = int(v.Args[0].Reg() - loong64.REG_R4) + yIsReg = true + yVal = int(v.Args[1].Reg() - loong64.REG_R4) + case ssa.OpLOONG64LoweredPanicBoundsRC: + xIsReg = true + xVal = int(v.Args[0].Reg() - loong64.REG_R4) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + if yVal == xVal { + yVal = 1 + } + p := s.Prog(loong64.AMOVV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = loong64.REG_R4 + int16(yVal) + } + case ssa.OpLOONG64LoweredPanicBoundsCR: + yIsReg = true + yVal := int(v.Args[0].Reg() - loong64.REG_R4) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + xIsReg = true + if xVal == yVal { + xVal = 1 + } + p := s.Prog(loong64.AMOVV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = loong64.REG_R4 + int16(xVal) + } + case ssa.OpLOONG64LoweredPanicBoundsCC: + c := v.Aux.(ssa.PanicBoundsCC).Cx + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + xIsReg = true + p := s.Prog(loong64.AMOVV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = loong64.REG_R4 + int16(xVal) + } + c = v.Aux.(ssa.PanicBoundsCC).Cy + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + yVal = 1 + p := s.Prog(loong64.AMOVV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = loong64.REG_R4 + int16(yVal) + } + } + c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal) + + p := s.Prog(obj.APCDATA) + p.From.SetConst(abi.PCDATA_PanicBounds) + p.To.SetConst(int64(c)) + p = s.Prog(obj.ACALL) p.To.Type = obj.TYPE_MEM p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt] - s.UseArgs(16) // space used in callee args area by assembly stubs + p.To.Sym = ir.Syms.PanicBounds + case ssa.OpLOONG64LoweredAtomicLoad8, ssa.OpLOONG64LoweredAtomicLoad32, ssa.OpLOONG64LoweredAtomicLoad64: // MOVB (Rarg0), Rout // DBAR 0x14 diff --git a/src/cmd/compile/internal/mips/ssa.go b/src/cmd/compile/internal/mips/ssa.go index 9762554829..7390db2945 100644 --- a/src/cmd/compile/internal/mips/ssa.go +++ b/src/cmd/compile/internal/mips/ssa.go @@ -15,6 +15,7 @@ import ( "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/mips" + "internal/abi" ) // isFPreg reports whether r is an FP register. @@ -486,18 +487,167 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { p.To.Name = obj.NAME_EXTERN // AuxInt encodes how many buffer entries we need. p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1] - case ssa.OpMIPSLoweredPanicBoundsA, ssa.OpMIPSLoweredPanicBoundsB, ssa.OpMIPSLoweredPanicBoundsC: - p := s.Prog(obj.ACALL) - p.To.Type = obj.TYPE_MEM - p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt] - s.UseArgs(8) // space used in callee args area by assembly stubs - case ssa.OpMIPSLoweredPanicExtendA, ssa.OpMIPSLoweredPanicExtendB, ssa.OpMIPSLoweredPanicExtendC: - p := s.Prog(obj.ACALL) + + case ssa.OpMIPSLoweredPanicBoundsRR, ssa.OpMIPSLoweredPanicBoundsRC, ssa.OpMIPSLoweredPanicBoundsCR, ssa.OpMIPSLoweredPanicBoundsCC, + ssa.OpMIPSLoweredPanicExtendRR, ssa.OpMIPSLoweredPanicExtendRC: + // Compute the constant we put in the PCData entry for this call. + code, signed := ssa.BoundsKind(v.AuxInt).Code() + xIsReg := false + yIsReg := false + xVal := 0 + yVal := 0 + extend := false + switch v.Op { + case ssa.OpMIPSLoweredPanicBoundsRR: + xIsReg = true + xVal = int(v.Args[0].Reg() - mips.REG_R1) + yIsReg = true + yVal = int(v.Args[1].Reg() - mips.REG_R1) + case ssa.OpMIPSLoweredPanicExtendRR: + extend = true + xIsReg = true + hi := int(v.Args[0].Reg() - mips.REG_R1) + lo := int(v.Args[1].Reg() - mips.REG_R1) + xVal = hi<<2 + lo // encode 2 register numbers + yIsReg = true + yVal = int(v.Args[2].Reg() - mips.REG_R1) + case ssa.OpMIPSLoweredPanicBoundsRC: + xIsReg = true + xVal = int(v.Args[0].Reg() - mips.REG_R1) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + if yVal == xVal { + yVal = 1 + } + p := s.Prog(mips.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(yVal) + } + case ssa.OpMIPSLoweredPanicExtendRC: + extend = true + xIsReg = true + hi := int(v.Args[0].Reg() - mips.REG_R1) + lo := int(v.Args[1].Reg() - mips.REG_R1) + xVal = hi<<2 + lo // encode 2 register numbers + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + for yVal == hi || yVal == lo { + yVal++ + } + p := s.Prog(mips.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(yVal) + } + case ssa.OpMIPSLoweredPanicBoundsCR: + yIsReg = true + yVal := int(v.Args[0].Reg() - mips.REG_R1) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else if signed && int64(int32(c)) == c || !signed && int64(uint32(c)) == c { + // Move constant to a register + xIsReg = true + if xVal == yVal { + xVal = 1 + } + p := s.Prog(mips.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(xVal) + } else { + // Move constant to two registers + extend = true + xIsReg = true + hi := 0 + lo := 1 + if hi == yVal { + hi = 2 + } + if lo == yVal { + lo = 2 + } + xVal = hi<<2 + lo + p := s.Prog(mips.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c >> 32 + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(hi) + p = s.Prog(mips.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = int64(int32(c)) + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(lo) + } + case ssa.OpMIPSLoweredPanicBoundsCC: + c := v.Aux.(ssa.PanicBoundsCC).Cx + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else if signed && int64(int32(c)) == c || !signed && int64(uint32(c)) == c { + // Move constant to a register + xIsReg = true + p := s.Prog(mips.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(xVal) + } else { + // Move constant to two registers + extend = true + xIsReg = true + hi := 0 + lo := 1 + xVal = hi<<2 + lo + p := s.Prog(mips.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c >> 32 + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(hi) + p = s.Prog(mips.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = int64(int32(c)) + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(lo) + } + c = v.Aux.(ssa.PanicBoundsCC).Cy + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + yVal = 2 + p := s.Prog(mips.AMOVW) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(yVal) + } + } + c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal) + + p := s.Prog(obj.APCDATA) + p.From.SetConst(abi.PCDATA_PanicBounds) + p.To.SetConst(int64(c)) + p = s.Prog(obj.ACALL) p.To.Type = obj.TYPE_MEM p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.ExtendCheckFunc[v.AuxInt] - s.UseArgs(12) // space used in callee args area by assembly stubs + if extend { + p.To.Sym = ir.Syms.PanicExtend + } else { + p.To.Sym = ir.Syms.PanicBounds + } + case ssa.OpMIPSLoweredAtomicLoad8, ssa.OpMIPSLoweredAtomicLoad32: s.Prog(mips.ASYNC) diff --git a/src/cmd/compile/internal/mips64/ssa.go b/src/cmd/compile/internal/mips64/ssa.go index af94c16f6d..37e2274ae8 100644 --- a/src/cmd/compile/internal/mips64/ssa.go +++ b/src/cmd/compile/internal/mips64/ssa.go @@ -15,6 +15,7 @@ import ( "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/mips" + "internal/abi" ) // isFPreg reports whether r is an FP register. @@ -507,12 +508,93 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { p.To.Name = obj.NAME_EXTERN // AuxInt encodes how many buffer entries we need. p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1] - case ssa.OpMIPS64LoweredPanicBoundsA, ssa.OpMIPS64LoweredPanicBoundsB, ssa.OpMIPS64LoweredPanicBoundsC: - p := s.Prog(obj.ACALL) + + case ssa.OpMIPS64LoweredPanicBoundsRR, ssa.OpMIPS64LoweredPanicBoundsRC, ssa.OpMIPS64LoweredPanicBoundsCR, ssa.OpMIPS64LoweredPanicBoundsCC: + // Compute the constant we put in the PCData entry for this call. + code, signed := ssa.BoundsKind(v.AuxInt).Code() + xIsReg := false + yIsReg := false + xVal := 0 + yVal := 0 + switch v.Op { + case ssa.OpMIPS64LoweredPanicBoundsRR: + xIsReg = true + xVal = int(v.Args[0].Reg() - mips.REG_R1) + yIsReg = true + yVal = int(v.Args[1].Reg() - mips.REG_R1) + case ssa.OpMIPS64LoweredPanicBoundsRC: + xIsReg = true + xVal = int(v.Args[0].Reg() - mips.REG_R1) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + if yVal == xVal { + yVal = 1 + } + p := s.Prog(mips.AMOVV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(yVal) + } + case ssa.OpMIPS64LoweredPanicBoundsCR: + yIsReg = true + yVal := int(v.Args[0].Reg() - mips.REG_R1) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + xIsReg = true + if xVal == yVal { + xVal = 1 + } + p := s.Prog(mips.AMOVV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(xVal) + } + case ssa.OpMIPS64LoweredPanicBoundsCC: + c := v.Aux.(ssa.PanicBoundsCC).Cx + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + xIsReg = true + p := s.Prog(mips.AMOVV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(xVal) + } + c = v.Aux.(ssa.PanicBoundsCC).Cy + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + yVal = 1 + p := s.Prog(mips.AMOVV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = mips.REG_R1 + int16(yVal) + } + } + c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal) + + p := s.Prog(obj.APCDATA) + p.From.SetConst(abi.PCDATA_PanicBounds) + p.To.SetConst(int64(c)) + p = s.Prog(obj.ACALL) p.To.Type = obj.TYPE_MEM p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt] - s.UseArgs(16) // space used in callee args area by assembly stubs + p.To.Sym = ir.Syms.PanicBounds + case ssa.OpMIPS64LoweredAtomicLoad8, ssa.OpMIPS64LoweredAtomicLoad32, ssa.OpMIPS64LoweredAtomicLoad64: as := mips.AMOVV switch v.Op { diff --git a/src/cmd/compile/internal/reflectdata/map_swiss.go b/src/cmd/compile/internal/reflectdata/map.go index 54266a604a..2b43d4af27 100644 --- a/src/cmd/compile/internal/reflectdata/map_swiss.go +++ b/src/cmd/compile/internal/reflectdata/map.go @@ -15,10 +15,10 @@ import ( "internal/abi" ) -// SwissMapGroupType makes the map slot group type given the type of the map. -func SwissMapGroupType(t *types.Type) *types.Type { - if t.MapType().SwissGroup != nil { - return t.MapType().SwissGroup +// MapGroupType makes the map slot group type given the type of the map. +func MapGroupType(t *types.Type) *types.Type { + if t.MapType().Group != nil { + return t.MapType().Group } // Builds a type representing a group structure for the given map type. @@ -29,7 +29,7 @@ func SwissMapGroupType(t *types.Type) *types.Type { // // type group struct { // ctrl uint64 - // slots [abi.SwissMapGroupSlots]struct { + // slots [abi.MapGroupSlots]struct { // key keyType // elem elemType // } @@ -39,10 +39,10 @@ func SwissMapGroupType(t *types.Type) *types.Type { elemtype := t.Elem() types.CalcSize(keytype) types.CalcSize(elemtype) - if keytype.Size() > abi.SwissMapMaxKeyBytes { + if keytype.Size() > abi.MapMaxKeyBytes { keytype = types.NewPtr(keytype) } - if elemtype.Size() > abi.SwissMapMaxElemBytes { + if elemtype.Size() > abi.MapMaxElemBytes { elemtype = types.NewPtr(elemtype) } @@ -53,7 +53,7 @@ func SwissMapGroupType(t *types.Type) *types.Type { slot := types.NewStruct(slotFields) slot.SetNoalg(true) - slotArr := types.NewArray(slot, abi.SwissMapGroupSlots) + slotArr := types.NewArray(slot, abi.MapGroupSlots) slotArr.SetNoalg(true) fields := []*types.Field{ @@ -76,25 +76,25 @@ func SwissMapGroupType(t *types.Type) *types.Type { // the end to ensure pointers are valid. base.Fatalf("bad group size for %v", t) } - if t.Key().Size() > abi.SwissMapMaxKeyBytes && !keytype.IsPtr() { + if t.Key().Size() > abi.MapMaxKeyBytes && !keytype.IsPtr() { base.Fatalf("key indirect incorrect for %v", t) } - if t.Elem().Size() > abi.SwissMapMaxElemBytes && !elemtype.IsPtr() { + if t.Elem().Size() > abi.MapMaxElemBytes && !elemtype.IsPtr() { base.Fatalf("elem indirect incorrect for %v", t) } - t.MapType().SwissGroup = group + t.MapType().Group = group group.StructType().Map = t return group } -var cachedSwissTableType *types.Type +var cachedMapTableType *types.Type -// swissTableType returns a type interchangeable with internal/runtime/maps.table. +// mapTableType returns a type interchangeable with internal/runtime/maps.table. // Make sure this stays in sync with internal/runtime/maps/table.go. -func swissTableType() *types.Type { - if cachedSwissTableType != nil { - return cachedSwissTableType +func mapTableType() *types.Type { + if cachedMapTableType != nil { + return cachedMapTableType } // type table struct { @@ -135,17 +135,17 @@ func swissTableType() *types.Type { base.Fatalf("internal/runtime/maps.table size not correct: got %d, want %d", table.Size(), size) } - cachedSwissTableType = table + cachedMapTableType = table return table } -var cachedSwissMapType *types.Type +var cachedMapType *types.Type -// SwissMapType returns a type interchangeable with internal/runtime/maps.Map. +// MapType returns a type interchangeable with internal/runtime/maps.Map. // Make sure this stays in sync with internal/runtime/maps/map.go. -func SwissMapType() *types.Type { - if cachedSwissMapType != nil { - return cachedSwissMapType +func MapType() *types.Type { + if cachedMapType != nil { + return cachedMapType } // type Map struct { @@ -191,23 +191,23 @@ func SwissMapType() *types.Type { base.Fatalf("internal/runtime/maps.Map size not correct: got %d, want %d", m.Size(), size) } - cachedSwissMapType = m + cachedMapType = m return m } -var cachedSwissIterType *types.Type +var cachedMapIterType *types.Type -// SwissMapIterType returns a type interchangeable with runtime.hiter. -// Make sure this stays in sync with runtime/map.go. -func SwissMapIterType() *types.Type { - if cachedSwissIterType != nil { - return cachedSwissIterType +// MapIterType returns a type interchangeable with internal/runtime/maps.Iter. +// Make sure this stays in sync with internal/runtime/maps/table.go. +func MapIterType() *types.Type { + if cachedMapIterType != nil { + return cachedMapIterType } // type Iter struct { // key unsafe.Pointer // *Key // elem unsafe.Pointer // *Elem - // typ unsafe.Pointer // *SwissMapType + // typ unsafe.Pointer // *MapType // m *Map // // groupSlotOffset uint64 @@ -231,13 +231,13 @@ func SwissMapIterType() *types.Type { makefield("key", types.Types[types.TUNSAFEPTR]), // Used in range.go for TMAP. makefield("elem", types.Types[types.TUNSAFEPTR]), // Used in range.go for TMAP. makefield("typ", types.Types[types.TUNSAFEPTR]), - makefield("m", types.NewPtr(SwissMapType())), + makefield("m", types.NewPtr(MapType())), makefield("groupSlotOffset", types.Types[types.TUINT64]), makefield("dirOffset", types.Types[types.TUINT64]), makefield("clearSeq", types.Types[types.TUINT64]), makefield("globalDepth", types.Types[types.TUINT8]), makefield("dirIdx", types.Types[types.TINT]), - makefield("tab", types.NewPtr(swissTableType())), + makefield("tab", types.NewPtr(mapTableType())), makefield("group", types.Types[types.TUNSAFEPTR]), makefield("entryIdx", types.Types[types.TUINT64]), } @@ -257,13 +257,13 @@ func SwissMapIterType() *types.Type { base.Fatalf("internal/runtime/maps.Iter size not correct: got %d, want %d", iter.Size(), size) } - cachedSwissIterType = iter + cachedMapIterType = iter return iter } -func writeSwissMapType(t *types.Type, lsym *obj.LSym, c rttype.Cursor) { - // internal/abi.SwissMapType - gtyp := SwissMapGroupType(t) +func writeMapType(t *types.Type, lsym *obj.LSym, c rttype.Cursor) { + // internal/abi.MapType + gtyp := MapGroupType(t) s1 := writeType(t.Key()) s2 := writeType(t.Elem()) s3 := writeType(gtyp) @@ -287,16 +287,16 @@ func writeSwissMapType(t *types.Type, lsym *obj.LSym, c rttype.Cursor) { c.Field("ElemOff").WriteUintptr(uint64(elemOff)) var flags uint32 if needkeyupdate(t.Key()) { - flags |= abi.SwissMapNeedKeyUpdate + flags |= abi.MapNeedKeyUpdate } if hashMightPanic(t.Key()) { - flags |= abi.SwissMapHashMightPanic + flags |= abi.MapHashMightPanic } - if t.Key().Size() > abi.SwissMapMaxKeyBytes { - flags |= abi.SwissMapIndirectKey + if t.Key().Size() > abi.MapMaxKeyBytes { + flags |= abi.MapIndirectKey } - if t.Elem().Size() > abi.SwissMapMaxKeyBytes { - flags |= abi.SwissMapIndirectElem + if t.Elem().Size() > abi.MapMaxKeyBytes { + flags |= abi.MapIndirectElem } c.Field("Flags").WriteUint32(flags) diff --git a/src/cmd/compile/internal/reflectdata/map_noswiss.go b/src/cmd/compile/internal/reflectdata/map_noswiss.go deleted file mode 100644 index a6fab4cbac..0000000000 --- a/src/cmd/compile/internal/reflectdata/map_noswiss.go +++ /dev/null @@ -1,305 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package reflectdata - -import ( - "internal/abi" - - "cmd/compile/internal/base" - "cmd/compile/internal/ir" - "cmd/compile/internal/rttype" - "cmd/compile/internal/types" - "cmd/internal/obj" - "cmd/internal/objabi" - "cmd/internal/src" -) - -// OldMapBucketType makes the map bucket type given the type of the map. -func OldMapBucketType(t *types.Type) *types.Type { - // Builds a type representing a Bucket structure for - // the given map type. This type is not visible to users - - // we include only enough information to generate a correct GC - // program for it. - // Make sure this stays in sync with runtime/map.go. - // - // A "bucket" is a "struct" { - // tophash [abi.OldMapBucketCount]uint8 - // keys [abi.OldMapBucketCount]keyType - // elems [abi.OldMapBucketCount]elemType - // overflow *bucket - // } - if t.MapType().OldBucket != nil { - return t.MapType().OldBucket - } - - keytype := t.Key() - elemtype := t.Elem() - types.CalcSize(keytype) - types.CalcSize(elemtype) - if keytype.Size() > abi.OldMapMaxKeyBytes { - keytype = types.NewPtr(keytype) - } - if elemtype.Size() > abi.OldMapMaxElemBytes { - elemtype = types.NewPtr(elemtype) - } - - field := make([]*types.Field, 0, 5) - - // The first field is: uint8 topbits[BUCKETSIZE]. - arr := types.NewArray(types.Types[types.TUINT8], abi.OldMapBucketCount) - field = append(field, makefield("topbits", arr)) - - arr = types.NewArray(keytype, abi.OldMapBucketCount) - arr.SetNoalg(true) - keys := makefield("keys", arr) - field = append(field, keys) - - arr = types.NewArray(elemtype, abi.OldMapBucketCount) - arr.SetNoalg(true) - elems := makefield("elems", arr) - field = append(field, elems) - - // If keys and elems have no pointers, the map implementation - // can keep a list of overflow pointers on the side so that - // buckets can be marked as having no pointers. - // Arrange for the bucket to have no pointers by changing - // the type of the overflow field to uintptr in this case. - // See comment on hmap.overflow in runtime/map.go. - otyp := types.Types[types.TUNSAFEPTR] - if !elemtype.HasPointers() && !keytype.HasPointers() { - otyp = types.Types[types.TUINTPTR] - } - overflow := makefield("overflow", otyp) - field = append(field, overflow) - - // link up fields - bucket := types.NewStruct(field[:]) - bucket.SetNoalg(true) - types.CalcSize(bucket) - - // Check invariants that map code depends on. - if !types.IsComparable(t.Key()) { - base.Fatalf("unsupported map key type for %v", t) - } - if abi.OldMapBucketCount < 8 { - base.Fatalf("bucket size %d too small for proper alignment %d", abi.OldMapBucketCount, 8) - } - if uint8(keytype.Alignment()) > abi.OldMapBucketCount { - base.Fatalf("key align too big for %v", t) - } - if uint8(elemtype.Alignment()) > abi.OldMapBucketCount { - base.Fatalf("elem align %d too big for %v, BUCKETSIZE=%d", elemtype.Alignment(), t, abi.OldMapBucketCount) - } - if keytype.Size() > abi.OldMapMaxKeyBytes { - base.Fatalf("key size too large for %v", t) - } - if elemtype.Size() > abi.OldMapMaxElemBytes { - base.Fatalf("elem size too large for %v", t) - } - if t.Key().Size() > abi.OldMapMaxKeyBytes && !keytype.IsPtr() { - base.Fatalf("key indirect incorrect for %v", t) - } - if t.Elem().Size() > abi.OldMapMaxElemBytes && !elemtype.IsPtr() { - base.Fatalf("elem indirect incorrect for %v", t) - } - if keytype.Size()%keytype.Alignment() != 0 { - base.Fatalf("key size not a multiple of key align for %v", t) - } - if elemtype.Size()%elemtype.Alignment() != 0 { - base.Fatalf("elem size not a multiple of elem align for %v", t) - } - if uint8(bucket.Alignment())%uint8(keytype.Alignment()) != 0 { - base.Fatalf("bucket align not multiple of key align %v", t) - } - if uint8(bucket.Alignment())%uint8(elemtype.Alignment()) != 0 { - base.Fatalf("bucket align not multiple of elem align %v", t) - } - if keys.Offset%keytype.Alignment() != 0 { - base.Fatalf("bad alignment of keys in bmap for %v", t) - } - if elems.Offset%elemtype.Alignment() != 0 { - base.Fatalf("bad alignment of elems in bmap for %v", t) - } - - // Double-check that overflow field is final memory in struct, - // with no padding at end. - if overflow.Offset != bucket.Size()-int64(types.PtrSize) { - base.Fatalf("bad offset of overflow in bmap for %v, overflow.Offset=%d, bucket.Size()-int64(types.PtrSize)=%d", - t, overflow.Offset, bucket.Size()-int64(types.PtrSize)) - } - - t.MapType().OldBucket = bucket - - bucket.StructType().Map = t - return bucket -} - -var oldHmapType *types.Type - -// OldMapType returns a type interchangeable with runtime.hmap. -// Make sure this stays in sync with runtime/map.go. -func OldMapType() *types.Type { - if oldHmapType != nil { - return oldHmapType - } - - // build a struct: - // type hmap struct { - // count int - // flags uint8 - // B uint8 - // noverflow uint16 - // hash0 uint32 - // buckets unsafe.Pointer - // oldbuckets unsafe.Pointer - // nevacuate uintptr - // clearSeq uint64 - // extra unsafe.Pointer // *mapextra - // } - // must match runtime/map.go:hmap. - fields := []*types.Field{ - makefield("count", types.Types[types.TINT]), - makefield("flags", types.Types[types.TUINT8]), - makefield("B", types.Types[types.TUINT8]), - makefield("noverflow", types.Types[types.TUINT16]), - makefield("hash0", types.Types[types.TUINT32]), // Used in walk.go for OMAKEMAP. - makefield("buckets", types.Types[types.TUNSAFEPTR]), // Used in walk.go for OMAKEMAP. - makefield("oldbuckets", types.Types[types.TUNSAFEPTR]), - makefield("nevacuate", types.Types[types.TUINTPTR]), - makefield("clearSeq", types.Types[types.TUINT64]), - makefield("extra", types.Types[types.TUNSAFEPTR]), - } - - n := ir.NewDeclNameAt(src.NoXPos, ir.OTYPE, ir.Pkgs.Runtime.Lookup("hmap")) - hmap := types.NewNamed(n) - n.SetType(hmap) - n.SetTypecheck(1) - - hmap.SetUnderlying(types.NewStruct(fields)) - types.CalcSize(hmap) - - // The size of hmap should be 56 bytes on 64 bit - // and 36 bytes on 32 bit platforms. - if size := int64(2*8 + 5*types.PtrSize); hmap.Size() != size { - base.Fatalf("hmap size not correct: got %d, want %d", hmap.Size(), size) - } - - oldHmapType = hmap - return hmap -} - -var oldHiterType *types.Type - -// OldMapIterType returns a type interchangeable with runtime.hiter. -// Make sure this stays in sync with runtime/map.go. -func OldMapIterType() *types.Type { - if oldHiterType != nil { - return oldHiterType - } - - hmap := OldMapType() - - // build a struct: - // type hiter struct { - // key unsafe.Pointer // *Key - // elem unsafe.Pointer // *Elem - // t unsafe.Pointer // *OldMapType - // h *hmap - // buckets unsafe.Pointer - // bptr unsafe.Pointer // *bmap - // overflow unsafe.Pointer // *[]*bmap - // oldoverflow unsafe.Pointer // *[]*bmap - // startBucket uintptr - // offset uint8 - // wrapped bool - // B uint8 - // i uint8 - // bucket uintptr - // checkBucket uintptr - // clearSeq uint64 - // } - // must match runtime/map.go:hiter. - fields := []*types.Field{ - makefield("key", types.Types[types.TUNSAFEPTR]), // Used in range.go for TMAP. - makefield("elem", types.Types[types.TUNSAFEPTR]), // Used in range.go for TMAP. - makefield("t", types.Types[types.TUNSAFEPTR]), - makefield("h", types.NewPtr(hmap)), - makefield("buckets", types.Types[types.TUNSAFEPTR]), - makefield("bptr", types.Types[types.TUNSAFEPTR]), - makefield("overflow", types.Types[types.TUNSAFEPTR]), - makefield("oldoverflow", types.Types[types.TUNSAFEPTR]), - makefield("startBucket", types.Types[types.TUINTPTR]), - makefield("offset", types.Types[types.TUINT8]), - makefield("wrapped", types.Types[types.TBOOL]), - makefield("B", types.Types[types.TUINT8]), - makefield("i", types.Types[types.TUINT8]), - makefield("bucket", types.Types[types.TUINTPTR]), - makefield("checkBucket", types.Types[types.TUINTPTR]), - makefield("clearSeq", types.Types[types.TUINT64]), - } - - // build iterator struct holding the above fields - n := ir.NewDeclNameAt(src.NoXPos, ir.OTYPE, ir.Pkgs.Runtime.Lookup("hiter")) - hiter := types.NewNamed(n) - n.SetType(hiter) - n.SetTypecheck(1) - - hiter.SetUnderlying(types.NewStruct(fields)) - types.CalcSize(hiter) - if hiter.Size() != int64(8+12*types.PtrSize) { - base.Fatalf("hash_iter size not correct %d %d", hiter.Size(), 8+12*types.PtrSize) - } - - oldHiterType = hiter - return hiter -} - -func writeOldMapType(t *types.Type, lsym *obj.LSym, c rttype.Cursor) { - // internal/abi.OldMapType - s1 := writeType(t.Key()) - s2 := writeType(t.Elem()) - s3 := writeType(OldMapBucketType(t)) - hasher := genhash(t.Key()) - - c.Field("Key").WritePtr(s1) - c.Field("Elem").WritePtr(s2) - c.Field("Bucket").WritePtr(s3) - c.Field("Hasher").WritePtr(hasher) - var flags uint32 - // Note: flags must match maptype accessors in ../../../../runtime/type.go - // and maptype builder in ../../../../reflect/type.go:MapOf. - if t.Key().Size() > abi.OldMapMaxKeyBytes { - c.Field("KeySize").WriteUint8(uint8(types.PtrSize)) - flags |= 1 // indirect key - } else { - c.Field("KeySize").WriteUint8(uint8(t.Key().Size())) - } - - if t.Elem().Size() > abi.OldMapMaxElemBytes { - c.Field("ValueSize").WriteUint8(uint8(types.PtrSize)) - flags |= 2 // indirect value - } else { - c.Field("ValueSize").WriteUint8(uint8(t.Elem().Size())) - } - c.Field("BucketSize").WriteUint16(uint16(OldMapBucketType(t).Size())) - if types.IsReflexive(t.Key()) { - flags |= 4 // reflexive key - } - if needkeyupdate(t.Key()) { - flags |= 8 // need key update - } - if hashMightPanic(t.Key()) { - flags |= 16 // hash might panic - } - c.Field("Flags").WriteUint32(flags) - - if u := t.Underlying(); u != t { - // If t is a named map type, also keep the underlying map - // type live in the binary. This is important to make sure that - // a named map and that same map cast to its underlying type via - // reflection, use the same hash function. See issue 37716. - lsym.AddRel(base.Ctxt, obj.Reloc{Type: objabi.R_KEEP, Sym: writeType(u)}) - } -} diff --git a/src/cmd/compile/internal/reflectdata/reflect.go b/src/cmd/compile/internal/reflectdata/reflect.go index fb60569670..4d1d780190 100644 --- a/src/cmd/compile/internal/reflectdata/reflect.go +++ b/src/cmd/compile/internal/reflectdata/reflect.go @@ -8,7 +8,6 @@ import ( "encoding/binary" "fmt" "internal/abi" - "internal/buildcfg" "slices" "sort" "strings" @@ -491,6 +490,9 @@ func dcommontype(c rttype.Cursor, t *types.Type) { exported = types.IsExported(t.Elem().Sym().Name) } } + if types.IsDirectIface(t) { + tflag |= abi.TFlagDirectIface + } if tflag != abi.TFlag(uint8(tflag)) { // this should optimize away completely @@ -511,9 +513,6 @@ func dcommontype(c rttype.Cursor, t *types.Type) { c.Field("FieldAlign_").WriteUint8(uint8(t.Alignment())) kind := kinds[t.Kind()] - if types.IsDirectIface(t) { - kind |= abi.KindDirectIface - } c.Field("Kind_").WriteUint8(uint8(kind)) c.Field("Equal").WritePtr(eqfunc) @@ -773,11 +772,7 @@ func writeType(t *types.Type) *obj.LSym { rt = rttype.InterfaceType dataAdd = len(imethods(t)) * int(rttype.IMethod.Size()) case types.TMAP: - if buildcfg.Experiment.SwissMap { - rt = rttype.SwissMapType - } else { - rt = rttype.OldMapType - } + rt = rttype.MapType case types.TPTR: rt = rttype.PtrType // TODO: use rttype.Type for Elem() is ANY? @@ -877,11 +872,7 @@ func writeType(t *types.Type) *obj.LSym { } case types.TMAP: - if buildcfg.Experiment.SwissMap { - writeSwissMapType(t, lsym, c) - } else { - writeOldMapType(t, lsym, c) - } + writeMapType(t, lsym, c) case types.TPTR: // internal/abi.PtrType diff --git a/src/cmd/compile/internal/riscv64/ssa.go b/src/cmd/compile/internal/riscv64/ssa.go index 21edcabc58..f54ea47c88 100644 --- a/src/cmd/compile/internal/riscv64/ssa.go +++ b/src/cmd/compile/internal/riscv64/ssa.go @@ -14,6 +14,7 @@ import ( "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/riscv" + "internal/abi" ) // ssaRegToReg maps ssa register numbers to obj register numbers. @@ -508,12 +509,91 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { p.To.Name = obj.NAME_EXTERN // AuxInt encodes how many buffer entries we need. p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1] - case ssa.OpRISCV64LoweredPanicBoundsA, ssa.OpRISCV64LoweredPanicBoundsB, ssa.OpRISCV64LoweredPanicBoundsC: - p := s.Prog(obj.ACALL) + + case ssa.OpRISCV64LoweredPanicBoundsRR, ssa.OpRISCV64LoweredPanicBoundsRC, ssa.OpRISCV64LoweredPanicBoundsCR, ssa.OpRISCV64LoweredPanicBoundsCC: + // Compute the constant we put in the PCData entry for this call. + code, signed := ssa.BoundsKind(v.AuxInt).Code() + xIsReg := false + yIsReg := false + xVal := 0 + yVal := 0 + switch v.Op { + case ssa.OpRISCV64LoweredPanicBoundsRR: + xIsReg = true + xVal = int(v.Args[0].Reg() - riscv.REG_X5) + yIsReg = true + yVal = int(v.Args[1].Reg() - riscv.REG_X5) + case ssa.OpRISCV64LoweredPanicBoundsRC: + xIsReg = true + xVal = int(v.Args[0].Reg() - riscv.REG_X5) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + if yVal == xVal { + yVal = 1 + } + p := s.Prog(riscv.AMOV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = riscv.REG_X5 + int16(yVal) + } + case ssa.OpRISCV64LoweredPanicBoundsCR: + yIsReg = true + yVal := int(v.Args[0].Reg() - riscv.REG_X5) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + if xVal == yVal { + xVal = 1 + } + p := s.Prog(riscv.AMOV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = riscv.REG_X5 + int16(xVal) + } + case ssa.OpRISCV64LoweredPanicBoundsCC: + c := v.Aux.(ssa.PanicBoundsCC).Cx + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + xIsReg = true + p := s.Prog(riscv.AMOV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = riscv.REG_X5 + int16(xVal) + } + c = v.Aux.(ssa.PanicBoundsCC).Cy + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + yVal = 1 + p := s.Prog(riscv.AMOV) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = riscv.REG_X5 + int16(yVal) + } + } + c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal) + + p := s.Prog(obj.APCDATA) + p.From.SetConst(abi.PCDATA_PanicBounds) + p.To.SetConst(int64(c)) + p = s.Prog(obj.ACALL) p.To.Type = obj.TYPE_MEM p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt] - s.UseArgs(16) // space used in callee args area by assembly stubs + p.To.Sym = ir.Syms.PanicBounds case ssa.OpRISCV64LoweredAtomicLoad8: s.Prog(riscv.AFENCE) diff --git a/src/cmd/compile/internal/rttype/rttype.go b/src/cmd/compile/internal/rttype/rttype.go index aaf98dda15..925d3901d4 100644 --- a/src/cmd/compile/internal/rttype/rttype.go +++ b/src/cmd/compile/internal/rttype/rttype.go @@ -27,8 +27,7 @@ var ArrayType *types.Type var ChanType *types.Type var FuncType *types.Type var InterfaceType *types.Type -var OldMapType *types.Type -var SwissMapType *types.Type +var MapType *types.Type var PtrType *types.Type var SliceType *types.Type var StructType *types.Type @@ -55,8 +54,7 @@ func Init() { ChanType = FromReflect(reflect.TypeOf(abi.ChanType{})) FuncType = FromReflect(reflect.TypeOf(abi.FuncType{})) InterfaceType = FromReflect(reflect.TypeOf(abi.InterfaceType{})) - OldMapType = FromReflect(reflect.TypeOf(abi.OldMapType{})) - SwissMapType = FromReflect(reflect.TypeOf(abi.SwissMapType{})) + MapType = FromReflect(reflect.TypeOf(abi.MapType{})) PtrType = FromReflect(reflect.TypeOf(abi.PtrType{})) SliceType = FromReflect(reflect.TypeOf(abi.SliceType{})) StructType = FromReflect(reflect.TypeOf(abi.StructType{})) diff --git a/src/cmd/compile/internal/s390x/ssa.go b/src/cmd/compile/internal/s390x/ssa.go index 4d24881dba..86efde4fa0 100644 --- a/src/cmd/compile/internal/s390x/ssa.go +++ b/src/cmd/compile/internal/s390x/ssa.go @@ -15,6 +15,7 @@ import ( "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/s390x" + "internal/abi" ) // ssaMarkMoves marks any MOVXconst ops that need to avoid clobbering flags. @@ -281,6 +282,10 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { case ssa.OpS390XCPSDR: p := opregreg(s, v.Op.Asm(), v.Reg(), v.Args[1].Reg()) p.Reg = v.Args[0].Reg() + case ssa.OpS390XWFMAXDB, ssa.OpS390XWFMAXSB, + ssa.OpS390XWFMINDB, ssa.OpS390XWFMINSB: + p := opregregimm(s, v.Op.Asm(), v.Reg(), v.Args[0].Reg(), 1 /* Java Math.Max() */) + p.AddRestSource(obj.Addr{Type: obj.TYPE_REG, Reg: v.Args[1].Reg()}) case ssa.OpS390XDIVD, ssa.OpS390XDIVW, ssa.OpS390XDIVDU, ssa.OpS390XDIVWU, ssa.OpS390XMODD, ssa.OpS390XMODW, @@ -569,12 +574,92 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { p.To.Name = obj.NAME_EXTERN // AuxInt encodes how many buffer entries we need. p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1] - case ssa.OpS390XLoweredPanicBoundsA, ssa.OpS390XLoweredPanicBoundsB, ssa.OpS390XLoweredPanicBoundsC: - p := s.Prog(obj.ACALL) + + case ssa.OpS390XLoweredPanicBoundsRR, ssa.OpS390XLoweredPanicBoundsRC, ssa.OpS390XLoweredPanicBoundsCR, ssa.OpS390XLoweredPanicBoundsCC: + // Compute the constant we put in the PCData entry for this call. + code, signed := ssa.BoundsKind(v.AuxInt).Code() + xIsReg := false + yIsReg := false + xVal := 0 + yVal := 0 + switch v.Op { + case ssa.OpS390XLoweredPanicBoundsRR: + xIsReg = true + xVal = int(v.Args[0].Reg() - s390x.REG_R0) + yIsReg = true + yVal = int(v.Args[1].Reg() - s390x.REG_R0) + case ssa.OpS390XLoweredPanicBoundsRC: + xIsReg = true + xVal = int(v.Args[0].Reg() - s390x.REG_R0) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + if yVal == xVal { + yVal = 1 + } + p := s.Prog(s390x.AMOVD) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = s390x.REG_R0 + int16(yVal) + } + case ssa.OpS390XLoweredPanicBoundsCR: + yIsReg = true + yVal := int(v.Args[0].Reg() - s390x.REG_R0) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + if xVal == yVal { + xVal = 1 + } + p := s.Prog(s390x.AMOVD) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = s390x.REG_R0 + int16(xVal) + } + case ssa.OpS390XLoweredPanicBoundsCC: + c := v.Aux.(ssa.PanicBoundsCC).Cx + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else { + // Move constant to a register + xIsReg = true + p := s.Prog(s390x.AMOVD) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = s390x.REG_R0 + int16(xVal) + } + c = v.Aux.(ssa.PanicBoundsCC).Cy + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + yVal = 1 + p := s.Prog(s390x.AMOVD) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = s390x.REG_R0 + int16(yVal) + } + } + c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal) + + p := s.Prog(obj.APCDATA) + p.From.SetConst(abi.PCDATA_PanicBounds) + p.To.SetConst(int64(c)) + p = s.Prog(obj.ACALL) p.To.Type = obj.TYPE_MEM p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt] - s.UseArgs(16) // space used in callee args area by assembly stubs + p.To.Sym = ir.Syms.PanicBounds + case ssa.OpS390XFLOGR, ssa.OpS390XPOPCNT, ssa.OpS390XNEG, ssa.OpS390XNEGW, ssa.OpS390XMOVWBR, ssa.OpS390XMOVDBR: diff --git a/src/cmd/compile/internal/ssa/_gen/386.rules b/src/cmd/compile/internal/ssa/_gen/386.rules index 97414913e4..5f11502419 100644 --- a/src/cmd/compile/internal/ssa/_gen/386.rules +++ b/src/cmd/compile/internal/ssa/_gen/386.rules @@ -363,13 +363,16 @@ // Write barrier. (WB ...) => (LoweredWB ...) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem) +(PanicBounds ...) => (LoweredPanicBoundsRR ...) +(PanicExtend ...) => (LoweredPanicExtendRR ...) -(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 0 => (LoweredPanicExtendA [kind] hi lo y mem) -(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 1 => (LoweredPanicExtendB [kind] hi lo y mem) -(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 2 => (LoweredPanicExtendC [kind] hi lo y mem) +(LoweredPanicBoundsRR [kind] x (MOVLconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem) +(LoweredPanicBoundsRR [kind] (MOVLconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem) +(LoweredPanicBoundsRC [kind] {p} (MOVLconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem) + +(LoweredPanicExtendRR [kind] hi lo (MOVLconst [c]) mem) => (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem) +(LoweredPanicExtendRR [kind] (MOVLconst [hi]) (MOVLconst [lo]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem) +(LoweredPanicExtendRC [kind] {p} (MOVLconst [hi]) (MOVLconst [lo]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem) // *************************** // Above: lowering rules diff --git a/src/cmd/compile/internal/ssa/_gen/386Ops.go b/src/cmd/compile/internal/ssa/_gen/386Ops.go index a976a91fb8..60599a33ab 100644 --- a/src/cmd/compile/internal/ssa/_gen/386Ops.go +++ b/src/cmd/compile/internal/ssa/_gen/386Ops.go @@ -76,7 +76,6 @@ func init() { cx = buildReg("CX") dx = buildReg("DX") bx = buildReg("BX") - si = buildReg("SI") gp = buildReg("AX CX DX BX BP SI DI") fp = buildReg("X0 X1 X2 X3 X4 X5 X6 X7") gpsp = gp | buildReg("SP") @@ -523,16 +522,19 @@ func init() { // Returns a pointer to a write barrier buffer in DI. {name: "LoweredWB", argLength: 1, reg: regInfo{clobbers: callerSave &^ gp, outputs: []regMask{buildReg("DI")}}, clobberFlags: true, aux: "Int64"}, - // There are three of these functions so that they can have three different register inputs. - // When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the - // default registers to match so we don't need to copy registers around unnecessarily. - {name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{dx, bx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{cx, dx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{ax, cx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - // Extend ops are the same as Bounds ops except the indexes are 64-bit. - {name: "LoweredPanicExtendA", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{si, dx, bx}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go). - {name: "LoweredPanicExtendB", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{si, cx, dx}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go). - {name: "LoweredPanicExtendC", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{si, ax, cx}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go). + // LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail. + // the RC and CR versions are used when one of the arguments is a constant. CC is used + // when both are constant (normally both 0, as prove derives the fact that a [0] bounds + // failure means the length must have also been 0). + // AuxInt contains a report code (see PanicBounds in genericOps.go). + {name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{gp, gp}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory. + {name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory. + + // Same as above, but the x value is 64 bits. + {name: "LoweredPanicExtendRR", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{ax | cx | dx | bx, ax | cx | dx | bx, gp}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=y, arg3=mem, returns memory. + {name: "LoweredPanicExtendRC", argLength: 3, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{ax | cx | dx | bx, ax | cx | dx | bx}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=mem, returns memory. // Constant flag values. For any comparison, there are 5 possible // outcomes: the three from the signed total order (<,==,>) and the diff --git a/src/cmd/compile/internal/ssa/_gen/AMD64.rules b/src/cmd/compile/internal/ssa/_gen/AMD64.rules index 5dafc4b563..dd9deef4af 100644 --- a/src/cmd/compile/internal/ssa/_gen/AMD64.rules +++ b/src/cmd/compile/internal/ssa/_gen/AMD64.rules @@ -375,34 +375,17 @@ (MOVQstoreconst [makeValAndOff(0,int32(s-8))] destptr (MOVQstoreconst [makeValAndOff(0,0)] destptr mem)) -// Adjust zeros to be a multiple of 16 bytes. -(Zero [s] destptr mem) && s%16 != 0 && s > 16 => - (Zero [s-s%16] (OffPtr <destptr.Type> destptr [s%16]) - (MOVOstoreconst [makeValAndOff(0,0)] destptr mem)) +// Zeroing up to 192 bytes uses straightline code. +(Zero [s] destptr mem) && s >= 16 && s < 192 => (LoweredZero [s] destptr mem) -(Zero [16] destptr mem) => - (MOVOstoreconst [makeValAndOff(0,0)] destptr mem) -(Zero [32] destptr mem) => - (MOVOstoreconst [makeValAndOff(0,16)] destptr - (MOVOstoreconst [makeValAndOff(0,0)] destptr mem)) -(Zero [48] destptr mem) => - (MOVOstoreconst [makeValAndOff(0,32)] destptr - (MOVOstoreconst [makeValAndOff(0,16)] destptr - (MOVOstoreconst [makeValAndOff(0,0)] destptr mem))) -(Zero [64] destptr mem) => - (MOVOstoreconst [makeValAndOff(0,48)] destptr - (MOVOstoreconst [makeValAndOff(0,32)] destptr - (MOVOstoreconst [makeValAndOff(0,16)] destptr - (MOVOstoreconst [makeValAndOff(0,0)] destptr mem)))) - -// Medium zeroing uses a duff device. -(Zero [s] destptr mem) - && s > 64 && s <= 1024 && s%16 == 0 => - (DUFFZERO [s] destptr mem) +// Zeroing up to ~1KB uses a small loop. +(Zero [s] destptr mem) && s >= 192 && s <= repZeroThreshold => (LoweredZeroLoop [s] destptr mem) // Large zeroing uses REP STOSQ. -(Zero [s] destptr mem) - && s > 1024 && s%8 == 0 => +(Zero [s] destptr mem) && s > repZeroThreshold && s%8 != 0 => + (Zero [s-s%8] (OffPtr <destptr.Type> destptr [s%8]) + (MOVOstoreconst [makeValAndOff(0,0)] destptr mem)) +(Zero [s] destptr mem) && s > repZeroThreshold && s%8 == 0 => (REPSTOSQ destptr (MOVQconst [s/8]) (MOVQconst [0]) mem) // Lowering constants @@ -558,9 +541,11 @@ // Write barrier. (WB ...) => (LoweredWB ...) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem) +(PanicBounds ...) => (LoweredPanicBoundsRR ...) +(LoweredPanicBoundsRR [kind] x (MOVQconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) +(LoweredPanicBoundsRR [kind] (MOVQconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) +(LoweredPanicBoundsRC [kind] {p} (MOVQconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) +(LoweredPanicBoundsCR [kind] {p} (MOVQconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) // lowering rotates (RotateLeft8 ...) => (ROLB ...) diff --git a/src/cmd/compile/internal/ssa/_gen/AMD64Ops.go b/src/cmd/compile/internal/ssa/_gen/AMD64Ops.go index 402f50bfc2..bc30e6574f 100644 --- a/src/cmd/compile/internal/ssa/_gen/AMD64Ops.go +++ b/src/cmd/compile/internal/ssa/_gen/AMD64Ops.go @@ -121,7 +121,6 @@ func init() { ax = buildReg("AX") cx = buildReg("CX") dx = buildReg("DX") - bx = buildReg("BX") gp = buildReg("AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15") g = buildReg("g") fp = buildReg("X0 X1 X2 X3 X4 X5 X6 X7 X8 X9 X10 X11 X12 X13 X14") @@ -964,15 +963,30 @@ func init() { // auxint = # of bytes to zero // returns mem { - name: "DUFFZERO", + name: "LoweredZero", aux: "Int64", argLength: 2, reg: regInfo{ - inputs: []regMask{buildReg("DI")}, - clobbers: buildReg("DI"), + inputs: []regMask{gp}, }, - //faultOnNilArg0: true, // Note: removed for 73748. TODO: reenable at some point - unsafePoint: true, // FP maintenance around DUFFCOPY can be clobbered by interrupts + faultOnNilArg0: true, + }, + + // arg0 = pointer to start of memory to zero + // arg1 = mem + // auxint = # of bytes to zero + // returns mem + { + name: "LoweredZeroLoop", + aux: "Int64", + argLength: 2, + reg: regInfo{ + inputs: []regMask{gp}, + clobbersArg0: true, + }, + clobberFlags: true, + faultOnNilArg0: true, + needIntTemp: true, }, // arg0 = address of memory to zero @@ -1060,12 +1074,15 @@ func init() { {name: "LoweredHasCPUFeature", argLength: 0, reg: gp01, rematerializeable: true, typ: "UInt64", aux: "Sym", symEffect: "None"}, - // There are three of these functions so that they can have three different register inputs. - // When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the - // default registers to match so we don't need to copy registers around unnecessarily. - {name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{dx, bx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go). - {name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{cx, dx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go). - {name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{ax, cx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go). + // LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail. + // the RC and CR versions are used when one of the arguments is a constant. CC is used + // when both are constant (normally both 0, as prove derives the fact that a [0] bounds + // failure means the length must have also been 0). + // AuxInt contains a report code (see PanicBounds in genericOps.go). + {name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{gp, gp}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory. + {name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory. // Constant flag values. For any comparison, there are 5 possible // outcomes: the three from the signed total order (<,==,>) and the diff --git a/src/cmd/compile/internal/ssa/_gen/ARM.rules b/src/cmd/compile/internal/ssa/_gen/ARM.rules index 431a12f35b..18b5d6bba6 100644 --- a/src/cmd/compile/internal/ssa/_gen/ARM.rules +++ b/src/cmd/compile/internal/ssa/_gen/ARM.rules @@ -395,13 +395,16 @@ // Write barrier. (WB ...) => (LoweredWB ...) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem) +(PanicBounds ...) => (LoweredPanicBoundsRR ...) +(PanicExtend ...) => (LoweredPanicExtendRR ...) -(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 0 => (LoweredPanicExtendA [kind] hi lo y mem) -(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 1 => (LoweredPanicExtendB [kind] hi lo y mem) -(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 2 => (LoweredPanicExtendC [kind] hi lo y mem) +(LoweredPanicBoundsRR [kind] x (MOVWconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem) +(LoweredPanicBoundsRR [kind] (MOVWconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem) +(LoweredPanicBoundsRC [kind] {p} (MOVWconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem) + +(LoweredPanicExtendRR [kind] hi lo (MOVWconst [c]) mem) => (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem) +(LoweredPanicExtendRR [kind] (MOVWconst [hi]) (MOVWconst [lo]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem) +(LoweredPanicExtendRC [kind] {p} (MOVWconst [hi]) (MOVWconst [lo]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem) // Optimizations diff --git a/src/cmd/compile/internal/ssa/_gen/ARM64.rules b/src/cmd/compile/internal/ssa/_gen/ARM64.rules index 01fe3a74f7..15ba10e216 100644 --- a/src/cmd/compile/internal/ssa/_gen/ARM64.rules +++ b/src/cmd/compile/internal/ssa/_gen/ARM64.rules @@ -601,9 +601,11 @@ // Publication barrier (0xe is ST option) (PubBarrier mem) => (DMB [0xe] mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem) +(PanicBounds ...) => (LoweredPanicBoundsRR ...) +(LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) +(LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) +(LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) +(LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) // Optimizations @@ -683,6 +685,14 @@ ((EQ|NE) (CMPconst [0] x) yes no) => ((Z|NZ) x yes no) ((EQ|NE) (CMPWconst [0] x) yes no) => ((ZW|NZW) x yes no) +((ULE|UGT) (CMPconst [0] x)) => ((EQ|NE) (CMPconst [0] x)) +((ULE|UGT) (CMPWconst [0] x)) => ((EQ|NE) (CMPWconst [0] x)) + +((Z|NZ) sub:(SUB x y)) && sub.Uses == 1 => ((EQ|NE) (CMP x y)) +((ZW|NZW) sub:(SUB x y)) && sub.Uses == 1 => ((EQ|NE) (CMPW x y)) +((Z|NZ) sub:(SUBconst [c] y)) && sub.Uses == 1 => ((EQ|NE) (CMPconst [c] y)) +((ZW|NZW) sub:(SUBconst [c] y)) && sub.Uses == 1 => ((EQ|NE) (CMPWconst [int32(c)] y)) + ((EQ|NE|LT|LE|GT|GE) (CMPconst [0] z:(MADD a x y)) yes no) && z.Uses==1 => ((EQ|NE|LTnoov|LEnoov|GTnoov|GEnoov) (CMN a (MUL <x.Type> x y)) yes no) ((EQ|NE|LT|LE|GT|GE) (CMPconst [0] z:(MSUB a x y)) yes no) && z.Uses==1 => ((EQ|NE|LTnoov|LEnoov|GTnoov|GEnoov) (CMP a (MUL <x.Type> x y)) yes no) ((EQ|NE|LT|LE|GT|GE) (CMPWconst [0] z:(MADDW a x y)) yes no) && z.Uses==1 => ((EQ|NE|LTnoov|LEnoov|GTnoov|GEnoov) (CMNW a (MULW <x.Type> x y)) yes no) @@ -1658,6 +1668,10 @@ (SRLconst [rc] (MOVHUreg x)) && rc >= 16 => (MOVDconst [0]) (SRLconst [rc] (MOVBUreg x)) && rc >= 8 => (MOVDconst [0]) +// Special cases for slice operations +(ADD x0 x1:(ANDshiftRA x2:(SLLconst [sl] y) z [63])) && x1.Uses == 1 && x2.Uses == 1 => (ADDshiftLL x0 (ANDshiftRA <y.Type> y z [63]) [sl]) +(ADD x0 x1:(ANDshiftLL x2:(SRAconst [63] z) y [sl])) && x1.Uses == 1 && x2.Uses == 1 => (ADDshiftLL x0 (ANDshiftRA <y.Type> y z [63]) [sl]) + // bitfield ops // sbfiz diff --git a/src/cmd/compile/internal/ssa/_gen/ARM64Ops.go b/src/cmd/compile/internal/ssa/_gen/ARM64Ops.go index ebb7ed5299..69db139ff0 100644 --- a/src/cmd/compile/internal/ssa/_gen/ARM64Ops.go +++ b/src/cmd/compile/internal/ssa/_gen/ARM64Ops.go @@ -144,11 +144,8 @@ func init() { gpspsbg = gpspg | buildReg("SB") fp = buildReg("F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 F16 F17 F18 F19 F20 F21 F22 F23 F24 F25 F26 F27 F28 F29 F30 F31") callerSave = gp | fp | buildReg("g") // runtime.setg (and anything calling it) may clobber g - r0 = buildReg("R0") - r1 = buildReg("R1") - r2 = buildReg("R2") - r3 = buildReg("R3") rz = buildReg("ZERO") + first16 = buildReg("R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15") ) // Common regInfo var ( @@ -760,12 +757,15 @@ func init() { // Returns a pointer to a write barrier buffer in R25. {name: "LoweredWB", argLength: 1, reg: regInfo{clobbers: (callerSave &^ gpg) | buildReg("R16 R17 R30"), outputs: []regMask{buildReg("R25")}}, clobberFlags: true, aux: "Int64"}, - // There are three of these functions so that they can have three different register inputs. - // When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the - // default registers to match so we don't need to copy registers around unnecessarily. - {name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go). - {name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go). - {name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r0, r1}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go). + // LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail. + // the RC and CR versions are used when one of the arguments is a constant. CC is used + // when both are constant (normally both 0, as prove derives the fact that a [0] bounds + // failure means the length must have also been 0). + // AuxInt contains a report code (see PanicBounds in genericOps.go). + {name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{first16, first16}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory. + {name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory. // Prefetch instruction // Do prefetch arg0 address with option aux. arg0=addr, arg1=memory, aux=option. diff --git a/src/cmd/compile/internal/ssa/_gen/ARMOps.go b/src/cmd/compile/internal/ssa/_gen/ARMOps.go index 3ad96fcac0..01cd48835e 100644 --- a/src/cmd/compile/internal/ssa/_gen/ARMOps.go +++ b/src/cmd/compile/internal/ssa/_gen/ARMOps.go @@ -94,11 +94,11 @@ func init() { gpspsbg = gpspg | buildReg("SB") fp = buildReg("F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15") callerSave = gp | fp | buildReg("g") // runtime.setg (and anything calling it) may clobber g + lr = buildReg("R14") r0 = buildReg("R0") r1 = buildReg("R1") r2 = buildReg("R2") r3 = buildReg("R3") - r4 = buildReg("R4") ) // Common regInfo var ( @@ -540,16 +540,19 @@ func init() { // See runtime/stubs.go for a more detailed discussion. {name: "LoweredGetCallerPC", reg: gp01, rematerializeable: true}, - // There are three of these functions so that they can have three different register inputs. - // When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the - // default registers to match so we don't need to copy registers around unnecessarily. - {name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r0, r1}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - // Extend ops are the same as Bounds ops except the indexes are 64-bit. - {name: "LoweredPanicExtendA", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r4, r2, r3}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go). - {name: "LoweredPanicExtendB", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r4, r1, r2}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go). - {name: "LoweredPanicExtendC", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r4, r0, r1}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go). + // LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail. + // the RC and CR versions are used when one of the arguments is a constant. CC is used + // when both are constant (normally both 0, as prove derives the fact that a [0] bounds + // failure means the length must have also been 0). + // AuxInt contains a report code (see PanicBounds in genericOps.go). + {name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{gp &^ lr, gp &^ lr}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory. + {name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp &^ lr}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp &^ lr}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory. + + // Same as above, but the x value is 64 bits. + {name: "LoweredPanicExtendRR", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r0 | r1 | r2 | r3, r0 | r1 | r2 | r3, gp}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=y, arg3=mem, returns memory. + {name: "LoweredPanicExtendRC", argLength: 3, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{r0 | r1 | r2 | r3, r0 | r1 | r2 | r3}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=mem, returns memory. // Constant flag value. // Note: there's an "unordered" outcome for floating-point diff --git a/src/cmd/compile/internal/ssa/_gen/LOONG64.rules b/src/cmd/compile/internal/ssa/_gen/LOONG64.rules index cab63a503f..9d0ad0148f 100644 --- a/src/cmd/compile/internal/ssa/_gen/LOONG64.rules +++ b/src/cmd/compile/internal/ssa/_gen/LOONG64.rules @@ -527,9 +527,11 @@ // Publication barrier as intrinsic (PubBarrier ...) => (LoweredPubBarrier ...) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem) +(PanicBounds ...) => (LoweredPanicBoundsRR ...) +(LoweredPanicBoundsRR [kind] x (MOVVconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) +(LoweredPanicBoundsRR [kind] (MOVVconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) +(LoweredPanicBoundsRC [kind] {p} (MOVVconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) +(LoweredPanicBoundsCR [kind] {p} (MOVVconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) (CondSelect <t> x y cond) => (OR (MASKEQZ <t> x cond) (MASKNEZ <t> y cond)) @@ -748,10 +750,10 @@ (SRLVconst [rc] (MOVBUreg x)) && rc >= 8 => (MOVVconst [0]) // mul by constant -(MULV x (MOVVconst [-1])) => (NEGV x) (MULV _ (MOVVconst [0])) => (MOVVconst [0]) (MULV x (MOVVconst [1])) => x -(MULV x (MOVVconst [c])) && isPowerOfTwo(c) => (SLLVconst [log64(c)] x) + +(MULV x (MOVVconst [c])) && canMulStrengthReduce(config, c) => {mulStrengthReduce(v, x, c)} // div by constant (DIVVU x (MOVVconst [1])) => x @@ -843,6 +845,14 @@ (MOVBUreg (ANDconst [c] x)) => (ANDconst [c&0xff] x) +// Avoid extending when already sufficiently masked. +(MOVBreg x:(ANDconst [c] y)) && c >= 0 && int64(int8(c)) == c => x +(MOVHreg x:(ANDconst [c] y)) && c >= 0 && int64(int16(c)) == c => x +(MOVWreg x:(ANDconst [c] y)) && c >= 0 && int64(int32(c)) == c => x +(MOVBUreg x:(ANDconst [c] y)) && c >= 0 && int64(uint8(c)) == c => x +(MOVHUreg x:(ANDconst [c] y)) && c >= 0 && int64(uint16(c)) == c => x +(MOVWUreg x:(ANDconst [c] y)) && c >= 0 && int64(uint32(c)) == c => x + // Prefetch instructions (hint specified using aux field) // For PRELD{,X} A value of hint indicates: // hint=0 is defined as load prefetch to L1-cache diff --git a/src/cmd/compile/internal/ssa/_gen/LOONG64Ops.go b/src/cmd/compile/internal/ssa/_gen/LOONG64Ops.go index 5ef304b4f9..0e204c4a3c 100644 --- a/src/cmd/compile/internal/ssa/_gen/LOONG64Ops.go +++ b/src/cmd/compile/internal/ssa/_gen/LOONG64Ops.go @@ -130,10 +130,7 @@ func init() { gpspsbg = gpspg | buildReg("SB") fp = buildReg("F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 F16 F17 F18 F19 F20 F21 F22 F23 F24 F25 F26 F27 F28 F29 F30 F31") callerSave = gp | fp | buildReg("g") // runtime.setg (and anything calling it) may clobber g - r1 = buildReg("R20") - r2 = buildReg("R21") - r3 = buildReg("R23") - r4 = buildReg("R24") + first16 = buildReg("R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19") ) // Common regInfo var ( @@ -563,12 +560,15 @@ func init() { // Do data barrier. arg0=memorys {name: "LoweredPubBarrier", argLength: 1, asm: "DBAR", hasSideEffects: true}, - // There are three of these functions so that they can have three different register inputs. - // When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the - // default registers to match so we don't need to copy registers around unnecessarily. - {name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r3, r4}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). + // LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail. + // the RC and CR versions are used when one of the arguments is a constant. CC is used + // when both are constant (normally both 0, as prove derives the fact that a [0] bounds + // failure means the length must have also been 0). + // AuxInt contains a report code (see PanicBounds in genericOps.go). + {name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{first16, first16}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory. + {name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory. // Prefetch instruction // Do prefetch arg0 address with option aux. arg0=addr, arg1=memory, aux=option. diff --git a/src/cmd/compile/internal/ssa/_gen/LOONG64latelower.rules b/src/cmd/compile/internal/ssa/_gen/LOONG64latelower.rules new file mode 100644 index 0000000000..95844381c2 --- /dev/null +++ b/src/cmd/compile/internal/ssa/_gen/LOONG64latelower.rules @@ -0,0 +1,6 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Prefer addition when shifting left by one. +(SLLVconst [1] x) => (ADDV x x) diff --git a/src/cmd/compile/internal/ssa/_gen/MIPS.rules b/src/cmd/compile/internal/ssa/_gen/MIPS.rules index a9bac5fabe..80bf9017f5 100644 --- a/src/cmd/compile/internal/ssa/_gen/MIPS.rules +++ b/src/cmd/compile/internal/ssa/_gen/MIPS.rules @@ -423,13 +423,17 @@ // Publication barrier as intrinsic (PubBarrier ...) => (LoweredPubBarrier ...) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem) -(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 0 => (LoweredPanicExtendA [kind] hi lo y mem) -(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 1 => (LoweredPanicExtendB [kind] hi lo y mem) -(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 2 => (LoweredPanicExtendC [kind] hi lo y mem) +(PanicBounds ...) => (LoweredPanicBoundsRR ...) +(PanicExtend ...) => (LoweredPanicExtendRR ...) + +(LoweredPanicBoundsRR [kind] x (MOVWconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem) +(LoweredPanicBoundsRR [kind] (MOVWconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem) +(LoweredPanicBoundsRC [kind] {p} (MOVWconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem) + +(LoweredPanicExtendRR [kind] hi lo (MOVWconst [c]) mem) => (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem) +(LoweredPanicExtendRR [kind] (MOVWconst [hi]) (MOVWconst [lo]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem) +(LoweredPanicExtendRC [kind] {p} (MOVWconst [hi]) (MOVWconst [lo]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem) // Optimizations @@ -607,13 +611,13 @@ (Select0 (MULTU (MOVWconst [1]) _ )) => (MOVWconst [0]) (Select1 (MULTU (MOVWconst [-1]) x )) => (NEG <x.Type> x) (Select0 (MULTU (MOVWconst [-1]) x )) => (CMOVZ (ADDconst <x.Type> [-1] x) (MOVWconst [0]) x) -(Select1 (MULTU (MOVWconst [c]) x )) && isPowerOfTwo(int64(uint32(c))) => (SLLconst [int32(log2uint32(int64(c)))] x) -(Select0 (MULTU (MOVWconst [c]) x )) && isPowerOfTwo(int64(uint32(c))) => (SRLconst [int32(32-log2uint32(int64(c)))] x) +(Select1 (MULTU (MOVWconst [c]) x )) && isUnsignedPowerOfTwo(uint32(c)) => (SLLconst [int32(log32u(uint32(c)))] x) +(Select0 (MULTU (MOVWconst [c]) x )) && isUnsignedPowerOfTwo(uint32(c)) => (SRLconst [int32(32-log32u(uint32(c)))] x) (MUL (MOVWconst [0]) _ ) => (MOVWconst [0]) (MUL (MOVWconst [1]) x ) => x (MUL (MOVWconst [-1]) x ) => (NEG x) -(MUL (MOVWconst [c]) x ) && isPowerOfTwo(int64(uint32(c))) => (SLLconst [int32(log2uint32(int64(c)))] x) +(MUL (MOVWconst [c]) x ) && isUnsignedPowerOfTwo(uint32(c)) => (SLLconst [int32(log32u(uint32(c)))] x) // generic simplifications (ADD x (NEG y)) => (SUB x y) diff --git a/src/cmd/compile/internal/ssa/_gen/MIPS64.rules b/src/cmd/compile/internal/ssa/_gen/MIPS64.rules index 8e484f4a3d..bb862e282b 100644 --- a/src/cmd/compile/internal/ssa/_gen/MIPS64.rules +++ b/src/cmd/compile/internal/ssa/_gen/MIPS64.rules @@ -479,9 +479,11 @@ // Publication barrier as intrinsic (PubBarrier ...) => (LoweredPubBarrier ...) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem) +(PanicBounds ...) => (LoweredPanicBoundsRR ...) +(LoweredPanicBoundsRR [kind] x (MOVVconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) +(LoweredPanicBoundsRR [kind] (MOVVconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) +(LoweredPanicBoundsRC [kind] {p} (MOVVconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) +(LoweredPanicBoundsCR [kind] {p} (MOVVconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) // Optimizations diff --git a/src/cmd/compile/internal/ssa/_gen/MIPS64Ops.go b/src/cmd/compile/internal/ssa/_gen/MIPS64Ops.go index 6c04a1aea2..14f6c5c990 100644 --- a/src/cmd/compile/internal/ssa/_gen/MIPS64Ops.go +++ b/src/cmd/compile/internal/ssa/_gen/MIPS64Ops.go @@ -136,10 +136,7 @@ func init() { lo = buildReg("LO") hi = buildReg("HI") callerSave = gp | fp | lo | hi | buildReg("g") // runtime.setg (and anything calling it) may clobber g - r1 = buildReg("R1") - r2 = buildReg("R2") - r3 = buildReg("R3") - r4 = buildReg("R4") + first16 = buildReg("R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16") ) // Common regInfo var ( @@ -469,12 +466,15 @@ func init() { // Do data barrier. arg0=memorys {name: "LoweredPubBarrier", argLength: 1, asm: "SYNC", hasSideEffects: true}, - // There are three of these functions so that they can have three different register inputs. - // When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the - // default registers to match so we don't need to copy registers around unnecessarily. - {name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r3, r4}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). + // LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail. + // the RC and CR versions are used when one of the arguments is a constant. CC is used + // when both are constant (normally both 0, as prove derives the fact that a [0] bounds + // failure means the length must have also been 0). + // AuxInt contains a report code (see PanicBounds in genericOps.go). + {name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{first16, first16}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory. + {name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory. } blocks := []blockData{ diff --git a/src/cmd/compile/internal/ssa/_gen/MIPSOps.go b/src/cmd/compile/internal/ssa/_gen/MIPSOps.go index 62c35ed49f..a340775c07 100644 --- a/src/cmd/compile/internal/ssa/_gen/MIPSOps.go +++ b/src/cmd/compile/internal/ssa/_gen/MIPSOps.go @@ -120,11 +120,8 @@ func init() { lo = buildReg("LO") hi = buildReg("HI") callerSave = gp | fp | lo | hi | buildReg("g") // runtime.setg (and anything calling it) may clobber g - r1 = buildReg("R1") - r2 = buildReg("R2") - r3 = buildReg("R3") - r4 = buildReg("R4") - r5 = buildReg("R5") + first16 = buildReg("R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16") + first4 = buildReg("R1 R2 R3 R4") ) // Common regInfo var ( @@ -411,16 +408,19 @@ func init() { // Do data barrier. arg0=memorys {name: "LoweredPubBarrier", argLength: 1, asm: "SYNC", hasSideEffects: true}, - // There are three of these functions so that they can have three different register inputs. - // When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the - // default registers to match so we don't need to copy registers around unnecessarily. - {name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r3, r4}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - // Extend ops are the same as Bounds ops except the indexes are 64-bit. - {name: "LoweredPanicExtendA", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r5, r3, r4}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go). - {name: "LoweredPanicExtendB", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r5, r2, r3}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go). - {name: "LoweredPanicExtendC", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r5, r1, r2}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go). + // LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail. + // the RC and CR versions are used when one of the arguments is a constant. CC is used + // when both are constant (normally both 0, as prove derives the fact that a [0] bounds + // failure means the length must have also been 0). + // AuxInt contains a report code (see PanicBounds in genericOps.go). + {name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{first16, first16}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory. + {name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory. + + // Same as above, but the x value is 64 bits. + {name: "LoweredPanicExtendRR", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{first4, first4, first16}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=y, arg3=mem, returns memory. + {name: "LoweredPanicExtendRC", argLength: 3, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first4, first4}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=mem, returns memory. } blocks := []blockData{ diff --git a/src/cmd/compile/internal/ssa/_gen/RISCV64.rules b/src/cmd/compile/internal/ssa/_gen/RISCV64.rules index dc1cc97fb3..a99a16adff 100644 --- a/src/cmd/compile/internal/ssa/_gen/RISCV64.rules +++ b/src/cmd/compile/internal/ssa/_gen/RISCV64.rules @@ -407,9 +407,11 @@ // Publication barrier as intrinsic (PubBarrier ...) => (LoweredPubBarrier ...) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem) +(PanicBounds ...) => (LoweredPanicBoundsRR ...) +(LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) +(LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) +(LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) +(LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) // Small moves (Move [0] _ _ mem) => mem diff --git a/src/cmd/compile/internal/ssa/_gen/RISCV64Ops.go b/src/cmd/compile/internal/ssa/_gen/RISCV64Ops.go index 8cb042a604..c12bc47621 100644 --- a/src/cmd/compile/internal/ssa/_gen/RISCV64Ops.go +++ b/src/cmd/compile/internal/ssa/_gen/RISCV64Ops.go @@ -49,7 +49,7 @@ func riscv64RegName(r int) string { func init() { var regNamesRISCV64 []string - var gpMask, fpMask, gpgMask, gpspMask, gpspsbMask, gpspsbgMask regMask + var gpMask, fpMask, gpgMask, gpspMask, gpspsbMask, gpspsbgMask, first16Mask regMask regNamed := make(map[string]regMask) // Build the list of register names, creating an appropriately indexed @@ -93,6 +93,9 @@ func init() { gpspMask |= mask gpspsbMask |= mask gpspsbgMask |= mask + if r >= 5 && r < 5+16 { + first16Mask |= mask + } } } @@ -429,12 +432,15 @@ func init() { // Do data barrier. arg0=memorys {name: "LoweredPubBarrier", argLength: 1, asm: "FENCE", hasSideEffects: true}, - // There are three of these functions so that they can have three different register inputs. - // When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the - // default registers to match so we don't need to copy registers around unnecessarily. - {name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{regNamed["X7"], regNamed["X28"]}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{regNamed["X6"], regNamed["X7"]}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). - {name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{regNamed["X5"], regNamed["X6"]}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go). + // LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail. + // the RC and CR versions are used when one of the arguments is a constant. CC is used + // when both are constant (normally both 0, as prove derives the fact that a [0] bounds + // failure means the length must have also been 0). + // AuxInt contains a report code (see PanicBounds in genericOps.go). + {name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{first16Mask, first16Mask}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory. + {name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16Mask}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16Mask}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory. // F extension. {name: "FADDS", argLength: 2, reg: fp21, asm: "FADDS", commutative: true, typ: "Float32"}, // arg0 + arg1 diff --git a/src/cmd/compile/internal/ssa/_gen/S390X.rules b/src/cmd/compile/internal/ssa/_gen/S390X.rules index 231ad0615d..664bf4a89c 100644 --- a/src/cmd/compile/internal/ssa/_gen/S390X.rules +++ b/src/cmd/compile/internal/ssa/_gen/S390X.rules @@ -145,6 +145,9 @@ (Sqrt32 ...) => (FSQRTS ...) +(Max(64|32)F ...) => (WFMAX(D|S)B ...) +(Min(64|32)F ...) => (WFMIN(D|S)B ...) + // Atomic loads and stores. // The SYNC instruction (fast-BCR-serialization) prevents store-load // reordering. Other sequences of memory operations (load-load, @@ -455,9 +458,11 @@ // Write barrier. (WB ...) => (LoweredWB ...) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem) -(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem) +(PanicBounds ...) => (LoweredPanicBoundsRR ...) +(LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) +(LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) +(LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) +(LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) // *************************** // Above: lowering rules diff --git a/src/cmd/compile/internal/ssa/_gen/S390XOps.go b/src/cmd/compile/internal/ssa/_gen/S390XOps.go index 2f57d12630..c002d5bcc3 100644 --- a/src/cmd/compile/internal/ssa/_gen/S390XOps.go +++ b/src/cmd/compile/internal/ssa/_gen/S390XOps.go @@ -114,6 +114,7 @@ func init() { sb = buildReg("SB") r0 = buildReg("R0") tmp = buildReg("R11") // R11 is used as a temporary in a small number of instructions. + lr = buildReg("R14") // R10 is reserved by the assembler. gp = buildReg("R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R11 R12 R14") @@ -222,6 +223,12 @@ func init() { {name: "LNDFR", argLength: 1, reg: fp11, asm: "LNDFR"}, // fp64/fp32 clear sign bit {name: "CPSDR", argLength: 2, reg: fp21, asm: "CPSDR"}, // fp64/fp32 copy arg1 sign bit to arg0 + // Single element vector floating point min / max instructions + {name: "WFMAXDB", argLength: 2, reg: fp21, asm: "WFMAXDB", typ: "Float64"}, // max[float64](arg0, arg1) + {name: "WFMAXSB", argLength: 2, reg: fp21, asm: "WFMAXSB", typ: "Float32"}, // max[float32](arg0, arg1) + {name: "WFMINDB", argLength: 2, reg: fp21, asm: "WFMINDB", typ: "Float64"}, // min[float64](arg0, arg1) + {name: "WFMINSB", argLength: 2, reg: fp21, asm: "WFMINSB", typ: "Float32"}, // min[float32](arg0, arg1) + // Round to integer, float64 only. // // aux | rounding mode @@ -512,12 +519,15 @@ func init() { // Returns a pointer to a write barrier buffer in R9. {name: "LoweredWB", argLength: 1, reg: regInfo{clobbers: (callerSave &^ gpg) | buildReg("R14") | r1, outputs: []regMask{r9}}, clobberFlags: true, aux: "Int64"}, - // There are three of these functions so that they can have three different register inputs. - // When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the - // default registers to match so we don't need to copy registers around unnecessarily. - {name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go). - {name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go). - {name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r0, r1}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go). + // LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail. + // the RC and CR versions are used when one of the arguments is a constant. CC is used + // when both are constant (normally both 0, as prove derives the fact that a [0] bounds + // failure means the length must have also been 0). + // AuxInt contains a report code (see PanicBounds in genericOps.go). + {name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{gp &^ lr, gp &^ lr}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory. + {name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp &^ lr}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp &^ lr}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory. + {name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory. // Constant condition code values. The condition code can be 0, 1, 2 or 3. {name: "FlagEQ"}, // CC=0 (equal) diff --git a/src/cmd/compile/internal/ssa/_gen/generic.rules b/src/cmd/compile/internal/ssa/_gen/generic.rules index 1077921f93..00e8fcbe32 100644 --- a/src/cmd/compile/internal/ssa/_gen/generic.rules +++ b/src/cmd/compile/internal/ssa/_gen/generic.rules @@ -295,6 +295,10 @@ (Neq16 (Const16 <t> [c]) (Add16 (Const16 <t> [d]) x)) => (Neq16 (Const16 <t> [c-d]) x) (Neq8 (Const8 <t> [c]) (Add8 (Const8 <t> [d]) x)) => (Neq8 (Const8 <t> [c-d]) x) +(CondSelect x _ (ConstBool [true ])) => x +(CondSelect _ y (ConstBool [false])) => y +(CondSelect x x _) => x + // signed integer range: ( c <= x && x (<|<=) d ) -> ( unsigned(x-c) (<|<=) unsigned(d-c) ) (AndB (Leq64 (Const64 [c]) x) ((Less|Leq)64 x (Const64 [d]))) && d >= c => ((Less|Leq)64U (Sub64 <x.Type> x (Const64 <x.Type> [c])) (Const64 <x.Type> [d-c])) (AndB (Leq32 (Const32 [c]) x) ((Less|Leq)32 x (Const32 [d]))) && d >= c => ((Less|Leq)32U (Sub32 <x.Type> x (Const32 <x.Type> [c])) (Const32 <x.Type> [d-c])) @@ -1010,11 +1014,10 @@ // See ../magic.go for a detailed description of these algorithms. // Unsigned divide by power of 2. Strength reduce to a shift. -(Div8u n (Const8 [c])) && isPowerOfTwo(c) => (Rsh8Ux64 n (Const64 <typ.UInt64> [log8(c)])) -(Div16u n (Const16 [c])) && isPowerOfTwo(c) => (Rsh16Ux64 n (Const64 <typ.UInt64> [log16(c)])) -(Div32u n (Const32 [c])) && isPowerOfTwo(c) => (Rsh32Ux64 n (Const64 <typ.UInt64> [log32(c)])) -(Div64u n (Const64 [c])) && isPowerOfTwo(c) => (Rsh64Ux64 n (Const64 <typ.UInt64> [log64(c)])) -(Div64u n (Const64 [-1<<63])) => (Rsh64Ux64 n (Const64 <typ.UInt64> [63])) +(Div8u n (Const8 [c])) && isUnsignedPowerOfTwo(uint8(c)) => (Rsh8Ux64 n (Const64 <typ.UInt64> [log8u(uint8(c))])) +(Div16u n (Const16 [c])) && isUnsignedPowerOfTwo(uint16(c)) => (Rsh16Ux64 n (Const64 <typ.UInt64> [log16u(uint16(c))])) +(Div32u n (Const32 [c])) && isUnsignedPowerOfTwo(uint32(c)) => (Rsh32Ux64 n (Const64 <typ.UInt64> [log32u(uint32(c))])) +(Div64u n (Const64 [c])) && isUnsignedPowerOfTwo(uint64(c)) => (Rsh64Ux64 n (Const64 <typ.UInt64> [log64u(uint64(c))])) // Signed non-negative divide by power of 2. (Div8 n (Const8 [c])) && isNonNegative(n) && isPowerOfTwo(c) => (Rsh8Ux64 n (Const64 <typ.UInt64> [log8(c)])) @@ -1290,11 +1293,10 @@ (Const64 <typ.UInt64> [63]))) // Unsigned mod by power of 2 constant. -(Mod8u <t> n (Const8 [c])) && isPowerOfTwo(c) => (And8 n (Const8 <t> [c-1])) -(Mod16u <t> n (Const16 [c])) && isPowerOfTwo(c) => (And16 n (Const16 <t> [c-1])) -(Mod32u <t> n (Const32 [c])) && isPowerOfTwo(c) => (And32 n (Const32 <t> [c-1])) -(Mod64u <t> n (Const64 [c])) && isPowerOfTwo(c) => (And64 n (Const64 <t> [c-1])) -(Mod64u <t> n (Const64 [-1<<63])) => (And64 n (Const64 <t> [1<<63-1])) +(Mod8u <t> n (Const8 [c])) && isUnsignedPowerOfTwo(uint8(c)) => (And8 n (Const8 <t> [c-1])) +(Mod16u <t> n (Const16 [c])) && isUnsignedPowerOfTwo(uint16(c)) => (And16 n (Const16 <t> [c-1])) +(Mod32u <t> n (Const32 [c])) && isUnsignedPowerOfTwo(uint32(c)) => (And32 n (Const32 <t> [c-1])) +(Mod64u <t> n (Const64 [c])) && isUnsignedPowerOfTwo(uint64(c)) => (And64 n (Const64 <t> [c-1])) // Signed non-negative mod by power of 2 constant. (Mod8 <t> n (Const8 [c])) && isNonNegative(n) && isPowerOfTwo(c) => (And8 n (Const8 <t> [c-1])) @@ -2053,9 +2055,7 @@ (Select1 (MakeTuple x y)) => y // for rewriting results of some late-expanded rewrites (below) -(SelectN [0] (MakeResult x ___)) => x -(SelectN [1] (MakeResult x y ___)) => y -(SelectN [2] (MakeResult x y z ___)) => z +(SelectN [n] m:(MakeResult ___)) => m.Args[n] // for late-expanded calls, recognize newobject and remove zeroing and nilchecks (Zero (SelectN [0] call:(StaticLECall _ _)) mem:(SelectN [1] call)) @@ -2843,3 +2843,19 @@ && clobber(sbts) && clobber(key) => (StaticLECall {f} [argsize] dict_ (StringMake <typ.String> ptr len) mem) + +// Transform some CondSelect into math operations. +// if b { x++ } => x += b // but not on arm64 because it has CSINC +(CondSelect (Add8 <t> x (Const8 [1])) x bool) && config.arch != "arm64" => (Add8 x (CvtBoolToUint8 <t> bool)) +(CondSelect (Add(64|32|16) <t> x (Const(64|32|16) [1])) x bool) && config.arch != "arm64" => (Add(64|32|16) x (ZeroExt8to(64|32|16) <t> (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))) + +// if b { x-- } => x -= b +(CondSelect (Add8 <t> x (Const8 [-1])) x bool) => (Sub8 x (CvtBoolToUint8 <t> bool)) +(CondSelect (Add(64|32|16) <t> x (Const(64|32|16) [-1])) x bool) => (Sub(64|32|16) x (ZeroExt8to(64|32|16) <t> (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))) + +// if b { x <<= 1 } => x <<= b +(CondSelect (Lsh(64|32|16|8)x64 x (Const64 [1])) x bool) => (Lsh(64|32|16|8)x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + +// if b { x >>= 1 } => x >>= b +(CondSelect (Rsh(64|32|16|8)x64 x (Const64 [1])) x bool) => (Rsh(64|32|16|8)x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) +(CondSelect (Rsh(64|32|16|8)Ux64 x (Const64 [1])) x bool) => (Rsh(64|32|16|8)Ux8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) diff --git a/src/cmd/compile/internal/ssa/_gen/main.go b/src/cmd/compile/internal/ssa/_gen/main.go index 5b85cec79c..a26a4a4ea8 100644 --- a/src/cmd/compile/internal/ssa/_gen/main.go +++ b/src/cmd/compile/internal/ssa/_gen/main.go @@ -88,6 +88,10 @@ type regInfo struct { // clobbers encodes the set of registers that are overwritten by // the instruction (other than the output registers). clobbers regMask + // Instruction clobbers the register containing input 0. + clobbersArg0 bool + // Instruction clobbers the register containing input 1. + clobbersArg1 bool // outputs[i] encodes the set of registers allowed for the i'th output. outputs []regMask } @@ -294,7 +298,7 @@ func genOp() { fmt.Fprintf(w, "argLen: %d,\n", v.argLength) if v.rematerializeable { - if v.reg.clobbers != 0 { + if v.reg.clobbers != 0 || v.reg.clobbersArg0 || v.reg.clobbersArg1 { log.Fatalf("%s is rematerializeable and clobbers registers", v.name) } if v.clobberFlags { @@ -403,6 +407,12 @@ func genOp() { if v.reg.clobbers > 0 { fmt.Fprintf(w, "clobbers: %d,%s\n", v.reg.clobbers, a.regMaskComment(v.reg.clobbers)) } + if v.reg.clobbersArg0 { + fmt.Fprintf(w, "clobbersArg0: true,\n") + } + if v.reg.clobbersArg1 { + fmt.Fprintf(w, "clobbersArg1: true,\n") + } // reg outputs s = s[:0] diff --git a/src/cmd/compile/internal/ssa/_gen/rulegen.go b/src/cmd/compile/internal/ssa/_gen/rulegen.go index 5e66398927..57fd2b0594 100644 --- a/src/cmd/compile/internal/ssa/_gen/rulegen.go +++ b/src/cmd/compile/internal/ssa/_gen/rulegen.go @@ -549,6 +549,13 @@ func (u *unusedInspector) node(node ast.Node) { } } case *ast.BasicLit: + case *ast.CompositeLit: + for _, e := range node.Elts { + u.node(e) + } + case *ast.KeyValueExpr: + u.node(node.Key) + u.node(node.Value) case *ast.ValueSpec: u.exprs(node.Values) default: @@ -1440,7 +1447,8 @@ func parseValue(val string, arch arch, loc string) (op opData, oparch, typ, auxi func opHasAuxInt(op opData) bool { switch op.aux { case "Bool", "Int8", "Int16", "Int32", "Int64", "Int128", "UInt8", "Float32", "Float64", - "SymOff", "CallOff", "SymValAndOff", "TypSize", "ARM64BitField", "FlagConstant", "CCop": + "SymOff", "CallOff", "SymValAndOff", "TypSize", "ARM64BitField", "FlagConstant", "CCop", + "PanicBoundsC", "PanicBoundsCC": return true } return false @@ -1449,7 +1457,7 @@ func opHasAuxInt(op opData) bool { func opHasAux(op opData) bool { switch op.aux { case "String", "Sym", "SymOff", "Call", "CallOff", "SymValAndOff", "Typ", "TypSize", - "S390XCCMask", "S390XRotateParams": + "S390XCCMask", "S390XRotateParams", "PanicBoundsC", "PanicBoundsCC": return true } return false @@ -1804,6 +1812,10 @@ func (op opData) auxType() string { return "s390x.CCMask" case "S390XRotateParams": return "s390x.RotateParams" + case "PanicBoundsC": + return "PanicBoundsC" + case "PanicBoundsCC": + return "PanicBoundsCC" default: return "invalid" } @@ -1844,6 +1856,8 @@ func (op opData) auxIntType() string { return "flagConstant" case "ARM64BitField": return "arm64BitField" + case "PanicBoundsC", "PanicBoundsCC": + return "int64" default: return "invalid" } diff --git a/src/cmd/compile/internal/ssa/biasedsparsemap.go b/src/cmd/compile/internal/ssa/biasedsparsemap.go index 948aef9a9b..3032309b7a 100644 --- a/src/cmd/compile/internal/ssa/biasedsparsemap.go +++ b/src/cmd/compile/internal/ssa/biasedsparsemap.go @@ -56,19 +56,23 @@ func (s *biasedSparseMap) contains(x uint) bool { return s.s.contains(ID(int(x) - s.first)) } -// get returns the value s maps for key x, or -1 if -// x is not mapped or is out of range for s. -func (s *biasedSparseMap) get(x uint) int32 { +// get returns the value s maps for key x and true, or +// 0/false if x is not mapped or is out of range for s. +func (s *biasedSparseMap) get(x uint) (int32, bool) { if s == nil || s.s == nil { - return -1 + return 0, false } if int(x) < s.first { - return -1 + return 0, false } if int(x) >= s.cap() { - return -1 + return 0, false } - return s.s.get(ID(int(x) - s.first)) + k := ID(int(x) - s.first) + if !s.s.contains(k) { + return 0, false + } + return s.s.get(k) } // getEntry returns the i'th key and value stored in s, diff --git a/src/cmd/compile/internal/ssa/check.go b/src/cmd/compile/internal/ssa/check.go index cb6788cd95..f33c9bc87b 100644 --- a/src/cmd/compile/internal/ssa/check.go +++ b/src/cmd/compile/internal/ssa/check.go @@ -215,6 +215,9 @@ func checkFunc(f *Func) { f.Fatalf("bad FlagConstant AuxInt value for %v", v) } canHaveAuxInt = true + case auxPanicBoundsC, auxPanicBoundsCC: + canHaveAux = true + canHaveAuxInt = true default: f.Fatalf("unknown aux type for %s", v.Op) } diff --git a/src/cmd/compile/internal/ssa/compile.go b/src/cmd/compile/internal/ssa/compile.go index e9500a24ed..1f47362583 100644 --- a/src/cmd/compile/internal/ssa/compile.go +++ b/src/cmd/compile/internal/ssa/compile.go @@ -473,11 +473,11 @@ var passes = [...]pass{ {name: "expand calls", fn: expandCalls, required: true}, {name: "decompose builtin", fn: postExpandCallsDecompose, required: true}, {name: "softfloat", fn: softfloat, required: true}, + {name: "branchelim", fn: branchelim}, {name: "late opt", fn: opt, required: true}, // TODO: split required rules and optimizing rules {name: "dead auto elim", fn: elimDeadAutosGeneric}, {name: "sccp", fn: sccp}, {name: "generic deadcode", fn: deadcode, required: true}, // remove dead stores, which otherwise mess up store chain - {name: "branchelim", fn: branchelim}, {name: "late fuse", fn: fuseLate}, {name: "check bce", fn: checkbce}, {name: "dse", fn: dse}, @@ -583,6 +583,10 @@ var passOrder = [...]constraint{ {"late fuse", "memcombine"}, // memcombine is a arch-independent pass. {"memcombine", "lower"}, + // late opt transform some CondSelects into math. + {"branchelim", "late opt"}, + // ranchelim is an arch-independent pass. + {"branchelim", "lower"}, } func init() { diff --git a/src/cmd/compile/internal/ssa/config.go b/src/cmd/compile/internal/ssa/config.go index 0299e808c6..1ee94b4ee2 100644 --- a/src/cmd/compile/internal/ssa/config.go +++ b/src/cmd/compile/internal/ssa/config.go @@ -291,6 +291,8 @@ func NewConfig(arch string, types Types, ctxt *obj.Link, optimize, softfloat boo c.RegSize = 8 c.lowerBlock = rewriteBlockLOONG64 c.lowerValue = rewriteValueLOONG64 + c.lateLowerBlock = rewriteBlockLOONG64latelower + c.lateLowerValue = rewriteValueLOONG64latelower c.registers = registersLOONG64[:] c.gpRegMask = gpRegMaskLOONG64 c.fpRegMask = fpRegMaskLOONG64 @@ -570,6 +572,43 @@ func (c *Config) buildRecipes(arch string) { return m.Block.NewValue2I(m.Pos, OpARM64SUBshiftLL, m.Type, int64(i), x, y) }) } + case "loong64": + // - multiply is 4 cycles. + // - add/sub/shift are 1 cycle. + // On loong64, using a multiply also needs to load the constant into a register. + // TODO: figure out a happy medium. + mulCost = 45 + + // add + r(1, 1, 10, + func(m, x, y *Value) *Value { + return m.Block.NewValue2(m.Pos, OpLOONG64ADDV, m.Type, x, y) + }) + // neg + r(-1, 0, 10, + func(m, x, y *Value) *Value { + return m.Block.NewValue1(m.Pos, OpLOONG64NEGV, m.Type, x) + }) + // sub + r(1, -1, 10, + func(m, x, y *Value) *Value { + return m.Block.NewValue2(m.Pos, OpLOONG64SUBV, m.Type, x, y) + }) + + // regular shifts + for i := 1; i < 64; i++ { + c := 10 + if i == 1 { + // Prefer x<<1 over x+x. + // Note that we eventually reverse this decision in LOONG64latelower.rules, + // but this makes shift combining rules in LOONG64.rules simpler. + c-- + } + r(1<<i, 0, c, + func(m, x, y *Value) *Value { + return m.Block.NewValue1I(m.Pos, OpLOONG64SLLVconst, m.Type, int64(i), x) + }) + } } c.mulRecipes = map[int64]mulRecipe{} @@ -636,17 +675,58 @@ func (c *Config) buildRecipes(arch string) { } } + // Currently we only process 3 linear combination instructions for loong64. + if arch == "loong64" { + // Three-instruction recipes. + // D: The first and the second are all single-instruction recipes, and they are also the third's inputs. + // E: The first single-instruction is the second's input, and the second is the third's input. + + // D + for _, first := range linearCombos { + for _, second := range linearCombos { + for _, third := range linearCombos { + x := third.a*(first.a+first.b) + third.b*(second.a+second.b) + cost := first.cost + second.cost + third.cost + old := c.mulRecipes[x] + if (old.build == nil || cost < old.cost) && cost < mulCost { + c.mulRecipes[x] = mulRecipe{cost: cost, build: func(m, v *Value) *Value { + v1 := first.build(m, v, v) + v2 := second.build(m, v, v) + return third.build(m, v1, v2) + }} + } + } + } + } + + // E + for _, first := range linearCombos { + for _, second := range linearCombos { + for _, third := range linearCombos { + x := third.a*(second.a*(first.a+first.b)+second.b) + third.b + cost := first.cost + second.cost + third.cost + old := c.mulRecipes[x] + if (old.build == nil || cost < old.cost) && cost < mulCost { + c.mulRecipes[x] = mulRecipe{cost: cost, build: func(m, v *Value) *Value { + v1 := first.build(m, v, v) + v2 := second.build(m, v1, v) + return third.build(m, v2, v) + }} + } + } + } + } + } + // These cases should be handled specially by rewrite rules. // (Otherwise v * 1 == (neg (neg v))) delete(c.mulRecipes, 0) delete(c.mulRecipes, 1) - // Currently we assume that it doesn't help to do 3 linear - // combination instructions. - // Currently: // len(c.mulRecipes) == 5984 on arm64 // 680 on amd64 + // 5984 on loong64 // This function takes ~2.5ms on arm64. //println(len(c.mulRecipes)) } diff --git a/src/cmd/compile/internal/ssa/deadcode.go b/src/cmd/compile/internal/ssa/deadcode.go index 1aa0f9e296..aa85097c29 100644 --- a/src/cmd/compile/internal/ssa/deadcode.go +++ b/src/cmd/compile/internal/ssa/deadcode.go @@ -257,7 +257,7 @@ func deadcode(f *Func) { // Find new homes for lost lines -- require earliest in data flow with same line that is also in same block for i := len(order) - 1; i >= 0; i-- { w := order[i] - if j := pendingLines.get(w.Pos); j > -1 && f.Blocks[j] == w.Block { + if j, ok := pendingLines.get(w.Pos); ok && f.Blocks[j] == w.Block { w.Pos = w.Pos.WithIsStmt() pendingLines.remove(w.Pos) } diff --git a/src/cmd/compile/internal/ssa/deadstore.go b/src/cmd/compile/internal/ssa/deadstore.go index f8c69dc698..9e67e83399 100644 --- a/src/cmd/compile/internal/ssa/deadstore.go +++ b/src/cmd/compile/internal/ssa/deadstore.go @@ -118,7 +118,8 @@ func dse(f *Func) { ptr = la } } - sr := shadowRange(shadowed.get(ptr.ID)) + srNum, _ := shadowed.get(ptr.ID) + sr := shadowRange(srNum) if sr.contains(off, off+sz) { // Modify the store/zero into a copy of the memory state, // effectively eliding the store operation. @@ -156,9 +157,7 @@ func dse(f *Func) { // A shadowRange encodes a set of byte offsets [lo():hi()] from // a given pointer that will be written to later in the block. -// A zero shadowRange encodes an empty shadowed range (and so -// does a -1 shadowRange, which is what sparsemap.get returns -// on a failed lookup). +// A zero shadowRange encodes an empty shadowed range. type shadowRange int32 func (sr shadowRange) lo() int64 { diff --git a/src/cmd/compile/internal/ssa/debug.go b/src/cmd/compile/internal/ssa/debug.go index aa503eda87..e92b37fb7b 100644 --- a/src/cmd/compile/internal/ssa/debug.go +++ b/src/cmd/compile/internal/ssa/debug.go @@ -41,6 +41,9 @@ type FuncDebug struct { RegOutputParams []*ir.Name // Variable declarations that were removed during optimization OptDcl []*ir.Name + // The ssa.Func.EntryID value, used to build location lists for + // return values promoted to heap in later DWARF generation. + EntryID ID // Filled in by the user. Translates Block and Value ID to PC. // @@ -1645,13 +1648,13 @@ func readPtr(ctxt *obj.Link, buf []byte) uint64 { } -// setupLocList creates the initial portion of a location list for a +// SetupLocList creates the initial portion of a location list for a // user variable. It emits the encoded start/end of the range and a // placeholder for the size. Return value is the new list plus the // slot in the list holding the size (to be updated later). -func setupLocList(ctxt *obj.Link, f *Func, list []byte, st, en ID) ([]byte, int) { - start, startOK := encodeValue(ctxt, f.Entry.ID, st) - end, endOK := encodeValue(ctxt, f.Entry.ID, en) +func SetupLocList(ctxt *obj.Link, entryID ID, list []byte, st, en ID) ([]byte, int) { + start, startOK := encodeValue(ctxt, entryID, st) + end, endOK := encodeValue(ctxt, entryID, en) if !startOK || !endOK { // This could happen if someone writes a function that uses // >65K values on a 32-bit platform. Hopefully a degraded debugging @@ -1800,7 +1803,6 @@ func isNamedRegParam(p abi.ABIParamAssignment) bool { // appropriate for the ".closureptr" compiler-synthesized variable // needed by the debugger for range func bodies. func BuildFuncDebugNoOptimized(ctxt *obj.Link, f *Func, loggingEnabled bool, stackOffset func(LocalSlot) int32, rval *FuncDebug) { - needCloCtx := f.CloSlot != nil pri := f.ABISelf.ABIAnalyzeFuncType(f.Type) @@ -1911,7 +1913,7 @@ func BuildFuncDebugNoOptimized(ctxt *obj.Link, f *Func, loggingEnabled bool, sta // Param is arriving in one or more registers. We need a 2-element // location expression for it. First entry in location list // will correspond to lifetime in input registers. - list, sizeIdx := setupLocList(ctxt, f, rval.LocationLists[pidx], + list, sizeIdx := SetupLocList(ctxt, f.Entry.ID, rval.LocationLists[pidx], BlockStart.ID, afterPrologVal) if list == nil { pidx++ @@ -1961,7 +1963,7 @@ func BuildFuncDebugNoOptimized(ctxt *obj.Link, f *Func, loggingEnabled bool, sta // Second entry in the location list will be the stack home // of the param, once it has been spilled. Emit that now. - list, sizeIdx = setupLocList(ctxt, f, list, + list, sizeIdx = SetupLocList(ctxt, f.Entry.ID, list, afterPrologVal, FuncEnd.ID) if list == nil { pidx++ diff --git a/src/cmd/compile/internal/ssa/debug_lines_test.go b/src/cmd/compile/internal/ssa/debug_lines_test.go index 857cce785f..79dbd91c2f 100644 --- a/src/cmd/compile/internal/ssa/debug_lines_test.go +++ b/src/cmd/compile/internal/ssa/debug_lines_test.go @@ -115,6 +115,34 @@ func TestDebugLines_53456(t *testing.T) { testDebugLinesDefault(t, "-N -l", "b53456.go", "(*T).Inc", []int{15, 16, 17, 18}, true) } +func TestDebugLines_74576(t *testing.T) { + unixOnly(t) + + switch testGoArch() { + default: + // Failed on linux/riscv64 (issue 74669), but conservatively + // skip many architectures like several other tests here. + t.Skip("skipped for many architectures") + + case "arm64", "amd64", "loong64": + tests := []struct { + file string + wantStmts []int + }{ + {"i74576a.go", []int{12, 13, 13, 14}}, + {"i74576b.go", []int{12, 13, 13, 14}}, + {"i74576c.go", []int{12, 13, 13, 14}}, + } + t.Parallel() + for _, test := range tests { + t.Run(test.file, func(t *testing.T) { + t.Parallel() + testDebugLines(t, "-N -l", test.file, "main", test.wantStmts, false) + }) + } + } +} + func compileAndDump(t *testing.T, file, function, moreGCFlags string) []byte { testenv.MustHaveGoBuild(t) @@ -223,6 +251,9 @@ func testInlineStack(t *testing.T, file, function string, wantStacks [][]int) { // then verifies that the statement-marked lines in that file are the same as those in wantStmts // These files must all be short because this is super-fragile. // "go build" is run in a temporary directory that is normally deleted, unless -test.v +// +// TODO: the tests calling this are somewhat expensive; perhaps more tests can be marked t.Parallel, +// or perhaps the mechanism here can be made more efficient. func testDebugLines(t *testing.T, gcflags, file, function string, wantStmts []int, ignoreRepeats bool) { dumpBytes := compileAndDump(t, file, function, gcflags) dump := bufio.NewScanner(bytes.NewReader(dumpBytes)) diff --git a/src/cmd/compile/internal/ssa/expand_calls.go b/src/cmd/compile/internal/ssa/expand_calls.go index 9e46182a4c..302626f902 100644 --- a/src/cmd/compile/internal/ssa/expand_calls.go +++ b/src/cmd/compile/internal/ssa/expand_calls.go @@ -243,11 +243,8 @@ func (x *expandState) rewriteFuncResults(v *Value, b *Block, aux *AuxCall) { if len(aRegs) > 0 { result = &allResults } else { - if a.Op == OpLoad && a.Args[0].Op == OpLocalAddr { - addr := a.Args[0] - if addr.MemoryArg() == a.MemoryArg() && addr.Aux == aux.NameOfResult(i) { - continue // Self move to output parameter - } + if a.Op == OpLoad && a.Args[0].Op == OpLocalAddr && a.Args[0].Aux == aux.NameOfResult(i) { + continue // Self move to output parameter } } rc.init(aRegs, aux.abiInfo, result, auxBase, auxOffset) diff --git a/src/cmd/compile/internal/ssa/likelyadjust.go b/src/cmd/compile/internal/ssa/likelyadjust.go index 1dfb53d355..06b9414a3f 100644 --- a/src/cmd/compile/internal/ssa/likelyadjust.go +++ b/src/cmd/compile/internal/ssa/likelyadjust.go @@ -12,18 +12,15 @@ type loop struct { header *Block // The header node of this (reducible) loop outer *loop // loop containing this loop - // By default, children, exits, and depth are not initialized. - children []*loop // loops nested directly within this loop. Initialized by assembleChildren(). - exits []*Block // exits records blocks reached by exits from this loop. Initialized by findExits(). - // Next three fields used by regalloc and/or // aid in computation of inner-ness and list of blocks. nBlocks int32 // Number of blocks in this loop but not within inner loops - depth int16 // Nesting depth of the loop; 1 is outermost. Initialized by calculateDepths(). + depth int16 // Nesting depth of the loop; 1 is outermost. isInner bool // True if never discovered to contain a loop - // register allocation uses this. - containsUnavoidableCall bool // True if all paths through the loop have a call + // True if all paths through the loop have a call. + // Computed and used by regalloc; stored here for convenience. + containsUnavoidableCall bool } // outerinner records that outer contains inner @@ -49,18 +46,6 @@ func (sdom SparseTree) outerinner(outer, inner *loop) { outer.isInner = false } -func checkContainsCall(bb *Block) bool { - if bb.Kind == BlockDefer { - return true - } - for _, v := range bb.Values { - if opcodeTable[v.Op].call { - return true - } - } - return false -} - type loopnest struct { f *Func b2l []*loop @@ -68,9 +53,6 @@ type loopnest struct { sdom SparseTree loops []*loop hasIrreducible bool // TODO current treatment of irreducible loops is very flaky, if accurate loops are needed, must punt at function level. - - // Record which of the lazily initialized fields have actually been initialized. - initializedChildren, initializedDepth, initializedExits bool } const ( @@ -355,91 +337,59 @@ func loopnestfor(f *Func) *loopnest { visited[b.ID] = true } - ln := &loopnest{f: f, b2l: b2l, po: po, sdom: sdom, loops: loops, hasIrreducible: sawIrred} - - // Calculate containsUnavoidableCall for regalloc - dominatedByCall := f.Cache.allocBoolSlice(f.NumBlocks()) - defer f.Cache.freeBoolSlice(dominatedByCall) - for _, b := range po { - if checkContainsCall(b) { - dominatedByCall[b.ID] = true - } - } - // Run dfs to find path through the loop that avoids all calls. - // Such path either escapes loop or return back to header. - // It isn't enough to have exit not dominated by any call, for example: - // ... some loop - // call1 call2 - // \ / - // exit - // ... - // exit is not dominated by any call, but we don't have call-free path to it. + // Compute depths. for _, l := range loops { - // Header contains call. - if dominatedByCall[l.header.ID] { - l.containsUnavoidableCall = true + if l.depth != 0 { + // Already computed because it is an ancestor of + // a previous loop. continue } - callfreepath := false - tovisit := make([]*Block, 0, len(l.header.Succs)) - // Push all non-loop non-exit successors of header onto toVisit. - for _, s := range l.header.Succs { - nb := s.Block() - // This corresponds to loop with zero iterations. - if !l.iterationEnd(nb, b2l) { - tovisit = append(tovisit, nb) + // Find depth by walking up the loop tree. + d := int16(0) + for x := l; x != nil; x = x.outer { + if x.depth != 0 { + d += x.depth + break } + d++ } - for len(tovisit) > 0 { - cur := tovisit[len(tovisit)-1] - tovisit = tovisit[:len(tovisit)-1] - if dominatedByCall[cur.ID] { - continue - } - // Record visited in dominatedByCall. - dominatedByCall[cur.ID] = true - for _, s := range cur.Succs { - nb := s.Block() - if l.iterationEnd(nb, b2l) { - callfreepath = true - } - if !dominatedByCall[nb.ID] { - tovisit = append(tovisit, nb) - } - - } - if callfreepath { + // Set depth for every ancestor. + for x := l; x != nil; x = x.outer { + if x.depth != 0 { break } + x.depth = d + d-- + } + } + // Double-check depths. + for _, l := range loops { + want := int16(1) + if l.outer != nil { + want = l.outer.depth + 1 } - if !callfreepath { - l.containsUnavoidableCall = true + if l.depth != want { + l.header.Fatalf("bad depth calculation for loop %s: got %d want %d", l.header, l.depth, want) } } + ln := &loopnest{f: f, b2l: b2l, po: po, sdom: sdom, loops: loops, hasIrreducible: sawIrred} + // Curious about the loopiness? "-d=ssa/likelyadjust/stats" if f.pass != nil && f.pass.stats > 0 && len(loops) > 0 { - ln.assembleChildren() - ln.calculateDepths() - ln.findExits() // Note stats for non-innermost loops are slightly flawed because // they don't account for inner loop exits that span multiple levels. for _, l := range loops { - x := len(l.exits) - cf := 0 - if !l.containsUnavoidableCall { - cf = 1 - } inner := 0 if l.isInner { inner++ } - f.LogStat("loopstats:", - l.depth, "depth", x, "exits", - inner, "is_inner", cf, "always_calls", l.nBlocks, "n_blocks") + f.LogStat("loopstats in "+f.Name+":", + l.depth, "depth", + inner, "is_inner", l.nBlocks, "n_blocks") } } @@ -465,62 +415,6 @@ func loopnestfor(f *Func) *loopnest { return ln } -// assembleChildren initializes the children field of each -// loop in the nest. Loop A is a child of loop B if A is -// directly nested within B (based on the reducible-loops -// detection above) -func (ln *loopnest) assembleChildren() { - if ln.initializedChildren { - return - } - for _, l := range ln.loops { - if l.outer != nil { - l.outer.children = append(l.outer.children, l) - } - } - ln.initializedChildren = true -} - -// calculateDepths uses the children field of loops -// to determine the nesting depth (outer=1) of each -// loop. This is helpful for finding exit edges. -func (ln *loopnest) calculateDepths() { - if ln.initializedDepth { - return - } - ln.assembleChildren() - for _, l := range ln.loops { - if l.outer == nil { - l.setDepth(1) - } - } - ln.initializedDepth = true -} - -// findExits uses loop depth information to find the -// exits from a loop. -func (ln *loopnest) findExits() { - if ln.initializedExits { - return - } - ln.calculateDepths() - b2l := ln.b2l - for _, b := range ln.po { - l := b2l[b.ID] - if l != nil && len(b.Succs) == 2 { - sl := b2l[b.Succs[0].b.ID] - if recordIfExit(l, sl, b.Succs[0].b) { - continue - } - sl = b2l[b.Succs[1].b.ID] - if recordIfExit(l, sl, b.Succs[1].b) { - continue - } - } - } - ln.initializedExits = true -} - // depth returns the loop nesting level of block b. func (ln *loopnest) depth(b ID) int16 { if l := ln.b2l[b]; l != nil { @@ -528,39 +422,3 @@ func (ln *loopnest) depth(b ID) int16 { } return 0 } - -// recordIfExit checks sl (the loop containing b) to see if it -// is outside of loop l, and if so, records b as an exit block -// from l and returns true. -func recordIfExit(l, sl *loop, b *Block) bool { - if sl != l { - if sl == nil || sl.depth <= l.depth { - l.exits = append(l.exits, b) - return true - } - // sl is not nil, and is deeper than l - // it's possible for this to be a goto into an irreducible loop made from gotos. - for sl.depth > l.depth { - sl = sl.outer - } - if sl != l { - l.exits = append(l.exits, b) - return true - } - } - return false -} - -func (l *loop) setDepth(d int16) { - l.depth = d - for _, c := range l.children { - c.setDepth(d + 1) - } -} - -// iterationEnd checks if block b ends iteration of loop l. -// Ending iteration means either escaping to outer loop/code or -// going back to header -func (l *loop) iterationEnd(b *Block, b2l []*loop) bool { - return b == l.header || b2l[b.ID] == nil || (b2l[b.ID] != l && b2l[b.ID].depth <= l.depth) -} diff --git a/src/cmd/compile/internal/ssa/loopbce.go b/src/cmd/compile/internal/ssa/loopbce.go index dd1f39dbef..aa6cc48cac 100644 --- a/src/cmd/compile/internal/ssa/loopbce.go +++ b/src/cmd/compile/internal/ssa/loopbce.go @@ -37,19 +37,20 @@ type indVar struct { // - the minimum bound // - the increment value // - the "next" value (SSA value that is Phi'd into the induction variable every loop) +// - the header's edge returning from the body // // Currently, we detect induction variables that match (Phi min nxt), // with nxt being (Add inc ind). // If it can't parse the induction variable correctly, it returns (nil, nil, nil). -func parseIndVar(ind *Value) (min, inc, nxt *Value) { +func parseIndVar(ind *Value) (min, inc, nxt *Value, loopReturn Edge) { if ind.Op != OpPhi { return } if n := ind.Args[0]; (n.Op == OpAdd64 || n.Op == OpAdd32 || n.Op == OpAdd16 || n.Op == OpAdd8) && (n.Args[0] == ind || n.Args[1] == ind) { - min, nxt = ind.Args[1], n + min, nxt, loopReturn = ind.Args[1], n, ind.Block.Preds[0] } else if n := ind.Args[1]; (n.Op == OpAdd64 || n.Op == OpAdd32 || n.Op == OpAdd16 || n.Op == OpAdd8) && (n.Args[0] == ind || n.Args[1] == ind) { - min, nxt = ind.Args[0], n + min, nxt, loopReturn = ind.Args[0], n, ind.Block.Preds[1] } else { // Not a recognized induction variable. return @@ -111,13 +112,13 @@ func findIndVar(f *Func) []indVar { // See if this is really an induction variable less := true - init, inc, nxt := parseIndVar(ind) + init, inc, nxt, loopReturn := parseIndVar(ind) if init == nil { // We failed to parse the induction variable. Before punting, we want to check // whether the control op was written with the induction variable on the RHS // instead of the LHS. This happens for the downwards case, like: // for i := len(n)-1; i >= 0; i-- - init, inc, nxt = parseIndVar(limit) + init, inc, nxt, loopReturn = parseIndVar(limit) if init == nil { // No recognized induction variable on either operand continue @@ -145,6 +146,20 @@ func findIndVar(f *Func) []indVar { continue } + // startBody is the edge that eventually returns to the loop header. + var startBody Edge + switch { + case sdom.IsAncestorEq(b.Succs[0].b, loopReturn.b): + startBody = b.Succs[0] + case sdom.IsAncestorEq(b.Succs[1].b, loopReturn.b): + // if x { goto exit } else { goto entry } is identical to if !x { goto entry } else { goto exit } + startBody = b.Succs[1] + less = !less + inclusive = !inclusive + default: + continue + } + // Increment sign must match comparison direction. // When incrementing, the termination comparison must be ind </<= limit. // When decrementing, the termination comparison must be ind >/>= limit. @@ -172,14 +187,14 @@ func findIndVar(f *Func) []indVar { // First condition: loop entry has a single predecessor, which // is the header block. This implies that b.Succs[0] is // reached iff ind < limit. - if len(b.Succs[0].b.Preds) != 1 { - // b.Succs[1] must exit the loop. + if len(startBody.b.Preds) != 1 { + // the other successor must exit the loop. continue } - // Second condition: b.Succs[0] dominates nxt so that + // Second condition: startBody.b dominates nxt so that // nxt is computed when inc < limit. - if !sdom.IsAncestorEq(b.Succs[0].b, nxt.Block) { + if !sdom.IsAncestorEq(startBody.b, nxt.Block) { // inc+ind can only be reached through the branch that enters the loop. continue } @@ -298,7 +313,7 @@ func findIndVar(f *Func) []indVar { nxt: nxt, min: min, max: max, - entry: b.Succs[0].b, + entry: startBody.b, flags: flags, }) b.Logf("found induction variable %v (inc = %v, min = %v, max = %v)\n", ind, inc, min, max) diff --git a/src/cmd/compile/internal/ssa/looprotate.go b/src/cmd/compile/internal/ssa/looprotate.go index f32125576f..e97321019b 100644 --- a/src/cmd/compile/internal/ssa/looprotate.go +++ b/src/cmd/compile/internal/ssa/looprotate.go @@ -4,6 +4,10 @@ package ssa +import ( + "slices" +) + // loopRotate converts loops with a check-loop-condition-at-beginning // to loops with a check-loop-condition-at-end. // This helps loops avoid extra unnecessary jumps. @@ -41,10 +45,64 @@ func loopRotate(f *Func) { // Map from block ID to the moving blocks that should // come right after it. + // If a block, which has its ID present in keys of the 'after' map, + // occurs in some other block's 'after' list, that represents whole + // nested loop, e.g. consider an inner loop I nested into an outer + // loop O. It and Ot are corresponding top block for these loops + // chosen by our algorithm, and It is in the Ot's 'after' list. + // + // Before: After: + // + // e e + // │ │ + // │ │Ot ◄───┐ + // ▼ ▼▼ │ + // ┌───Oh ◄────┐ ┌─┬─Oh │ + // │ │ │ │ │ │ + // │ │ │ │ │ It◄───┐ │ + // │ ▼ │ │ │ ▼ │ │ + // │ ┌─Ih◄───┐ │ │ └►Ih │ │ + // │ │ │ │ │ │ ┌─┤ │ │ + // │ │ ▼ │ │ │ │ ▼ │ │ + // │ │ Ib │ │ │ │ Ib │ │ + // │ │ └─►It─┘ │ │ │ └─────┘ │ + // │ │ │ │ │ │ + // │ └►Ie │ │ └►Ie │ + // │ └─►Ot───┘ │ └───────┘ + // │ │ + // └──►Oe └──►Oe + // + // We build the 'after' lists for each of the top blocks Ot and It: + // after[Ot]: Oh, It, Ie + // after[It]: Ih, Ib after := map[ID][]*Block{} + // Map from loop header ID to the new top block for the loop. + tops := map[ID]*Block{} + + // Order loops to rotate any child loop before adding its top block + // to the parent loop's 'after' list. + loopOrder := f.Cache.allocIntSlice(len(loopnest.loops)) + for i := range loopOrder { + loopOrder[i] = i + } + defer f.Cache.freeIntSlice(loopOrder) + slices.SortFunc(loopOrder, func(i, j int) int { + di := loopnest.loops[i].depth + dj := loopnest.loops[j].depth + switch { + case di > dj: + return -1 + case di < dj: + return 1 + default: + return 0 + } + }) + // Check each loop header and decide if we want to move it. - for _, loop := range loopnest.loops { + for _, loopIdx := range loopOrder { + loop := loopnest.loops[loopIdx] b := loop.header var p *Block // b's in-loop predecessor for _, e := range b.Preds { @@ -59,6 +117,7 @@ func loopRotate(f *Func) { if p == nil { continue } + tops[loop.header.ID] = p p.Hotness |= HotInitial if f.IsPgoHot { p.Hotness |= HotPgo @@ -80,8 +139,10 @@ func loopRotate(f *Func) { if nextb == p { // original loop predecessor is next break } - if loopnest.b2l[nextb.ID] == loop { - after[p.ID] = append(after[p.ID], nextb) + if bloop := loopnest.b2l[nextb.ID]; bloop != nil { + if bloop == loop || bloop.outer == loop && tops[bloop.header.ID] == nextb { + after[p.ID] = append(after[p.ID], nextb) + } } b = nextb } @@ -90,7 +151,7 @@ func loopRotate(f *Func) { f.Blocks[idToIdx[p.ID]] = loop.header idToIdx[loop.header.ID], idToIdx[p.ID] = idToIdx[p.ID], idToIdx[loop.header.ID] - // Place b after p. + // Place loop blocks after p. for _, b := range after[p.ID] { move[b.ID] = struct{}{} } @@ -107,16 +168,23 @@ func loopRotate(f *Func) { oldOrder := f.Cache.allocBlockSlice(len(f.Blocks)) defer f.Cache.freeBlockSlice(oldOrder) copy(oldOrder, f.Blocks) + var moveBlocks func(bs []*Block) + moveBlocks = func(blocks []*Block) { + for _, a := range blocks { + f.Blocks[j] = a + j++ + if nextBlocks, ok := after[a.ID]; ok { + moveBlocks(nextBlocks) + } + } + } for _, b := range oldOrder { if _, ok := move[b.ID]; ok { continue } f.Blocks[j] = b j++ - for _, a := range after[b.ID] { - f.Blocks[j] = a - j++ - } + moveBlocks(after[b.ID]) } if j != len(oldOrder) { f.Fatalf("bad reordering in looprotate") diff --git a/src/cmd/compile/internal/ssa/looprotate_test.go b/src/cmd/compile/internal/ssa/looprotate_test.go new file mode 100644 index 0000000000..8e7cfc343f --- /dev/null +++ b/src/cmd/compile/internal/ssa/looprotate_test.go @@ -0,0 +1,65 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package ssa + +import ( + "cmd/compile/internal/types" + "testing" +) + +func TestLoopRotateNested(t *testing.T) { + c := testConfig(t) + fun := c.Fun("entry", + Bloc("entry", + Valu("mem", OpInitMem, types.TypeMem, 0, nil), + Valu("constTrue", OpConstBool, types.Types[types.TBOOL], 1, nil), + Goto("outerHeader")), + Bloc("outerHeader", + If("constTrue", "outerBody", "outerExit")), + Bloc("outerBody", + Goto("innerHeader")), + Bloc("innerHeader", + If("constTrue", "innerBody", "innerExit")), + Bloc("innerBody", + Goto("innerTop")), + Bloc("innerTop", + Goto("innerHeader")), + Bloc("innerExit", + Goto("outerTop")), + Bloc("outerTop", + Goto("outerHeader")), + Bloc("outerExit", + Exit("mem"))) + + blockName := make([]string, len(fun.f.Blocks)+1) + for name, block := range fun.blocks { + blockName[block.ID] = name + } + + CheckFunc(fun.f) + loopRotate(fun.f) + CheckFunc(fun.f) + + // Verify the resulting block order + expected := []string{ + "entry", + "outerTop", + "outerHeader", + "outerBody", + "innerTop", + "innerHeader", + "innerBody", + "innerExit", + "outerExit", + } + if len(expected) != len(fun.f.Blocks) { + t.Fatalf("expected %d blocks, found %d", len(expected), len(fun.f.Blocks)) + } + for i, b := range fun.f.Blocks { + if expected[i] != blockName[b.ID] { + t.Errorf("position %d: expected %s, found %s", i, expected[i], blockName[b.ID]) + } + } +} diff --git a/src/cmd/compile/internal/ssa/nilcheck.go b/src/cmd/compile/internal/ssa/nilcheck.go index 9d43ec1991..467c7514ee 100644 --- a/src/cmd/compile/internal/ssa/nilcheck.go +++ b/src/cmd/compile/internal/ssa/nilcheck.go @@ -221,7 +221,8 @@ func nilcheckelim2(f *Func) { // Iteration order means that first nilcheck in the chain wins, others // are bumped into the ordinary statement preservation algorithm. - u := b.Values[unnecessary.get(v.Args[0].ID)] + uid, _ := unnecessary.get(v.Args[0].ID) + u := b.Values[uid] if !u.Type.IsMemory() && !u.Pos.SameFileAndLine(v.Pos) { if u.Pos.IsStmt() == src.PosIsStmt { pendingLines.add(u.Pos) diff --git a/src/cmd/compile/internal/ssa/op.go b/src/cmd/compile/internal/ssa/op.go index 2a3356bc5c..d5c7394a26 100644 --- a/src/cmd/compile/internal/ssa/op.go +++ b/src/cmd/compile/internal/ssa/op.go @@ -6,10 +6,12 @@ package ssa import ( "cmd/compile/internal/abi" + "cmd/compile/internal/base" "cmd/compile/internal/ir" "cmd/compile/internal/types" "cmd/internal/obj" "fmt" + rtabi "internal/abi" "strings" ) @@ -68,6 +70,10 @@ type regInfo struct { // clobbers encodes the set of registers that are overwritten by // the instruction (other than the output registers). clobbers regMask + // Instruction clobbers the register containing input 0. + clobbersArg0 bool + // Instruction clobbers the register containing input 1. + clobbersArg1 bool // outputs is the same as inputs, but for the outputs of the instruction. outputs []outputInfo } @@ -365,6 +371,9 @@ const ( auxCall // aux is a *ssa.AuxCall auxCallOff // aux is a *ssa.AuxCall, AuxInt is int64 param (in+out) size + auxPanicBoundsC // constant for a bounds failure + auxPanicBoundsCC // two constants for a bounds failure + // architecture specific aux types auxARM64BitField // aux is an arm64 bitfield lsb and width packed into auxInt auxS390XRotateParams // aux is a s390x rotate parameters object encoding start bit, end bit and rotate amount @@ -523,6 +532,50 @@ func boundsABI(b int64) int { } } +// Returns the bounds error code needed by the runtime, and +// whether the x field is signed. +func (b BoundsKind) Code() (rtabi.BoundsErrorCode, bool) { + switch b { + case BoundsIndex: + return rtabi.BoundsIndex, true + case BoundsIndexU: + return rtabi.BoundsIndex, false + case BoundsSliceAlen: + return rtabi.BoundsSliceAlen, true + case BoundsSliceAlenU: + return rtabi.BoundsSliceAlen, false + case BoundsSliceAcap: + return rtabi.BoundsSliceAcap, true + case BoundsSliceAcapU: + return rtabi.BoundsSliceAcap, false + case BoundsSliceB: + return rtabi.BoundsSliceB, true + case BoundsSliceBU: + return rtabi.BoundsSliceB, false + case BoundsSlice3Alen: + return rtabi.BoundsSlice3Alen, true + case BoundsSlice3AlenU: + return rtabi.BoundsSlice3Alen, false + case BoundsSlice3Acap: + return rtabi.BoundsSlice3Acap, true + case BoundsSlice3AcapU: + return rtabi.BoundsSlice3Acap, false + case BoundsSlice3B: + return rtabi.BoundsSlice3B, true + case BoundsSlice3BU: + return rtabi.BoundsSlice3B, false + case BoundsSlice3C: + return rtabi.BoundsSlice3C, true + case BoundsSlice3CU: + return rtabi.BoundsSlice3C, false + case BoundsConvert: + return rtabi.BoundsConvert, false + default: + base.Fatalf("bad bounds kind %d", b) + return 0, false + } +} + // arm64BitField is the GO type of ARM64BitField auxInt. // if x is an ARM64BitField, then width=x&0xff, lsb=(x>>8)&0xff, and // width+lsb<64 for 64-bit variant, width+lsb<32 for 32-bit variant. diff --git a/src/cmd/compile/internal/ssa/opGen.go b/src/cmd/compile/internal/ssa/opGen.go index 6dcbec2573..a69612f28a 100644 --- a/src/cmd/compile/internal/ssa/opGen.go +++ b/src/cmd/compile/internal/ssa/opGen.go @@ -569,12 +569,12 @@ const ( Op386LoweredGetCallerSP Op386LoweredNilCheck Op386LoweredWB - Op386LoweredPanicBoundsA - Op386LoweredPanicBoundsB - Op386LoweredPanicBoundsC - Op386LoweredPanicExtendA - Op386LoweredPanicExtendB - Op386LoweredPanicExtendC + Op386LoweredPanicBoundsRR + Op386LoweredPanicBoundsRC + Op386LoweredPanicBoundsCR + Op386LoweredPanicBoundsCC + Op386LoweredPanicExtendRR + Op386LoweredPanicExtendRC Op386FlagEQ Op386FlagLT_ULT Op386FlagLT_UGT @@ -1051,7 +1051,8 @@ const ( OpAMD64MOVLstoreconstidx4 OpAMD64MOVQstoreconstidx1 OpAMD64MOVQstoreconstidx8 - OpAMD64DUFFZERO + OpAMD64LoweredZero + OpAMD64LoweredZeroLoop OpAMD64REPSTOSQ OpAMD64CALLstatic OpAMD64CALLtail @@ -1067,9 +1068,10 @@ const ( OpAMD64LoweredNilCheck OpAMD64LoweredWB OpAMD64LoweredHasCPUFeature - OpAMD64LoweredPanicBoundsA - OpAMD64LoweredPanicBoundsB - OpAMD64LoweredPanicBoundsC + OpAMD64LoweredPanicBoundsRR + OpAMD64LoweredPanicBoundsRC + OpAMD64LoweredPanicBoundsCR + OpAMD64LoweredPanicBoundsCC OpAMD64FlagEQ OpAMD64FlagLT_ULT OpAMD64FlagLT_UGT @@ -2478,12 +2480,12 @@ const ( OpARMLoweredGetClosurePtr OpARMLoweredGetCallerSP OpARMLoweredGetCallerPC - OpARMLoweredPanicBoundsA - OpARMLoweredPanicBoundsB - OpARMLoweredPanicBoundsC - OpARMLoweredPanicExtendA - OpARMLoweredPanicExtendB - OpARMLoweredPanicExtendC + OpARMLoweredPanicBoundsRR + OpARMLoweredPanicBoundsRC + OpARMLoweredPanicBoundsCR + OpARMLoweredPanicBoundsCC + OpARMLoweredPanicExtendRR + OpARMLoweredPanicExtendRC OpARMFlagConstant OpARMInvertFlags OpARMLoweredWB @@ -2814,9 +2816,10 @@ const ( OpARM64LoweredAtomicAnd32Variant OpARM64LoweredAtomicOr32Variant OpARM64LoweredWB - OpARM64LoweredPanicBoundsA - OpARM64LoweredPanicBoundsB - OpARM64LoweredPanicBoundsC + OpARM64LoweredPanicBoundsRR + OpARM64LoweredPanicBoundsRC + OpARM64LoweredPanicBoundsCR + OpARM64LoweredPanicBoundsCC OpARM64PRFM OpARM64DMB OpARM64ZERO @@ -3018,9 +3021,10 @@ const ( OpLOONG64LoweredGetCallerPC OpLOONG64LoweredWB OpLOONG64LoweredPubBarrier - OpLOONG64LoweredPanicBoundsA - OpLOONG64LoweredPanicBoundsB - OpLOONG64LoweredPanicBoundsC + OpLOONG64LoweredPanicBoundsRR + OpLOONG64LoweredPanicBoundsRC + OpLOONG64LoweredPanicBoundsCR + OpLOONG64LoweredPanicBoundsCC OpLOONG64PRELD OpLOONG64PRELDX @@ -3134,12 +3138,12 @@ const ( OpMIPSLoweredGetCallerPC OpMIPSLoweredWB OpMIPSLoweredPubBarrier - OpMIPSLoweredPanicBoundsA - OpMIPSLoweredPanicBoundsB - OpMIPSLoweredPanicBoundsC - OpMIPSLoweredPanicExtendA - OpMIPSLoweredPanicExtendB - OpMIPSLoweredPanicExtendC + OpMIPSLoweredPanicBoundsRR + OpMIPSLoweredPanicBoundsRC + OpMIPSLoweredPanicBoundsCR + OpMIPSLoweredPanicBoundsCC + OpMIPSLoweredPanicExtendRR + OpMIPSLoweredPanicExtendRC OpMIPS64ADDV OpMIPS64ADDVconst @@ -3266,9 +3270,10 @@ const ( OpMIPS64LoweredGetCallerPC OpMIPS64LoweredWB OpMIPS64LoweredPubBarrier - OpMIPS64LoweredPanicBoundsA - OpMIPS64LoweredPanicBoundsB - OpMIPS64LoweredPanicBoundsC + OpMIPS64LoweredPanicBoundsRR + OpMIPS64LoweredPanicBoundsRC + OpMIPS64LoweredPanicBoundsCR + OpMIPS64LoweredPanicBoundsCC OpPPC64ADD OpPPC64ADDCC @@ -3637,9 +3642,10 @@ const ( OpRISCV64LoweredGetCallerPC OpRISCV64LoweredWB OpRISCV64LoweredPubBarrier - OpRISCV64LoweredPanicBoundsA - OpRISCV64LoweredPanicBoundsB - OpRISCV64LoweredPanicBoundsC + OpRISCV64LoweredPanicBoundsRR + OpRISCV64LoweredPanicBoundsRC + OpRISCV64LoweredPanicBoundsCR + OpRISCV64LoweredPanicBoundsCC OpRISCV64FADDS OpRISCV64FSUBS OpRISCV64FMULS @@ -3708,6 +3714,10 @@ const ( OpS390XLPDFR OpS390XLNDFR OpS390XCPSDR + OpS390XWFMAXDB + OpS390XWFMAXSB + OpS390XWFMINDB + OpS390XWFMINSB OpS390XFIDBR OpS390XFMOVSload OpS390XFMOVDload @@ -3890,9 +3900,10 @@ const ( OpS390XLoweredRound32F OpS390XLoweredRound64F OpS390XLoweredWB - OpS390XLoweredPanicBoundsA - OpS390XLoweredPanicBoundsB - OpS390XLoweredPanicBoundsC + OpS390XLoweredPanicBoundsRR + OpS390XLoweredPanicBoundsRC + OpS390XLoweredPanicBoundsCR + OpS390XLoweredPanicBoundsCC OpS390XFlagEQ OpS390XFlagLT OpS390XFlagGT @@ -9499,77 +9510,68 @@ var opcodeTable = [...]opInfo{ }, }, { - name: "LoweredPanicBoundsA", + name: "LoweredPanicBoundsRR", auxType: auxInt64, argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 4}, // DX - {1, 8}, // BX + {0, 239}, // AX CX DX BX BP SI DI + {1, 239}, // AX CX DX BX BP SI DI }, }, }, { - name: "LoweredPanicBoundsB", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsRC", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 2}, // CX - {1, 4}, // DX + {0, 239}, // AX CX DX BX BP SI DI }, }, }, { - name: "LoweredPanicBoundsC", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsCR", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 1}, // AX - {1, 2}, // CX + {0, 239}, // AX CX DX BX BP SI DI }, }, }, { - name: "LoweredPanicExtendA", - auxType: auxInt64, - argLen: 4, + name: "LoweredPanicBoundsCC", + auxType: auxPanicBoundsCC, + argLen: 1, call: true, - reg: regInfo{ - inputs: []inputInfo{ - {0, 64}, // SI - {1, 4}, // DX - {2, 8}, // BX - }, - }, + reg: regInfo{}, }, { - name: "LoweredPanicExtendB", + name: "LoweredPanicExtendRR", auxType: auxInt64, argLen: 4, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 64}, // SI - {1, 2}, // CX - {2, 4}, // DX + {0, 15}, // AX CX DX BX + {1, 15}, // AX CX DX BX + {2, 239}, // AX CX DX BX BP SI DI }, }, }, { - name: "LoweredPanicExtendC", - auxType: auxInt64, - argLen: 4, + name: "LoweredPanicExtendRC", + auxType: auxPanicBoundsC, + argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 64}, // SI - {1, 1}, // AX - {2, 2}, // CX + {0, 15}, // AX CX DX BX + {1, 15}, // AX CX DX BX }, }, }, @@ -16796,15 +16798,28 @@ var opcodeTable = [...]opInfo{ }, }, { - name: "DUFFZERO", - auxType: auxInt64, - argLen: 2, - unsafePoint: true, + name: "LoweredZero", + auxType: auxInt64, + argLen: 2, + faultOnNilArg0: true, reg: regInfo{ inputs: []inputInfo{ - {0, 128}, // DI + {0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15 }, - clobbers: 128, // DI + }, + }, + { + name: "LoweredZeroLoop", + auxType: auxInt64, + argLen: 2, + clobberFlags: true, + needIntTemp: true, + faultOnNilArg0: true, + reg: regInfo{ + inputs: []inputInfo{ + {0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15 + }, + clobbersArg0: true, }, }, { @@ -16977,42 +16992,47 @@ var opcodeTable = [...]opInfo{ }, }, { - name: "LoweredPanicBoundsA", + name: "LoweredPanicBoundsRR", auxType: auxInt64, argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 4}, // DX - {1, 8}, // BX + {0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15 + {1, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15 }, }, }, { - name: "LoweredPanicBoundsB", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsRC", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 2}, // CX - {1, 4}, // DX + {0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15 }, }, }, { - name: "LoweredPanicBoundsC", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsCR", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 1}, // AX - {1, 2}, // CX + {0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15 }, }, }, { + name: "LoweredPanicBoundsCC", + auxType: auxPanicBoundsCC, + argLen: 1, + call: true, + reg: regInfo{}, + }, + { name: "FlagEQ", argLen: 0, reg: regInfo{}, @@ -37876,77 +37896,68 @@ var opcodeTable = [...]opInfo{ }, }, { - name: "LoweredPanicBoundsA", + name: "LoweredPanicBoundsRR", auxType: auxInt64, argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 4}, // R2 - {1, 8}, // R3 + {0, 5119}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R12 + {1, 5119}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R12 }, }, }, { - name: "LoweredPanicBoundsB", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsRC", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 2}, // R1 - {1, 4}, // R2 + {0, 5119}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R12 }, }, }, { - name: "LoweredPanicBoundsC", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsCR", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 1}, // R0 - {1, 2}, // R1 + {0, 5119}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R12 }, }, }, { - name: "LoweredPanicExtendA", - auxType: auxInt64, - argLen: 4, + name: "LoweredPanicBoundsCC", + auxType: auxPanicBoundsCC, + argLen: 1, call: true, - reg: regInfo{ - inputs: []inputInfo{ - {0, 16}, // R4 - {1, 4}, // R2 - {2, 8}, // R3 - }, - }, + reg: regInfo{}, }, { - name: "LoweredPanicExtendB", + name: "LoweredPanicExtendRR", auxType: auxInt64, argLen: 4, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 16}, // R4 - {1, 2}, // R1 - {2, 4}, // R2 + {0, 15}, // R0 R1 R2 R3 + {1, 15}, // R0 R1 R2 R3 + {2, 21503}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R12 R14 }, }, }, { - name: "LoweredPanicExtendC", - auxType: auxInt64, - argLen: 4, + name: "LoweredPanicExtendRC", + auxType: auxPanicBoundsC, + argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 16}, // R4 - {1, 1}, // R0 - {2, 2}, // R1 + {0, 15}, // R0 R1 R2 R3 + {1, 15}, // R0 R1 R2 R3 }, }, }, @@ -42441,42 +42452,47 @@ var opcodeTable = [...]opInfo{ }, }, { - name: "LoweredPanicBoundsA", + name: "LoweredPanicBoundsRR", auxType: auxInt64, argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 4}, // R2 - {1, 8}, // R3 + {0, 65535}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 + {1, 65535}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 }, }, }, { - name: "LoweredPanicBoundsB", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsRC", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 2}, // R1 - {1, 4}, // R2 + {0, 65535}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 }, }, }, { - name: "LoweredPanicBoundsC", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsCR", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 1}, // R0 - {1, 2}, // R1 + {0, 65535}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 }, }, }, { + name: "LoweredPanicBoundsCC", + auxType: auxPanicBoundsCC, + argLen: 1, + call: true, + reg: regInfo{}, + }, + { name: "PRFM", auxType: auxInt64, argLen: 2, @@ -45208,42 +45224,47 @@ var opcodeTable = [...]opInfo{ reg: regInfo{}, }, { - name: "LoweredPanicBoundsA", + name: "LoweredPanicBoundsRR", auxType: auxInt64, argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 4194304}, // R23 - {1, 8388608}, // R24 + {0, 524280}, // R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19 + {1, 524280}, // R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19 }, }, }, { - name: "LoweredPanicBoundsB", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsRC", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 1048576}, // R21 - {1, 4194304}, // R23 + {0, 524280}, // R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19 }, }, }, { - name: "LoweredPanicBoundsC", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsCR", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 524288}, // R20 - {1, 1048576}, // R21 + {0, 524280}, // R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19 }, }, }, { + name: "LoweredPanicBoundsCC", + auxType: auxPanicBoundsCC, + argLen: 1, + call: true, + reg: regInfo{}, + }, + { name: "PRELD", auxType: auxInt64, argLen: 2, @@ -46756,77 +46777,68 @@ var opcodeTable = [...]opInfo{ reg: regInfo{}, }, { - name: "LoweredPanicBoundsA", + name: "LoweredPanicBoundsRR", auxType: auxInt64, argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 8}, // R3 - {1, 16}, // R4 + {0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 + {1, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 }, }, }, { - name: "LoweredPanicBoundsB", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsRC", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 4}, // R2 - {1, 8}, // R3 + {0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 }, }, }, { - name: "LoweredPanicBoundsC", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsCR", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 2}, // R1 - {1, 4}, // R2 + {0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 }, }, }, { - name: "LoweredPanicExtendA", - auxType: auxInt64, - argLen: 4, + name: "LoweredPanicBoundsCC", + auxType: auxPanicBoundsCC, + argLen: 1, call: true, - reg: regInfo{ - inputs: []inputInfo{ - {0, 32}, // R5 - {1, 8}, // R3 - {2, 16}, // R4 - }, - }, + reg: regInfo{}, }, { - name: "LoweredPanicExtendB", + name: "LoweredPanicExtendRR", auxType: auxInt64, argLen: 4, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 32}, // R5 - {1, 4}, // R2 - {2, 8}, // R3 + {0, 30}, // R1 R2 R3 R4 + {1, 30}, // R1 R2 R3 R4 + {2, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 }, }, }, { - name: "LoweredPanicExtendC", - auxType: auxInt64, - argLen: 4, + name: "LoweredPanicExtendRC", + auxType: auxPanicBoundsC, + argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 32}, // R5 - {1, 2}, // R1 - {2, 4}, // R2 + {0, 30}, // R1 R2 R3 R4 + {1, 30}, // R1 R2 R3 R4 }, }, }, @@ -48529,41 +48541,46 @@ var opcodeTable = [...]opInfo{ reg: regInfo{}, }, { - name: "LoweredPanicBoundsA", + name: "LoweredPanicBoundsRR", auxType: auxInt64, argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 8}, // R3 - {1, 16}, // R4 + {0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 + {1, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 }, }, }, { - name: "LoweredPanicBoundsB", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsRC", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 4}, // R2 - {1, 8}, // R3 + {0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 }, }, }, { - name: "LoweredPanicBoundsC", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsCR", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 2}, // R1 - {1, 4}, // R2 + {0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 }, }, }, + { + name: "LoweredPanicBoundsCC", + auxType: auxPanicBoundsCC, + argLen: 1, + call: true, + reg: regInfo{}, + }, { name: "ADD", @@ -53530,42 +53547,47 @@ var opcodeTable = [...]opInfo{ reg: regInfo{}, }, { - name: "LoweredPanicBoundsA", + name: "LoweredPanicBoundsRR", auxType: auxInt64, argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 64}, // X7 - {1, 134217728}, // X28 + {0, 1048560}, // X5 X6 X7 X8 X9 X10 X11 X12 X13 X14 X15 X16 X17 X18 X19 X20 + {1, 1048560}, // X5 X6 X7 X8 X9 X10 X11 X12 X13 X14 X15 X16 X17 X18 X19 X20 }, }, }, { - name: "LoweredPanicBoundsB", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsRC", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 32}, // X6 - {1, 64}, // X7 + {0, 1048560}, // X5 X6 X7 X8 X9 X10 X11 X12 X13 X14 X15 X16 X17 X18 X19 X20 }, }, }, { - name: "LoweredPanicBoundsC", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsCR", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 16}, // X5 - {1, 32}, // X6 + {0, 1048560}, // X5 X6 X7 X8 X9 X10 X11 X12 X13 X14 X15 X16 X17 X18 X19 X20 }, }, }, { + name: "LoweredPanicBoundsCC", + auxType: auxPanicBoundsCC, + argLen: 1, + call: true, + reg: regInfo{}, + }, + { name: "FADDS", argLen: 2, commutative: true, @@ -54542,6 +54564,62 @@ var opcodeTable = [...]opInfo{ }, }, { + name: "WFMAXDB", + argLen: 2, + asm: s390x.AWFMAXDB, + reg: regInfo{ + inputs: []inputInfo{ + {0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + {1, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + }, + outputs: []outputInfo{ + {0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + }, + }, + }, + { + name: "WFMAXSB", + argLen: 2, + asm: s390x.AWFMAXSB, + reg: regInfo{ + inputs: []inputInfo{ + {0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + {1, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + }, + outputs: []outputInfo{ + {0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + }, + }, + }, + { + name: "WFMINDB", + argLen: 2, + asm: s390x.AWFMINDB, + reg: regInfo{ + inputs: []inputInfo{ + {0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + {1, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + }, + outputs: []outputInfo{ + {0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + }, + }, + }, + { + name: "WFMINSB", + argLen: 2, + asm: s390x.AWFMINSB, + reg: regInfo{ + inputs: []inputInfo{ + {0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + {1, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + }, + outputs: []outputInfo{ + {0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 + }, + }, + }, + { name: "FIDBR", auxType: auxInt8, argLen: 1, @@ -57211,42 +57289,47 @@ var opcodeTable = [...]opInfo{ }, }, { - name: "LoweredPanicBoundsA", + name: "LoweredPanicBoundsRR", auxType: auxInt64, argLen: 3, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 4}, // R2 - {1, 8}, // R3 + {0, 7167}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R11 R12 + {1, 7167}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R11 R12 }, }, }, { - name: "LoweredPanicBoundsB", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsRC", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 2}, // R1 - {1, 4}, // R2 + {0, 7167}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R11 R12 }, }, }, { - name: "LoweredPanicBoundsC", - auxType: auxInt64, - argLen: 3, + name: "LoweredPanicBoundsCR", + auxType: auxPanicBoundsC, + argLen: 2, call: true, reg: regInfo{ inputs: []inputInfo{ - {0, 1}, // R0 - {1, 2}, // R1 + {0, 7167}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R11 R12 }, }, }, { + name: "LoweredPanicBoundsCC", + auxType: auxPanicBoundsCC, + argLen: 1, + call: true, + reg: regInfo{}, + }, + { name: "FlagEQ", argLen: 0, reg: regInfo{}, diff --git a/src/cmd/compile/internal/ssa/prove.go b/src/cmd/compile/internal/ssa/prove.go index 93bd525c38..b8c952ef33 100644 --- a/src/cmd/compile/internal/ssa/prove.go +++ b/src/cmd/compile/internal/ssa/prove.go @@ -5,6 +5,7 @@ package ssa import ( + "cmd/compile/internal/types" "cmd/internal/src" "fmt" "math" @@ -2132,6 +2133,41 @@ func addRestrictions(parent *Block, ft *factsTable, t domain, v, w *Value, r rel } } +func unsignedAddOverflows(a, b uint64, t *types.Type) bool { + switch t.Size() { + case 8: + return a+b < a + case 4: + return a+b > math.MaxUint32 + case 2: + return a+b > math.MaxUint16 + case 1: + return a+b > math.MaxUint8 + default: + panic("unreachable") + } +} + +func signedAddOverflowsOrUnderflows(a, b int64, t *types.Type) bool { + r := a + b + switch t.Size() { + case 8: + return (a >= 0 && b >= 0 && r < 0) || (a < 0 && b < 0 && r >= 0) + case 4: + return r < math.MinInt32 || math.MaxInt32 < r + case 2: + return r < math.MinInt16 || math.MaxInt16 < r + case 1: + return r < math.MinInt8 || math.MaxInt8 < r + default: + panic("unreachable") + } +} + +func unsignedSubUnderflows(a, b uint64) bool { + return a < b +} + func addLocalFacts(ft *factsTable, b *Block) { // Propagate constant ranges among values in this block. // We do this before the second loop so that we have the @@ -2151,6 +2187,60 @@ func addLocalFacts(ft *factsTable, b *Block) { // FIXME(go.dev/issue/68857): this loop only set up limits properly when b.Values is in topological order. // flowLimit can also depend on limits given by this loop which right now is not handled. switch v.Op { + case OpAdd64, OpAdd32, OpAdd16, OpAdd8: + x := ft.limits[v.Args[0].ID] + y := ft.limits[v.Args[1].ID] + if !unsignedAddOverflows(x.umax, y.umax, v.Type) { + r := gt + if !x.nonzero() { + r |= eq + } + ft.update(b, v, v.Args[1], unsigned, r) + r = gt + if !y.nonzero() { + r |= eq + } + ft.update(b, v, v.Args[0], unsigned, r) + } + if x.min >= 0 && !signedAddOverflowsOrUnderflows(x.max, y.max, v.Type) { + r := gt + if !x.nonzero() { + r |= eq + } + ft.update(b, v, v.Args[1], signed, r) + } + if y.min >= 0 && !signedAddOverflowsOrUnderflows(x.max, y.max, v.Type) { + r := gt + if !y.nonzero() { + r |= eq + } + ft.update(b, v, v.Args[0], signed, r) + } + if x.max <= 0 && !signedAddOverflowsOrUnderflows(x.min, y.min, v.Type) { + r := lt + if !x.nonzero() { + r |= eq + } + ft.update(b, v, v.Args[1], signed, r) + } + if y.max <= 0 && !signedAddOverflowsOrUnderflows(x.min, y.min, v.Type) { + r := lt + if !y.nonzero() { + r |= eq + } + ft.update(b, v, v.Args[0], signed, r) + } + case OpSub64, OpSub32, OpSub16, OpSub8: + x := ft.limits[v.Args[0].ID] + y := ft.limits[v.Args[1].ID] + if !unsignedSubUnderflows(x.umin, y.umax) { + r := lt + if !y.nonzero() { + r |= eq + } + ft.update(b, v, v.Args[0], unsigned, r) + } + // FIXME: we could also do signed facts but the overflow checks are much trickier and I don't need it yet. case OpAnd64, OpAnd32, OpAnd16, OpAnd8: ft.update(b, v, v.Args[0], unsigned, lt|eq) ft.update(b, v, v.Args[1], unsigned, lt|eq) @@ -2177,6 +2267,10 @@ func addLocalFacts(ft *factsTable, b *Block) { // the mod instruction executes (and thus panics if the // modulus is 0). See issue 67625. ft.update(b, v, v.Args[1], unsigned, lt) + case OpStringLen: + if v.Args[0].Op == OpStringMake { + ft.update(b, v, v.Args[0].Args[1], signed, eq) + } case OpSliceLen: if v.Args[0].Op == OpSliceMake { ft.update(b, v, v.Args[0].Args[1], signed, eq) diff --git a/src/cmd/compile/internal/ssa/regalloc.go b/src/cmd/compile/internal/ssa/regalloc.go index d4ce7a815b..0fd0b9173c 100644 --- a/src/cmd/compile/internal/ssa/regalloc.go +++ b/src/cmd/compile/internal/ssa/regalloc.go @@ -1591,6 +1591,12 @@ func (s *regAllocState) regalloc(f *Func) { mask &^= desired.avoid } } + if mask&s.values[v.Args[i.idx].ID].regs&(1<<s.SPReg) != 0 { + // Prefer SP register. This ensures that local variables + // use SP as their base register (instead of a copy of the + // stack pointer living in another register). See issue 74836. + mask = 1 << s.SPReg + } args[i.idx] = s.allocValToReg(v.Args[i.idx], mask, true, v.Pos) } @@ -1694,8 +1700,38 @@ func (s *regAllocState) regalloc(f *Func) { } } } - ok: + for i := 0; i < 2; i++ { + if !(i == 0 && regspec.clobbersArg0 || i == 1 && regspec.clobbersArg1) { + continue + } + if !s.liveAfterCurrentInstruction(v.Args[i]) { + // arg is dead. We can clobber its register. + continue + } + if s.values[v.Args[i].ID].rematerializeable { + // We can rematerialize the input, don't worry about clobbering it. + continue + } + if countRegs(s.values[v.Args[i].ID].regs) >= 2 { + // We have at least 2 copies of arg. We can afford to clobber one. + continue + } + // Possible new registers to copy into. + m := s.compatRegs(v.Args[i].Type) &^ s.used + if m == 0 { + // No free registers. In this case we'll just clobber the + // input and future uses of that input must use a restore. + // TODO(khr): We should really do this like allocReg does it, + // spilling the value with the most distant next use. + continue + } + // Copy input to a new clobberable register. + c := s.allocValToReg(v.Args[i], m, true, v.Pos) + s.copies[c] = false + args[i] = c + } + // Pick a temporary register if needed. // It should be distinct from all the input registers, so we // allocate it after all the input registers, but before @@ -1717,6 +1753,13 @@ func (s *regAllocState) regalloc(f *Func) { s.tmpused |= regMask(1) << tmpReg } + if regspec.clobbersArg0 { + s.freeReg(register(s.f.getHome(args[0].ID).(*Register).num)) + } + if regspec.clobbersArg1 { + s.freeReg(register(s.f.getHome(args[1].ID).(*Register).num)) + } + // Now that all args are in regs, we're ready to issue the value itself. // Before we pick a register for the output value, allow input registers // to be deallocated. We do this here so that the output can use the @@ -2743,7 +2786,7 @@ func (s *regAllocState) computeLive() { // out to all of them. po := f.postorder() s.loopnest = f.loopnest() - s.loopnest.calculateDepths() + s.loopnest.computeUnavoidableCalls() for { changed := false @@ -3050,3 +3093,72 @@ func (d *desiredState) merge(x *desiredState) { d.addList(e.ID, e.regs) } } + +// computeUnavoidableCalls computes the containsUnavoidableCall fields in the loop nest. +func (loopnest *loopnest) computeUnavoidableCalls() { + f := loopnest.f + + hasCall := f.Cache.allocBoolSlice(f.NumBlocks()) + defer f.Cache.freeBoolSlice(hasCall) + for _, b := range f.Blocks { + if b.containsCall() { + hasCall[b.ID] = true + } + } + found := f.Cache.allocSparseSet(f.NumBlocks()) + defer f.Cache.freeSparseSet(found) + // Run dfs to find path through the loop that avoids all calls. + // Such path either escapes the loop or returns back to the header. + // It isn't enough to have exit not dominated by any call, for example: + // ... some loop + // call1 call2 + // \ / + // block + // ... + // block is not dominated by any single call, but we don't have call-free path to it. +loopLoop: + for _, l := range loopnest.loops { + found.clear() + tovisit := make([]*Block, 0, 8) + tovisit = append(tovisit, l.header) + for len(tovisit) > 0 { + cur := tovisit[len(tovisit)-1] + tovisit = tovisit[:len(tovisit)-1] + if hasCall[cur.ID] { + continue + } + for _, s := range cur.Succs { + nb := s.Block() + if nb == l.header { + // Found a call-free path around the loop. + continue loopLoop + } + if found.contains(nb.ID) { + // Already found via another path. + continue + } + nl := loopnest.b2l[nb.ID] + if nl == nil || (nl.depth <= l.depth && nl != l) { + // Left the loop. + continue + } + tovisit = append(tovisit, nb) + found.add(nb.ID) + } + } + // No call-free path was found. + l.containsUnavoidableCall = true + } +} + +func (b *Block) containsCall() bool { + if b.Kind == BlockDefer { + return true + } + for _, v := range b.Values { + if opcodeTable[v.Op].call { + return true + } + } + return false +} diff --git a/src/cmd/compile/internal/ssa/regalloc_test.go b/src/cmd/compile/internal/ssa/regalloc_test.go index 7d804a0d30..e7ed416c50 100644 --- a/src/cmd/compile/internal/ssa/regalloc_test.go +++ b/src/cmd/compile/internal/ssa/regalloc_test.go @@ -6,6 +6,7 @@ package ssa import ( "cmd/compile/internal/types" + "fmt" "testing" ) @@ -218,10 +219,37 @@ func TestSpillMove2(t *testing.T) { } +func TestClobbersArg0(t *testing.T) { + c := testConfig(t) + f := c.Fun("entry", + Bloc("entry", + Valu("mem", OpInitMem, types.TypeMem, 0, nil), + Valu("ptr", OpArg, c.config.Types.Int64.PtrTo(), 0, c.Temp(c.config.Types.Int64.PtrTo())), + Valu("dst", OpArg, c.config.Types.Int64.PtrTo().PtrTo(), 0, c.Temp(c.config.Types.Int64.PtrTo().PtrTo())), + Valu("zero", OpAMD64LoweredZeroLoop, types.TypeMem, 256, nil, "ptr", "mem"), + Valu("store", OpAMD64MOVQstore, types.TypeMem, 0, nil, "dst", "ptr", "zero"), + Exit("store"))) + flagalloc(f.f) + regalloc(f.f) + checkFunc(f.f) + // LoweredZeroLoop clobbers its argument, so there must be a copy of "ptr" somewhere + // so we still have that value available at "store". + if n := numCopies(f.blocks["entry"]); n != 1 { + fmt.Printf("%s\n", f.f.String()) + t.Errorf("got %d copies, want 1", n) + } +} + func numSpills(b *Block) int { + return numOps(b, OpStoreReg) +} +func numCopies(b *Block) int { + return numOps(b, OpCopy) +} +func numOps(b *Block, op Op) int { n := 0 for _, v := range b.Values { - if v.Op == OpStoreReg { + if v.Op == op { n++ } } diff --git a/src/cmd/compile/internal/ssa/rewrite.go b/src/cmd/compile/internal/ssa/rewrite.go index eb2c3b31b8..f9a35deecc 100644 --- a/src/cmd/compile/internal/ssa/rewrite.go +++ b/src/cmd/compile/internal/ssa/rewrite.go @@ -29,6 +29,8 @@ type deadValueChoice bool const ( leaveDeadValues deadValueChoice = false removeDeadValues = true + + repZeroThreshold = 1408 // size beyond which we use REP STOS for zeroing ) // deadcode indicates whether rewrite should try to remove any values that become dead. @@ -199,16 +201,18 @@ func applyRewrite(f *Func, rb blockRewriter, rv valueRewriter, deadcode deadValu f.freeValue(v) continue } - if v.Pos.IsStmt() != src.PosNotStmt && !notStmtBoundary(v.Op) && pendingLines.get(vl) == int32(b.ID) { - pendingLines.remove(vl) - v.Pos = v.Pos.WithIsStmt() + if v.Pos.IsStmt() != src.PosNotStmt && !notStmtBoundary(v.Op) { + if pl, ok := pendingLines.get(vl); ok && pl == int32(b.ID) { + pendingLines.remove(vl) + v.Pos = v.Pos.WithIsStmt() + } } if i != j { b.Values[j] = v } j++ } - if pendingLines.get(b.Pos) == int32(b.ID) { + if pl, ok := pendingLines.get(b.Pos); ok && pl == int32(b.ID) { b.Pos = b.Pos.WithIsStmt() pendingLines.remove(b.Pos) } @@ -301,7 +305,6 @@ func canMergeLoadClobber(target, load, x *Value) bool { return false } loopnest := x.Block.Func.loopnest() - loopnest.calculateDepths() if loopnest.depth(target.Block.ID) > loopnest.depth(x.Block.ID) { return false } @@ -479,30 +482,28 @@ func nto(x int64) int64 { // logX returns logarithm of n base 2. // n must be a positive power of 2 (isPowerOfTwoX returns true). -func log8(n int8) int64 { - return int64(bits.Len8(uint8(n))) - 1 -} -func log16(n int16) int64 { - return int64(bits.Len16(uint16(n))) - 1 -} -func log32(n int32) int64 { - return int64(bits.Len32(uint32(n))) - 1 -} -func log64(n int64) int64 { - return int64(bits.Len64(uint64(n))) - 1 -} +func log8(n int8) int64 { return log8u(uint8(n)) } +func log16(n int16) int64 { return log16u(uint16(n)) } +func log32(n int32) int64 { return log32u(uint32(n)) } +func log64(n int64) int64 { return log64u(uint64(n)) } -// log2uint32 returns logarithm in base 2 of uint32(n), with log2(0) = -1. -// Rounds down. -func log2uint32(n int64) int64 { - return int64(bits.Len32(uint32(n))) - 1 -} +// logXu returns the logarithm of n base 2. +// n must be a power of 2 (isUnsignedPowerOfTwo returns true) +func log8u(n uint8) int64 { return int64(bits.Len8(n)) - 1 } +func log16u(n uint16) int64 { return int64(bits.Len16(n)) - 1 } +func log32u(n uint32) int64 { return int64(bits.Len32(n)) - 1 } +func log64u(n uint64) int64 { return int64(bits.Len64(n)) - 1 } // isPowerOfTwoX functions report whether n is a power of 2. func isPowerOfTwo[T int8 | int16 | int32 | int64](n T) bool { return n > 0 && n&(n-1) == 0 } +// isUnsignedPowerOfTwo reports whether n is an unsigned power of 2. +func isUnsignedPowerOfTwo[T uint8 | uint16 | uint32 | uint64](n T) bool { + return n != 0 && n&(n-1) == 0 +} + // isUint64PowerOfTwo reports whether uint64(n) is a power of 2. func isUint64PowerOfTwo(in int64) bool { n := uint64(in) @@ -2671,3 +2672,32 @@ func flagify(v *Value) bool { v.AddArg(inner) return true } + +// PanicBoundsC contains a constant for a bounds failure. +type PanicBoundsC struct { + C int64 +} + +// PanicBoundsCC contains 2 constants for a bounds failure. +type PanicBoundsCC struct { + Cx int64 + Cy int64 +} + +func (p PanicBoundsC) CanBeAnSSAAux() { +} +func (p PanicBoundsCC) CanBeAnSSAAux() { +} + +func auxToPanicBoundsC(i Aux) PanicBoundsC { + return i.(PanicBoundsC) +} +func auxToPanicBoundsCC(i Aux) PanicBoundsCC { + return i.(PanicBoundsCC) +} +func panicBoundsCToAux(p PanicBoundsC) Aux { + return p +} +func panicBoundsCCToAux(p PanicBoundsCC) Aux { + return p +} diff --git a/src/cmd/compile/internal/ssa/rewrite386.go b/src/cmd/compile/internal/ssa/rewrite386.go index 9ece0e4eb7..0495438710 100644 --- a/src/cmd/compile/internal/ssa/rewrite386.go +++ b/src/cmd/compile/internal/ssa/rewrite386.go @@ -75,6 +75,14 @@ func rewriteValue386(v *Value) bool { return rewriteValue386_Op386LEAL4(v) case Op386LEAL8: return rewriteValue386_Op386LEAL8(v) + case Op386LoweredPanicBoundsRC: + return rewriteValue386_Op386LoweredPanicBoundsRC(v) + case Op386LoweredPanicBoundsRR: + return rewriteValue386_Op386LoweredPanicBoundsRR(v) + case Op386LoweredPanicExtendRC: + return rewriteValue386_Op386LoweredPanicExtendRC(v) + case Op386LoweredPanicExtendRR: + return rewriteValue386_Op386LoweredPanicExtendRR(v) case Op386MOVBLSX: return rewriteValue386_Op386MOVBLSX(v) case Op386MOVBLSXload: @@ -558,9 +566,11 @@ func rewriteValue386(v *Value) bool { v.Op = Op386ORL return true case OpPanicBounds: - return rewriteValue386_OpPanicBounds(v) + v.Op = Op386LoweredPanicBoundsRR + return true case OpPanicExtend: - return rewriteValue386_OpPanicExtend(v) + v.Op = Op386LoweredPanicExtendRR + return true case OpRotateLeft16: v.Op = Op386ROLW return true @@ -3398,6 +3408,135 @@ func rewriteValue386_Op386LEAL8(v *Value) bool { } return false } +func rewriteValue386_Op386LoweredPanicBoundsRC(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRC [kind] {p} (MOVLconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != Op386MOVLconst { + break + } + c := auxIntToInt32(v_0.AuxInt) + mem := v_1 + v.reset(Op386LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(c), Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValue386_Op386LoweredPanicBoundsRR(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRR [kind] x (MOVLconst [c]) mem) + // result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + x := v_0 + if v_1.Op != Op386MOVLconst { + break + } + c := auxIntToInt32(v_1.AuxInt) + mem := v_2 + v.reset(Op386LoweredPanicBoundsRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)}) + v.AddArg2(x, mem) + return true + } + // match: (LoweredPanicBoundsRR [kind] (MOVLconst [c]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != Op386MOVLconst { + break + } + c := auxIntToInt32(v_0.AuxInt) + y := v_1 + mem := v_2 + v.reset(Op386LoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)}) + v.AddArg2(y, mem) + return true + } + return false +} +func rewriteValue386_Op386LoweredPanicExtendRC(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicExtendRC [kind] {p} (MOVLconst [hi]) (MOVLconst [lo]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != Op386MOVLconst { + break + } + hi := auxIntToInt32(v_0.AuxInt) + if v_1.Op != Op386MOVLconst { + break + } + lo := auxIntToInt32(v_1.AuxInt) + mem := v_2 + v.reset(Op386LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(hi)<<32 + int64(uint32(lo)), Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValue386_Op386LoweredPanicExtendRR(v *Value) bool { + v_3 := v.Args[3] + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicExtendRR [kind] hi lo (MOVLconst [c]) mem) + // result: (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + hi := v_0 + lo := v_1 + if v_2.Op != Op386MOVLconst { + break + } + c := auxIntToInt32(v_2.AuxInt) + mem := v_3 + v.reset(Op386LoweredPanicExtendRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)}) + v.AddArg3(hi, lo, mem) + return true + } + // match: (LoweredPanicExtendRR [kind] (MOVLconst [hi]) (MOVLconst [lo]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != Op386MOVLconst { + break + } + hi := auxIntToInt32(v_0.AuxInt) + if v_1.Op != Op386MOVLconst { + break + } + lo := auxIntToInt32(v_1.AuxInt) + y := v_2 + mem := v_3 + v.reset(Op386LoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(hi)<<32 + int64(uint32(lo))}) + v.AddArg2(y, mem) + return true + } + return false +} func rewriteValue386_Op386MOVBLSX(v *Value) bool { v_0 := v.Args[0] b := v.Block @@ -9313,118 +9452,6 @@ func rewriteValue386_OpOffPtr(v *Value) bool { return true } } -func rewriteValue386_OpPanicBounds(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicBoundsA [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 0) { - break - } - v.reset(Op386LoweredPanicBoundsA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicBoundsB [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 1) { - break - } - v.reset(Op386LoweredPanicBoundsB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicBoundsC [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 2) { - break - } - v.reset(Op386LoweredPanicBoundsC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - return false -} -func rewriteValue386_OpPanicExtend(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicExtend [kind] hi lo y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicExtendA [kind] hi lo y mem) - for { - kind := auxIntToInt64(v.AuxInt) - hi := v_0 - lo := v_1 - y := v_2 - mem := v_3 - if !(boundsABI(kind) == 0) { - break - } - v.reset(Op386LoweredPanicExtendA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg4(hi, lo, y, mem) - return true - } - // match: (PanicExtend [kind] hi lo y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicExtendB [kind] hi lo y mem) - for { - kind := auxIntToInt64(v.AuxInt) - hi := v_0 - lo := v_1 - y := v_2 - mem := v_3 - if !(boundsABI(kind) == 1) { - break - } - v.reset(Op386LoweredPanicExtendB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg4(hi, lo, y, mem) - return true - } - // match: (PanicExtend [kind] hi lo y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicExtendC [kind] hi lo y mem) - for { - kind := auxIntToInt64(v.AuxInt) - hi := v_0 - lo := v_1 - y := v_2 - mem := v_3 - if !(boundsABI(kind) == 2) { - break - } - v.reset(Op386LoweredPanicExtendC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg4(hi, lo, y, mem) - return true - } - return false -} func rewriteValue386_OpRsh16Ux16(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] diff --git a/src/cmd/compile/internal/ssa/rewriteAMD64.go b/src/cmd/compile/internal/ssa/rewriteAMD64.go index a3a7ba7ed6..f0b25d3c5d 100644 --- a/src/cmd/compile/internal/ssa/rewriteAMD64.go +++ b/src/cmd/compile/internal/ssa/rewriteAMD64.go @@ -215,6 +215,12 @@ func rewriteValueAMD64(v *Value) bool { return rewriteValueAMD64_OpAMD64LEAQ4(v) case OpAMD64LEAQ8: return rewriteValueAMD64_OpAMD64LEAQ8(v) + case OpAMD64LoweredPanicBoundsCR: + return rewriteValueAMD64_OpAMD64LoweredPanicBoundsCR(v) + case OpAMD64LoweredPanicBoundsRC: + return rewriteValueAMD64_OpAMD64LoweredPanicBoundsRC(v) + case OpAMD64LoweredPanicBoundsRR: + return rewriteValueAMD64_OpAMD64LoweredPanicBoundsRR(v) case OpAMD64MOVBELstore: return rewriteValueAMD64_OpAMD64MOVBELstore(v) case OpAMD64MOVBEQstore: @@ -3431,7 +3437,8 @@ func rewriteValueAMD64(v *Value) bool { case OpPairDotProdMaskedInt16x8: return rewriteValueAMD64_OpPairDotProdMaskedInt16x8(v) case OpPanicBounds: - return rewriteValueAMD64_OpPanicBounds(v) + v.Op = OpAMD64LoweredPanicBoundsRR + return true case OpPermute2Float32x16: v.Op = OpAMD64VPERMI2PS512 return true @@ -14127,6 +14134,86 @@ func rewriteValueAMD64_OpAMD64LEAQ8(v *Value) bool { } return false } +func rewriteValueAMD64_OpAMD64LoweredPanicBoundsCR(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsCR [kind] {p} (MOVQconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpAMD64MOVQconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpAMD64LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueAMD64_OpAMD64LoweredPanicBoundsRC(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRC [kind] {p} (MOVQconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpAMD64MOVQconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpAMD64LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueAMD64_OpAMD64LoweredPanicBoundsRR(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRR [kind] x (MOVQconst [c]) mem) + // result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + x := v_0 + if v_1.Op != OpAMD64MOVQconst { + break + } + c := auxIntToInt64(v_1.AuxInt) + mem := v_2 + v.reset(OpAMD64LoweredPanicBoundsRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(x, mem) + return true + } + // match: (LoweredPanicBoundsRR [kind] (MOVQconst [c]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != OpAMD64MOVQconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + y := v_1 + mem := v_2 + v.reset(OpAMD64LoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(y, mem) + return true + } + return false +} func rewriteValueAMD64_OpAMD64MOVBELstore(v *Value) bool { v_2 := v.Args[2] v_1 := v.Args[1] @@ -45567,60 +45654,6 @@ func rewriteValueAMD64_OpPairDotProdMaskedInt16x8(v *Value) bool { return true } } -func rewriteValueAMD64_OpPanicBounds(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicBoundsA [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 0) { - break - } - v.reset(OpAMD64LoweredPanicBoundsA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicBoundsB [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 1) { - break - } - v.reset(OpAMD64LoweredPanicBoundsB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicBoundsC [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 2) { - break - } - v.reset(OpAMD64LoweredPanicBoundsC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - return false -} func rewriteValueAMD64_OpPermute2MaskedFloat32x16(v *Value) bool { v_3 := v.Args[3] v_2 := v.Args[2] @@ -55499,119 +55532,64 @@ func rewriteValueAMD64_OpZero(v *Value) bool { return true } // match: (Zero [s] destptr mem) - // cond: s%16 != 0 && s > 16 - // result: (Zero [s-s%16] (OffPtr <destptr.Type> destptr [s%16]) (MOVOstoreconst [makeValAndOff(0,0)] destptr mem)) + // cond: s >= 16 && s < 192 + // result: (LoweredZero [s] destptr mem) for { s := auxIntToInt64(v.AuxInt) destptr := v_0 mem := v_1 - if !(s%16 != 0 && s > 16) { + if !(s >= 16 && s < 192) { break } - v.reset(OpZero) - v.AuxInt = int64ToAuxInt(s - s%16) - v0 := b.NewValue0(v.Pos, OpOffPtr, destptr.Type) - v0.AuxInt = int64ToAuxInt(s % 16) - v0.AddArg(destptr) - v1 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem) - v1.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0)) - v1.AddArg2(destptr, mem) - v.AddArg2(v0, v1) - return true - } - // match: (Zero [16] destptr mem) - // result: (MOVOstoreconst [makeValAndOff(0,0)] destptr mem) - for { - if auxIntToInt64(v.AuxInt) != 16 { - break - } - destptr := v_0 - mem := v_1 - v.reset(OpAMD64MOVOstoreconst) - v.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0)) + v.reset(OpAMD64LoweredZero) + v.AuxInt = int64ToAuxInt(s) v.AddArg2(destptr, mem) return true } - // match: (Zero [32] destptr mem) - // result: (MOVOstoreconst [makeValAndOff(0,16)] destptr (MOVOstoreconst [makeValAndOff(0,0)] destptr mem)) - for { - if auxIntToInt64(v.AuxInt) != 32 { - break - } - destptr := v_0 - mem := v_1 - v.reset(OpAMD64MOVOstoreconst) - v.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 16)) - v0 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem) - v0.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0)) - v0.AddArg2(destptr, mem) - v.AddArg2(destptr, v0) - return true - } - // match: (Zero [48] destptr mem) - // result: (MOVOstoreconst [makeValAndOff(0,32)] destptr (MOVOstoreconst [makeValAndOff(0,16)] destptr (MOVOstoreconst [makeValAndOff(0,0)] destptr mem))) + // match: (Zero [s] destptr mem) + // cond: s >= 192 && s <= repZeroThreshold + // result: (LoweredZeroLoop [s] destptr mem) for { - if auxIntToInt64(v.AuxInt) != 48 { - break - } + s := auxIntToInt64(v.AuxInt) destptr := v_0 mem := v_1 - v.reset(OpAMD64MOVOstoreconst) - v.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 32)) - v0 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem) - v0.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 16)) - v1 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem) - v1.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0)) - v1.AddArg2(destptr, mem) - v0.AddArg2(destptr, v1) - v.AddArg2(destptr, v0) - return true - } - // match: (Zero [64] destptr mem) - // result: (MOVOstoreconst [makeValAndOff(0,48)] destptr (MOVOstoreconst [makeValAndOff(0,32)] destptr (MOVOstoreconst [makeValAndOff(0,16)] destptr (MOVOstoreconst [makeValAndOff(0,0)] destptr mem)))) - for { - if auxIntToInt64(v.AuxInt) != 64 { + if !(s >= 192 && s <= repZeroThreshold) { break } - destptr := v_0 - mem := v_1 - v.reset(OpAMD64MOVOstoreconst) - v.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 48)) - v0 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem) - v0.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 32)) - v1 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem) - v1.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 16)) - v2 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem) - v2.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0)) - v2.AddArg2(destptr, mem) - v1.AddArg2(destptr, v2) - v0.AddArg2(destptr, v1) - v.AddArg2(destptr, v0) + v.reset(OpAMD64LoweredZeroLoop) + v.AuxInt = int64ToAuxInt(s) + v.AddArg2(destptr, mem) return true } // match: (Zero [s] destptr mem) - // cond: s > 64 && s <= 1024 && s%16 == 0 - // result: (DUFFZERO [s] destptr mem) + // cond: s > repZeroThreshold && s%8 != 0 + // result: (Zero [s-s%8] (OffPtr <destptr.Type> destptr [s%8]) (MOVOstoreconst [makeValAndOff(0,0)] destptr mem)) for { s := auxIntToInt64(v.AuxInt) destptr := v_0 mem := v_1 - if !(s > 64 && s <= 1024 && s%16 == 0) { + if !(s > repZeroThreshold && s%8 != 0) { break } - v.reset(OpAMD64DUFFZERO) - v.AuxInt = int64ToAuxInt(s) - v.AddArg2(destptr, mem) + v.reset(OpZero) + v.AuxInt = int64ToAuxInt(s - s%8) + v0 := b.NewValue0(v.Pos, OpOffPtr, destptr.Type) + v0.AuxInt = int64ToAuxInt(s % 8) + v0.AddArg(destptr) + v1 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem) + v1.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0)) + v1.AddArg2(destptr, mem) + v.AddArg2(v0, v1) return true } // match: (Zero [s] destptr mem) - // cond: s > 1024 && s%8 == 0 + // cond: s > repZeroThreshold && s%8 == 0 // result: (REPSTOSQ destptr (MOVQconst [s/8]) (MOVQconst [0]) mem) for { s := auxIntToInt64(v.AuxInt) destptr := v_0 mem := v_1 - if !(s > 1024 && s%8 == 0) { + if !(s > repZeroThreshold && s%8 == 0) { break } v.reset(OpAMD64REPSTOSQ) diff --git a/src/cmd/compile/internal/ssa/rewriteARM.go b/src/cmd/compile/internal/ssa/rewriteARM.go index 00517da4a1..44380cf8f5 100644 --- a/src/cmd/compile/internal/ssa/rewriteARM.go +++ b/src/cmd/compile/internal/ssa/rewriteARM.go @@ -151,6 +151,14 @@ func rewriteValueARM(v *Value) bool { return rewriteValueARM_OpARMLessThan(v) case OpARMLessThanU: return rewriteValueARM_OpARMLessThanU(v) + case OpARMLoweredPanicBoundsRC: + return rewriteValueARM_OpARMLoweredPanicBoundsRC(v) + case OpARMLoweredPanicBoundsRR: + return rewriteValueARM_OpARMLoweredPanicBoundsRR(v) + case OpARMLoweredPanicExtendRC: + return rewriteValueARM_OpARMLoweredPanicExtendRC(v) + case OpARMLoweredPanicExtendRR: + return rewriteValueARM_OpARMLoweredPanicExtendRR(v) case OpARMMOVBUload: return rewriteValueARM_OpARMMOVBUload(v) case OpARMMOVBUloadidx: @@ -745,9 +753,11 @@ func rewriteValueARM(v *Value) bool { v.Op = OpARMOR return true case OpPanicBounds: - return rewriteValueARM_OpPanicBounds(v) + v.Op = OpARMLoweredPanicBoundsRR + return true case OpPanicExtend: - return rewriteValueARM_OpPanicExtend(v) + v.Op = OpARMLoweredPanicExtendRR + return true case OpRotateLeft16: return rewriteValueARM_OpRotateLeft16(v) case OpRotateLeft32: @@ -4548,6 +4558,135 @@ func rewriteValueARM_OpARMLessThanU(v *Value) bool { } return false } +func rewriteValueARM_OpARMLoweredPanicBoundsRC(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRC [kind] {p} (MOVWconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpARMMOVWconst { + break + } + c := auxIntToInt32(v_0.AuxInt) + mem := v_1 + v.reset(OpARMLoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(c), Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueARM_OpARMLoweredPanicBoundsRR(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRR [kind] x (MOVWconst [c]) mem) + // result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + x := v_0 + if v_1.Op != OpARMMOVWconst { + break + } + c := auxIntToInt32(v_1.AuxInt) + mem := v_2 + v.reset(OpARMLoweredPanicBoundsRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)}) + v.AddArg2(x, mem) + return true + } + // match: (LoweredPanicBoundsRR [kind] (MOVWconst [c]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != OpARMMOVWconst { + break + } + c := auxIntToInt32(v_0.AuxInt) + y := v_1 + mem := v_2 + v.reset(OpARMLoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)}) + v.AddArg2(y, mem) + return true + } + return false +} +func rewriteValueARM_OpARMLoweredPanicExtendRC(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicExtendRC [kind] {p} (MOVWconst [hi]) (MOVWconst [lo]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpARMMOVWconst { + break + } + hi := auxIntToInt32(v_0.AuxInt) + if v_1.Op != OpARMMOVWconst { + break + } + lo := auxIntToInt32(v_1.AuxInt) + mem := v_2 + v.reset(OpARMLoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(hi)<<32 + int64(uint32(lo)), Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueARM_OpARMLoweredPanicExtendRR(v *Value) bool { + v_3 := v.Args[3] + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicExtendRR [kind] hi lo (MOVWconst [c]) mem) + // result: (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + hi := v_0 + lo := v_1 + if v_2.Op != OpARMMOVWconst { + break + } + c := auxIntToInt32(v_2.AuxInt) + mem := v_3 + v.reset(OpARMLoweredPanicExtendRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)}) + v.AddArg3(hi, lo, mem) + return true + } + // match: (LoweredPanicExtendRR [kind] (MOVWconst [hi]) (MOVWconst [lo]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != OpARMMOVWconst { + break + } + hi := auxIntToInt32(v_0.AuxInt) + if v_1.Op != OpARMMOVWconst { + break + } + lo := auxIntToInt32(v_1.AuxInt) + y := v_2 + mem := v_3 + v.reset(OpARMLoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(hi)<<32 + int64(uint32(lo))}) + v.AddArg2(y, mem) + return true + } + return false +} func rewriteValueARM_OpARMMOVBUload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] @@ -14969,118 +15108,6 @@ func rewriteValueARM_OpOffPtr(v *Value) bool { return true } } -func rewriteValueARM_OpPanicBounds(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicBoundsA [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 0) { - break - } - v.reset(OpARMLoweredPanicBoundsA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicBoundsB [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 1) { - break - } - v.reset(OpARMLoweredPanicBoundsB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicBoundsC [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 2) { - break - } - v.reset(OpARMLoweredPanicBoundsC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - return false -} -func rewriteValueARM_OpPanicExtend(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicExtend [kind] hi lo y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicExtendA [kind] hi lo y mem) - for { - kind := auxIntToInt64(v.AuxInt) - hi := v_0 - lo := v_1 - y := v_2 - mem := v_3 - if !(boundsABI(kind) == 0) { - break - } - v.reset(OpARMLoweredPanicExtendA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg4(hi, lo, y, mem) - return true - } - // match: (PanicExtend [kind] hi lo y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicExtendB [kind] hi lo y mem) - for { - kind := auxIntToInt64(v.AuxInt) - hi := v_0 - lo := v_1 - y := v_2 - mem := v_3 - if !(boundsABI(kind) == 1) { - break - } - v.reset(OpARMLoweredPanicExtendB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg4(hi, lo, y, mem) - return true - } - // match: (PanicExtend [kind] hi lo y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicExtendC [kind] hi lo y mem) - for { - kind := auxIntToInt64(v.AuxInt) - hi := v_0 - lo := v_1 - y := v_2 - mem := v_3 - if !(boundsABI(kind) == 2) { - break - } - v.reset(OpARMLoweredPanicExtendC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg4(hi, lo, y, mem) - return true - } - return false -} func rewriteValueARM_OpRotateLeft16(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] diff --git a/src/cmd/compile/internal/ssa/rewriteARM64.go b/src/cmd/compile/internal/ssa/rewriteARM64.go index 792967c001..32f0f55434 100644 --- a/src/cmd/compile/internal/ssa/rewriteARM64.go +++ b/src/cmd/compile/internal/ssa/rewriteARM64.go @@ -180,6 +180,12 @@ func rewriteValueARM64(v *Value) bool { return rewriteValueARM64_OpARM64LessThanNoov(v) case OpARM64LessThanU: return rewriteValueARM64_OpARM64LessThanU(v) + case OpARM64LoweredPanicBoundsCR: + return rewriteValueARM64_OpARM64LoweredPanicBoundsCR(v) + case OpARM64LoweredPanicBoundsRC: + return rewriteValueARM64_OpARM64LoweredPanicBoundsRC(v) + case OpARM64LoweredPanicBoundsRR: + return rewriteValueARM64_OpARM64LoweredPanicBoundsRR(v) case OpARM64MADD: return rewriteValueARM64_OpARM64MADD(v) case OpARM64MADDW: @@ -936,7 +942,8 @@ func rewriteValueARM64(v *Value) bool { v.Op = OpARM64OR return true case OpPanicBounds: - return rewriteValueARM64_OpPanicBounds(v) + v.Op = OpARM64LoweredPanicBoundsRR + return true case OpPopCount16: return rewriteValueARM64_OpPopCount16(v) case OpPopCount32: @@ -1592,6 +1599,66 @@ func rewriteValueARM64_OpARM64ADD(v *Value) bool { } break } + // match: (ADD x0 x1:(ANDshiftRA x2:(SLLconst [sl] y) z [63])) + // cond: x1.Uses == 1 && x2.Uses == 1 + // result: (ADDshiftLL x0 (ANDshiftRA <y.Type> y z [63]) [sl]) + for { + for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { + x0 := v_0 + x1 := v_1 + if x1.Op != OpARM64ANDshiftRA || auxIntToInt64(x1.AuxInt) != 63 { + continue + } + z := x1.Args[1] + x2 := x1.Args[0] + if x2.Op != OpARM64SLLconst { + continue + } + sl := auxIntToInt64(x2.AuxInt) + y := x2.Args[0] + if !(x1.Uses == 1 && x2.Uses == 1) { + continue + } + v.reset(OpARM64ADDshiftLL) + v.AuxInt = int64ToAuxInt(sl) + v0 := b.NewValue0(v.Pos, OpARM64ANDshiftRA, y.Type) + v0.AuxInt = int64ToAuxInt(63) + v0.AddArg2(y, z) + v.AddArg2(x0, v0) + return true + } + break + } + // match: (ADD x0 x1:(ANDshiftLL x2:(SRAconst [63] z) y [sl])) + // cond: x1.Uses == 1 && x2.Uses == 1 + // result: (ADDshiftLL x0 (ANDshiftRA <y.Type> y z [63]) [sl]) + for { + for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { + x0 := v_0 + x1 := v_1 + if x1.Op != OpARM64ANDshiftLL { + continue + } + sl := auxIntToInt64(x1.AuxInt) + y := x1.Args[1] + x2 := x1.Args[0] + if x2.Op != OpARM64SRAconst || auxIntToInt64(x2.AuxInt) != 63 { + continue + } + z := x2.Args[0] + if !(x1.Uses == 1 && x2.Uses == 1) { + continue + } + v.reset(OpARM64ADDshiftLL) + v.AuxInt = int64ToAuxInt(sl) + v0 := b.NewValue0(v.Pos, OpARM64ANDshiftRA, y.Type) + v0.AuxInt = int64ToAuxInt(63) + v0.AddArg2(y, z) + v.AddArg2(x0, v0) + return true + } + break + } return false } func rewriteValueARM64_OpARM64ADDSflags(v *Value) bool { @@ -6982,6 +7049,86 @@ func rewriteValueARM64_OpARM64LessThanU(v *Value) bool { } return false } +func rewriteValueARM64_OpARM64LoweredPanicBoundsCR(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpARM64MOVDconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpARM64LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueARM64_OpARM64LoweredPanicBoundsRC(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpARM64MOVDconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpARM64LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueARM64_OpARM64LoweredPanicBoundsRR(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem) + // result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + x := v_0 + if v_1.Op != OpARM64MOVDconst { + break + } + c := auxIntToInt64(v_1.AuxInt) + mem := v_2 + v.reset(OpARM64LoweredPanicBoundsRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(x, mem) + return true + } + // match: (LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != OpARM64MOVDconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + y := v_1 + mem := v_2 + v.reset(OpARM64LoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(y, mem) + return true + } + return false +} func rewriteValueARM64_OpARM64MADD(v *Value) bool { v_2 := v.Args[2] v_1 := v.Args[1] @@ -19790,60 +19937,6 @@ func rewriteValueARM64_OpOffPtr(v *Value) bool { return true } } -func rewriteValueARM64_OpPanicBounds(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicBoundsA [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 0) { - break - } - v.reset(OpARM64LoweredPanicBoundsA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicBoundsB [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 1) { - break - } - v.reset(OpARM64LoweredPanicBoundsB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicBoundsC [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 2) { - break - } - v.reset(OpARM64LoweredPanicBoundsC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - return false -} func rewriteValueARM64_OpPopCount16(v *Value) bool { v_0 := v.Args[0] b := v.Block @@ -25045,6 +25138,37 @@ func rewriteBlockARM64(b *Block) bool { b.resetWithControl(BlockARM64FGE, cc) return true } + // match: (NZ sub:(SUB x y)) + // cond: sub.Uses == 1 + // result: (NE (CMP x y)) + for b.Controls[0].Op == OpARM64SUB { + sub := b.Controls[0] + y := sub.Args[1] + x := sub.Args[0] + if !(sub.Uses == 1) { + break + } + v0 := b.NewValue0(sub.Pos, OpARM64CMP, types.TypeFlags) + v0.AddArg2(x, y) + b.resetWithControl(BlockARM64NE, v0) + return true + } + // match: (NZ sub:(SUBconst [c] y)) + // cond: sub.Uses == 1 + // result: (NE (CMPconst [c] y)) + for b.Controls[0].Op == OpARM64SUBconst { + sub := b.Controls[0] + c := auxIntToInt64(sub.AuxInt) + y := sub.Args[0] + if !(sub.Uses == 1) { + break + } + v0 := b.NewValue0(sub.Pos, OpARM64CMPconst, types.TypeFlags) + v0.AuxInt = int64ToAuxInt(c) + v0.AddArg(y) + b.resetWithControl(BlockARM64NE, v0) + return true + } // match: (NZ (ANDconst [c] x) yes no) // cond: oneBit(c) // result: (TBNZ [int64(ntz64(c))] x yes no) @@ -25083,6 +25207,37 @@ func rewriteBlockARM64(b *Block) bool { return true } case BlockARM64NZW: + // match: (NZW sub:(SUB x y)) + // cond: sub.Uses == 1 + // result: (NE (CMPW x y)) + for b.Controls[0].Op == OpARM64SUB { + sub := b.Controls[0] + y := sub.Args[1] + x := sub.Args[0] + if !(sub.Uses == 1) { + break + } + v0 := b.NewValue0(sub.Pos, OpARM64CMPW, types.TypeFlags) + v0.AddArg2(x, y) + b.resetWithControl(BlockARM64NE, v0) + return true + } + // match: (NZW sub:(SUBconst [c] y)) + // cond: sub.Uses == 1 + // result: (NE (CMPWconst [int32(c)] y)) + for b.Controls[0].Op == OpARM64SUBconst { + sub := b.Controls[0] + c := auxIntToInt64(sub.AuxInt) + y := sub.Args[0] + if !(sub.Uses == 1) { + break + } + v0 := b.NewValue0(sub.Pos, OpARM64CMPWconst, types.TypeFlags) + v0.AuxInt = int32ToAuxInt(int32(c)) + v0.AddArg(y) + b.resetWithControl(BlockARM64NE, v0) + return true + } // match: (NZW (ANDconst [c] x) yes no) // cond: oneBit(int64(uint32(c))) // result: (TBNZ [int64(ntz64(int64(uint32(c))))] x yes no) @@ -25312,6 +25467,34 @@ func rewriteBlockARM64(b *Block) bool { return true } case BlockARM64UGT: + // match: (UGT (CMPconst [0] x)) + // result: (NE (CMPconst [0] x)) + for b.Controls[0].Op == OpARM64CMPconst { + v_0 := b.Controls[0] + if auxIntToInt64(v_0.AuxInt) != 0 { + break + } + x := v_0.Args[0] + v0 := b.NewValue0(v_0.Pos, OpARM64CMPconst, types.TypeFlags) + v0.AuxInt = int64ToAuxInt(0) + v0.AddArg(x) + b.resetWithControl(BlockARM64NE, v0) + return true + } + // match: (UGT (CMPWconst [0] x)) + // result: (NE (CMPWconst [0] x)) + for b.Controls[0].Op == OpARM64CMPWconst { + v_0 := b.Controls[0] + if auxIntToInt32(v_0.AuxInt) != 0 { + break + } + x := v_0.Args[0] + v0 := b.NewValue0(v_0.Pos, OpARM64CMPWconst, types.TypeFlags) + v0.AuxInt = int32ToAuxInt(0) + v0.AddArg(x) + b.resetWithControl(BlockARM64NE, v0) + return true + } // match: (UGT (FlagConstant [fc]) yes no) // cond: fc.ugt() // result: (First yes no) @@ -25346,6 +25529,34 @@ func rewriteBlockARM64(b *Block) bool { return true } case BlockARM64ULE: + // match: (ULE (CMPconst [0] x)) + // result: (EQ (CMPconst [0] x)) + for b.Controls[0].Op == OpARM64CMPconst { + v_0 := b.Controls[0] + if auxIntToInt64(v_0.AuxInt) != 0 { + break + } + x := v_0.Args[0] + v0 := b.NewValue0(v_0.Pos, OpARM64CMPconst, types.TypeFlags) + v0.AuxInt = int64ToAuxInt(0) + v0.AddArg(x) + b.resetWithControl(BlockARM64EQ, v0) + return true + } + // match: (ULE (CMPWconst [0] x)) + // result: (EQ (CMPWconst [0] x)) + for b.Controls[0].Op == OpARM64CMPWconst { + v_0 := b.Controls[0] + if auxIntToInt32(v_0.AuxInt) != 0 { + break + } + x := v_0.Args[0] + v0 := b.NewValue0(v_0.Pos, OpARM64CMPWconst, types.TypeFlags) + v0.AuxInt = int32ToAuxInt(0) + v0.AddArg(x) + b.resetWithControl(BlockARM64EQ, v0) + return true + } // match: (ULE (FlagConstant [fc]) yes no) // cond: fc.ule() // result: (First yes no) @@ -25414,6 +25625,37 @@ func rewriteBlockARM64(b *Block) bool { return true } case BlockARM64Z: + // match: (Z sub:(SUB x y)) + // cond: sub.Uses == 1 + // result: (EQ (CMP x y)) + for b.Controls[0].Op == OpARM64SUB { + sub := b.Controls[0] + y := sub.Args[1] + x := sub.Args[0] + if !(sub.Uses == 1) { + break + } + v0 := b.NewValue0(sub.Pos, OpARM64CMP, types.TypeFlags) + v0.AddArg2(x, y) + b.resetWithControl(BlockARM64EQ, v0) + return true + } + // match: (Z sub:(SUBconst [c] y)) + // cond: sub.Uses == 1 + // result: (EQ (CMPconst [c] y)) + for b.Controls[0].Op == OpARM64SUBconst { + sub := b.Controls[0] + c := auxIntToInt64(sub.AuxInt) + y := sub.Args[0] + if !(sub.Uses == 1) { + break + } + v0 := b.NewValue0(sub.Pos, OpARM64CMPconst, types.TypeFlags) + v0.AuxInt = int64ToAuxInt(c) + v0.AddArg(y) + b.resetWithControl(BlockARM64EQ, v0) + return true + } // match: (Z (ANDconst [c] x) yes no) // cond: oneBit(c) // result: (TBZ [int64(ntz64(c))] x yes no) @@ -25452,6 +25694,37 @@ func rewriteBlockARM64(b *Block) bool { return true } case BlockARM64ZW: + // match: (ZW sub:(SUB x y)) + // cond: sub.Uses == 1 + // result: (EQ (CMPW x y)) + for b.Controls[0].Op == OpARM64SUB { + sub := b.Controls[0] + y := sub.Args[1] + x := sub.Args[0] + if !(sub.Uses == 1) { + break + } + v0 := b.NewValue0(sub.Pos, OpARM64CMPW, types.TypeFlags) + v0.AddArg2(x, y) + b.resetWithControl(BlockARM64EQ, v0) + return true + } + // match: (ZW sub:(SUBconst [c] y)) + // cond: sub.Uses == 1 + // result: (EQ (CMPWconst [int32(c)] y)) + for b.Controls[0].Op == OpARM64SUBconst { + sub := b.Controls[0] + c := auxIntToInt64(sub.AuxInt) + y := sub.Args[0] + if !(sub.Uses == 1) { + break + } + v0 := b.NewValue0(sub.Pos, OpARM64CMPWconst, types.TypeFlags) + v0.AuxInt = int32ToAuxInt(int32(c)) + v0.AddArg(y) + b.resetWithControl(BlockARM64EQ, v0) + return true + } // match: (ZW (ANDconst [c] x) yes no) // cond: oneBit(int64(uint32(c))) // result: (TBZ [int64(ntz64(int64(uint32(c))))] x yes no) diff --git a/src/cmd/compile/internal/ssa/rewriteLOONG64.go b/src/cmd/compile/internal/ssa/rewriteLOONG64.go index 7c46ed7727..83242413f0 100644 --- a/src/cmd/compile/internal/ssa/rewriteLOONG64.go +++ b/src/cmd/compile/internal/ssa/rewriteLOONG64.go @@ -330,6 +330,12 @@ func rewriteValueLOONG64(v *Value) bool { return rewriteValueLOONG64_OpLOONG64DIVV(v) case OpLOONG64DIVVU: return rewriteValueLOONG64_OpLOONG64DIVVU(v) + case OpLOONG64LoweredPanicBoundsCR: + return rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsCR(v) + case OpLOONG64LoweredPanicBoundsRC: + return rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsRC(v) + case OpLOONG64LoweredPanicBoundsRR: + return rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsRR(v) case OpLOONG64MASKEQZ: return rewriteValueLOONG64_OpLOONG64MASKEQZ(v) case OpLOONG64MASKNEZ: @@ -669,7 +675,8 @@ func rewriteValueLOONG64(v *Value) bool { v.Op = OpLOONG64OR return true case OpPanicBounds: - return rewriteValueLOONG64_OpPanicBounds(v) + v.Op = OpLOONG64LoweredPanicBoundsRR + return true case OpPopCount16: return rewriteValueLOONG64_OpPopCount16(v) case OpPopCount32: @@ -2070,6 +2077,86 @@ func rewriteValueLOONG64_OpLOONG64DIVVU(v *Value) bool { } return false } +func rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsCR(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsCR [kind] {p} (MOVVconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpLOONG64MOVVconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpLOONG64LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsRC(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRC [kind] {p} (MOVVconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpLOONG64MOVVconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpLOONG64LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsRR(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRR [kind] x (MOVVconst [c]) mem) + // result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + x := v_0 + if v_1.Op != OpLOONG64MOVVconst { + break + } + c := auxIntToInt64(v_1.AuxInt) + mem := v_2 + v.reset(OpLOONG64LoweredPanicBoundsRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(x, mem) + return true + } + // match: (LoweredPanicBoundsRR [kind] (MOVVconst [c]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != OpLOONG64MOVVconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + y := v_1 + mem := v_2 + v.reset(OpLOONG64LoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(y, mem) + return true + } + return false +} func rewriteValueLOONG64_OpLOONG64MASKEQZ(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] @@ -2378,6 +2465,21 @@ func rewriteValueLOONG64_OpLOONG64MOVBUreg(v *Value) bool { v.AddArg(x) return true } + // match: (MOVBUreg x:(ANDconst [c] y)) + // cond: c >= 0 && int64(uint8(c)) == c + // result: x + for { + x := v_0 + if x.Op != OpLOONG64ANDconst { + break + } + c := auxIntToInt64(x.AuxInt) + if !(c >= 0 && int64(uint8(c)) == c) { + break + } + v.copyOf(x) + return true + } return false } func rewriteValueLOONG64_OpLOONG64MOVBload(v *Value) bool { @@ -2526,6 +2628,21 @@ func rewriteValueLOONG64_OpLOONG64MOVBreg(v *Value) bool { v.AuxInt = int64ToAuxInt(int64(int8(c))) return true } + // match: (MOVBreg x:(ANDconst [c] y)) + // cond: c >= 0 && int64(int8(c)) == c + // result: x + for { + x := v_0 + if x.Op != OpLOONG64ANDconst { + break + } + c := auxIntToInt64(x.AuxInt) + if !(c >= 0 && int64(int8(c)) == c) { + break + } + v.copyOf(x) + return true + } return false } func rewriteValueLOONG64_OpLOONG64MOVBstore(v *Value) bool { @@ -3614,6 +3731,21 @@ func rewriteValueLOONG64_OpLOONG64MOVHUreg(v *Value) bool { v.AuxInt = int64ToAuxInt(int64(uint16(c))) return true } + // match: (MOVHUreg x:(ANDconst [c] y)) + // cond: c >= 0 && int64(uint16(c)) == c + // result: x + for { + x := v_0 + if x.Op != OpLOONG64ANDconst { + break + } + c := auxIntToInt64(x.AuxInt) + if !(c >= 0 && int64(uint16(c)) == c) { + break + } + v.copyOf(x) + return true + } return false } func rewriteValueLOONG64_OpLOONG64MOVHload(v *Value) bool { @@ -3806,6 +3938,21 @@ func rewriteValueLOONG64_OpLOONG64MOVHreg(v *Value) bool { v.AuxInt = int64ToAuxInt(int64(int16(c))) return true } + // match: (MOVHreg x:(ANDconst [c] y)) + // cond: c >= 0 && int64(int16(c)) == c + // result: x + for { + x := v_0 + if x.Op != OpLOONG64ANDconst { + break + } + c := auxIntToInt64(x.AuxInt) + if !(c >= 0 && int64(int16(c)) == c) { + break + } + v.copyOf(x) + return true + } return false } func rewriteValueLOONG64_OpLOONG64MOVHstore(v *Value) bool { @@ -4821,6 +4968,21 @@ func rewriteValueLOONG64_OpLOONG64MOVWUreg(v *Value) bool { v.AuxInt = int64ToAuxInt(int64(uint32(c))) return true } + // match: (MOVWUreg x:(ANDconst [c] y)) + // cond: c >= 0 && int64(uint32(c)) == c + // result: x + for { + x := v_0 + if x.Op != OpLOONG64ANDconst { + break + } + c := auxIntToInt64(x.AuxInt) + if !(c >= 0 && int64(uint32(c)) == c) { + break + } + v.copyOf(x) + return true + } return false } func rewriteValueLOONG64_OpLOONG64MOVWload(v *Value) bool { @@ -5046,6 +5208,21 @@ func rewriteValueLOONG64_OpLOONG64MOVWreg(v *Value) bool { v.AuxInt = int64ToAuxInt(int64(int32(c))) return true } + // match: (MOVWreg x:(ANDconst [c] y)) + // cond: c >= 0 && int64(int32(c)) == c + // result: x + for { + x := v_0 + if x.Op != OpLOONG64ANDconst { + break + } + c := auxIntToInt64(x.AuxInt) + if !(c >= 0 && int64(int32(c)) == c) { + break + } + v.copyOf(x) + return true + } return false } func rewriteValueLOONG64_OpLOONG64MOVWstore(v *Value) bool { @@ -5360,20 +5537,8 @@ func rewriteValueLOONG64_OpLOONG64MOVWstorezeroidx(v *Value) bool { func rewriteValueLOONG64_OpLOONG64MULV(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] - // match: (MULV x (MOVVconst [-1])) - // result: (NEGV x) - for { - for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { - x := v_0 - if v_1.Op != OpLOONG64MOVVconst || auxIntToInt64(v_1.AuxInt) != -1 { - continue - } - v.reset(OpLOONG64NEGV) - v.AddArg(x) - return true - } - break - } + b := v.Block + config := b.Func.Config // match: (MULV _ (MOVVconst [0])) // result: (MOVVconst [0]) for { @@ -5401,8 +5566,8 @@ func rewriteValueLOONG64_OpLOONG64MULV(v *Value) bool { break } // match: (MULV x (MOVVconst [c])) - // cond: isPowerOfTwo(c) - // result: (SLLVconst [log64(c)] x) + // cond: canMulStrengthReduce(config, c) + // result: {mulStrengthReduce(v, x, c)} for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { x := v_0 @@ -5410,12 +5575,10 @@ func rewriteValueLOONG64_OpLOONG64MULV(v *Value) bool { continue } c := auxIntToInt64(v_1.AuxInt) - if !(isPowerOfTwo(c)) { + if !(canMulStrengthReduce(config, c)) { continue } - v.reset(OpLOONG64SLLVconst) - v.AuxInt = int64ToAuxInt(log64(c)) - v.AddArg(x) + v.copyOf(mulStrengthReduce(v, x, c)) return true } break @@ -9016,60 +9179,6 @@ func rewriteValueLOONG64_OpOffPtr(v *Value) bool { return true } } -func rewriteValueLOONG64_OpPanicBounds(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicBoundsA [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 0) { - break - } - v.reset(OpLOONG64LoweredPanicBoundsA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicBoundsB [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 1) { - break - } - v.reset(OpLOONG64LoweredPanicBoundsB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicBoundsC [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 2) { - break - } - v.reset(OpLOONG64LoweredPanicBoundsC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - return false -} func rewriteValueLOONG64_OpPopCount16(v *Value) bool { v_0 := v.Args[0] b := v.Block diff --git a/src/cmd/compile/internal/ssa/rewriteLOONG64latelower.go b/src/cmd/compile/internal/ssa/rewriteLOONG64latelower.go new file mode 100644 index 0000000000..ef9b83192c --- /dev/null +++ b/src/cmd/compile/internal/ssa/rewriteLOONG64latelower.go @@ -0,0 +1,29 @@ +// Code generated from _gen/LOONG64latelower.rules using 'go generate'; DO NOT EDIT. + +package ssa + +func rewriteValueLOONG64latelower(v *Value) bool { + switch v.Op { + case OpLOONG64SLLVconst: + return rewriteValueLOONG64latelower_OpLOONG64SLLVconst(v) + } + return false +} +func rewriteValueLOONG64latelower_OpLOONG64SLLVconst(v *Value) bool { + v_0 := v.Args[0] + // match: (SLLVconst [1] x) + // result: (ADDV x x) + for { + if auxIntToInt64(v.AuxInt) != 1 { + break + } + x := v_0 + v.reset(OpLOONG64ADDV) + v.AddArg2(x, x) + return true + } + return false +} +func rewriteBlockLOONG64latelower(b *Block) bool { + return false +} diff --git a/src/cmd/compile/internal/ssa/rewriteMIPS.go b/src/cmd/compile/internal/ssa/rewriteMIPS.go index 4c5edb8694..fda02e64d1 100644 --- a/src/cmd/compile/internal/ssa/rewriteMIPS.go +++ b/src/cmd/compile/internal/ssa/rewriteMIPS.go @@ -279,6 +279,14 @@ func rewriteValueMIPS(v *Value) bool { return rewriteValueMIPS_OpMIPSLoweredAtomicAdd(v) case OpMIPSLoweredAtomicStore32: return rewriteValueMIPS_OpMIPSLoweredAtomicStore32(v) + case OpMIPSLoweredPanicBoundsRC: + return rewriteValueMIPS_OpMIPSLoweredPanicBoundsRC(v) + case OpMIPSLoweredPanicBoundsRR: + return rewriteValueMIPS_OpMIPSLoweredPanicBoundsRR(v) + case OpMIPSLoweredPanicExtendRC: + return rewriteValueMIPS_OpMIPSLoweredPanicExtendRC(v) + case OpMIPSLoweredPanicExtendRR: + return rewriteValueMIPS_OpMIPSLoweredPanicExtendRR(v) case OpMIPSMOVBUload: return rewriteValueMIPS_OpMIPSMOVBUload(v) case OpMIPSMOVBUreg: @@ -447,9 +455,11 @@ func rewriteValueMIPS(v *Value) bool { v.Op = OpMIPSOR return true case OpPanicBounds: - return rewriteValueMIPS_OpPanicBounds(v) + v.Op = OpMIPSLoweredPanicBoundsRR + return true case OpPanicExtend: - return rewriteValueMIPS_OpPanicExtend(v) + v.Op = OpMIPSLoweredPanicExtendRR + return true case OpPubBarrier: v.Op = OpMIPSLoweredPubBarrier return true @@ -2435,6 +2445,135 @@ func rewriteValueMIPS_OpMIPSLoweredAtomicStore32(v *Value) bool { } return false } +func rewriteValueMIPS_OpMIPSLoweredPanicBoundsRC(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRC [kind] {p} (MOVWconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpMIPSMOVWconst { + break + } + c := auxIntToInt32(v_0.AuxInt) + mem := v_1 + v.reset(OpMIPSLoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(c), Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueMIPS_OpMIPSLoweredPanicBoundsRR(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRR [kind] x (MOVWconst [c]) mem) + // result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + x := v_0 + if v_1.Op != OpMIPSMOVWconst { + break + } + c := auxIntToInt32(v_1.AuxInt) + mem := v_2 + v.reset(OpMIPSLoweredPanicBoundsRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)}) + v.AddArg2(x, mem) + return true + } + // match: (LoweredPanicBoundsRR [kind] (MOVWconst [c]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != OpMIPSMOVWconst { + break + } + c := auxIntToInt32(v_0.AuxInt) + y := v_1 + mem := v_2 + v.reset(OpMIPSLoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)}) + v.AddArg2(y, mem) + return true + } + return false +} +func rewriteValueMIPS_OpMIPSLoweredPanicExtendRC(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicExtendRC [kind] {p} (MOVWconst [hi]) (MOVWconst [lo]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpMIPSMOVWconst { + break + } + hi := auxIntToInt32(v_0.AuxInt) + if v_1.Op != OpMIPSMOVWconst { + break + } + lo := auxIntToInt32(v_1.AuxInt) + mem := v_2 + v.reset(OpMIPSLoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(hi)<<32 + int64(uint32(lo)), Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueMIPS_OpMIPSLoweredPanicExtendRR(v *Value) bool { + v_3 := v.Args[3] + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicExtendRR [kind] hi lo (MOVWconst [c]) mem) + // result: (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + hi := v_0 + lo := v_1 + if v_2.Op != OpMIPSMOVWconst { + break + } + c := auxIntToInt32(v_2.AuxInt) + mem := v_3 + v.reset(OpMIPSLoweredPanicExtendRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)}) + v.AddArg3(hi, lo, mem) + return true + } + // match: (LoweredPanicExtendRR [kind] (MOVWconst [hi]) (MOVWconst [lo]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != OpMIPSMOVWconst { + break + } + hi := auxIntToInt32(v_0.AuxInt) + if v_1.Op != OpMIPSMOVWconst { + break + } + lo := auxIntToInt32(v_1.AuxInt) + y := v_2 + mem := v_3 + v.reset(OpMIPSLoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(hi)<<32 + int64(uint32(lo))}) + v.AddArg2(y, mem) + return true + } + return false +} func rewriteValueMIPS_OpMIPSMOVBUload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] @@ -4058,8 +4197,8 @@ func rewriteValueMIPS_OpMIPSMUL(v *Value) bool { break } // match: (MUL (MOVWconst [c]) x ) - // cond: isPowerOfTwo(int64(uint32(c))) - // result: (SLLconst [int32(log2uint32(int64(c)))] x) + // cond: isUnsignedPowerOfTwo(uint32(c)) + // result: (SLLconst [int32(log32u(uint32(c)))] x) for { for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 { if v_0.Op != OpMIPSMOVWconst { @@ -4067,11 +4206,11 @@ func rewriteValueMIPS_OpMIPSMUL(v *Value) bool { } c := auxIntToInt32(v_0.AuxInt) x := v_1 - if !(isPowerOfTwo(int64(uint32(c)))) { + if !(isUnsignedPowerOfTwo(uint32(c))) { continue } v.reset(OpMIPSSLLconst) - v.AuxInt = int32ToAuxInt(int32(log2uint32(int64(c)))) + v.AuxInt = int32ToAuxInt(int32(log32u(uint32(c)))) v.AddArg(x) return true } @@ -5586,118 +5725,6 @@ func rewriteValueMIPS_OpOffPtr(v *Value) bool { return true } } -func rewriteValueMIPS_OpPanicBounds(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicBoundsA [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 0) { - break - } - v.reset(OpMIPSLoweredPanicBoundsA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicBoundsB [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 1) { - break - } - v.reset(OpMIPSLoweredPanicBoundsB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicBoundsC [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 2) { - break - } - v.reset(OpMIPSLoweredPanicBoundsC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - return false -} -func rewriteValueMIPS_OpPanicExtend(v *Value) bool { - v_3 := v.Args[3] - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicExtend [kind] hi lo y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicExtendA [kind] hi lo y mem) - for { - kind := auxIntToInt64(v.AuxInt) - hi := v_0 - lo := v_1 - y := v_2 - mem := v_3 - if !(boundsABI(kind) == 0) { - break - } - v.reset(OpMIPSLoweredPanicExtendA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg4(hi, lo, y, mem) - return true - } - // match: (PanicExtend [kind] hi lo y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicExtendB [kind] hi lo y mem) - for { - kind := auxIntToInt64(v.AuxInt) - hi := v_0 - lo := v_1 - y := v_2 - mem := v_3 - if !(boundsABI(kind) == 1) { - break - } - v.reset(OpMIPSLoweredPanicExtendB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg4(hi, lo, y, mem) - return true - } - // match: (PanicExtend [kind] hi lo y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicExtendC [kind] hi lo y mem) - for { - kind := auxIntToInt64(v.AuxInt) - hi := v_0 - lo := v_1 - y := v_2 - mem := v_3 - if !(boundsABI(kind) == 2) { - break - } - v.reset(OpMIPSLoweredPanicExtendC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg4(hi, lo, y, mem) - return true - } - return false -} func rewriteValueMIPS_OpRotateLeft16(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] @@ -6611,8 +6638,8 @@ func rewriteValueMIPS_OpSelect0(v *Value) bool { break } // match: (Select0 (MULTU (MOVWconst [c]) x )) - // cond: isPowerOfTwo(int64(uint32(c))) - // result: (SRLconst [int32(32-log2uint32(int64(c)))] x) + // cond: isUnsignedPowerOfTwo(uint32(c)) + // result: (SRLconst [int32(32-log32u(uint32(c)))] x) for { if v_0.Op != OpMIPSMULTU { break @@ -6626,11 +6653,11 @@ func rewriteValueMIPS_OpSelect0(v *Value) bool { } c := auxIntToInt32(v_0_0.AuxInt) x := v_0_1 - if !(isPowerOfTwo(int64(uint32(c)))) { + if !(isUnsignedPowerOfTwo(uint32(c))) { continue } v.reset(OpMIPSSRLconst) - v.AuxInt = int32ToAuxInt(int32(32 - log2uint32(int64(c)))) + v.AuxInt = int32ToAuxInt(int32(32 - log32u(uint32(c)))) v.AddArg(x) return true } @@ -6807,8 +6834,8 @@ func rewriteValueMIPS_OpSelect1(v *Value) bool { break } // match: (Select1 (MULTU (MOVWconst [c]) x )) - // cond: isPowerOfTwo(int64(uint32(c))) - // result: (SLLconst [int32(log2uint32(int64(c)))] x) + // cond: isUnsignedPowerOfTwo(uint32(c)) + // result: (SLLconst [int32(log32u(uint32(c)))] x) for { if v_0.Op != OpMIPSMULTU { break @@ -6822,11 +6849,11 @@ func rewriteValueMIPS_OpSelect1(v *Value) bool { } c := auxIntToInt32(v_0_0.AuxInt) x := v_0_1 - if !(isPowerOfTwo(int64(uint32(c)))) { + if !(isUnsignedPowerOfTwo(uint32(c))) { continue } v.reset(OpMIPSSLLconst) - v.AuxInt = int32ToAuxInt(int32(log2uint32(int64(c)))) + v.AuxInt = int32ToAuxInt(int32(log32u(uint32(c)))) v.AddArg(x) return true } diff --git a/src/cmd/compile/internal/ssa/rewriteMIPS64.go b/src/cmd/compile/internal/ssa/rewriteMIPS64.go index c30815cefb..c270ee4d83 100644 --- a/src/cmd/compile/internal/ssa/rewriteMIPS64.go +++ b/src/cmd/compile/internal/ssa/rewriteMIPS64.go @@ -316,6 +316,12 @@ func rewriteValueMIPS64(v *Value) bool { return rewriteValueMIPS64_OpMIPS64LoweredAtomicStore32(v) case OpMIPS64LoweredAtomicStore64: return rewriteValueMIPS64_OpMIPS64LoweredAtomicStore64(v) + case OpMIPS64LoweredPanicBoundsCR: + return rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsCR(v) + case OpMIPS64LoweredPanicBoundsRC: + return rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsRC(v) + case OpMIPS64LoweredPanicBoundsRR: + return rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsRR(v) case OpMIPS64MOVBUload: return rewriteValueMIPS64_OpMIPS64MOVBUload(v) case OpMIPS64MOVBUreg: @@ -501,7 +507,8 @@ func rewriteValueMIPS64(v *Value) bool { v.Op = OpMIPS64OR return true case OpPanicBounds: - return rewriteValueMIPS64_OpPanicBounds(v) + v.Op = OpMIPS64LoweredPanicBoundsRR + return true case OpPubBarrier: v.Op = OpMIPS64LoweredPubBarrier return true @@ -2757,6 +2764,86 @@ func rewriteValueMIPS64_OpMIPS64LoweredAtomicStore64(v *Value) bool { } return false } +func rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsCR(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsCR [kind] {p} (MOVVconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpMIPS64MOVVconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpMIPS64LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsRC(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRC [kind] {p} (MOVVconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpMIPS64MOVVconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpMIPS64LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsRR(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRR [kind] x (MOVVconst [c]) mem) + // result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + x := v_0 + if v_1.Op != OpMIPS64MOVVconst { + break + } + c := auxIntToInt64(v_1.AuxInt) + mem := v_2 + v.reset(OpMIPS64LoweredPanicBoundsRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(x, mem) + return true + } + // match: (LoweredPanicBoundsRR [kind] (MOVVconst [c]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != OpMIPS64MOVVconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + y := v_1 + mem := v_2 + v.reset(OpMIPS64LoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(y, mem) + return true + } + return false +} func rewriteValueMIPS64_OpMIPS64MOVBUload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] @@ -6364,60 +6451,6 @@ func rewriteValueMIPS64_OpOffPtr(v *Value) bool { return true } } -func rewriteValueMIPS64_OpPanicBounds(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicBoundsA [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 0) { - break - } - v.reset(OpMIPS64LoweredPanicBoundsA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicBoundsB [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 1) { - break - } - v.reset(OpMIPS64LoweredPanicBoundsB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicBoundsC [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 2) { - break - } - v.reset(OpMIPS64LoweredPanicBoundsC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - return false -} func rewriteValueMIPS64_OpRotateLeft16(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] diff --git a/src/cmd/compile/internal/ssa/rewriteRISCV64.go b/src/cmd/compile/internal/ssa/rewriteRISCV64.go index 95c6489a51..bbdb817900 100644 --- a/src/cmd/compile/internal/ssa/rewriteRISCV64.go +++ b/src/cmd/compile/internal/ssa/rewriteRISCV64.go @@ -486,7 +486,8 @@ func rewriteValueRISCV64(v *Value) bool { v.Op = OpRISCV64OR return true case OpPanicBounds: - return rewriteValueRISCV64_OpPanicBounds(v) + v.Op = OpRISCV64LoweredPanicBoundsRR + return true case OpPopCount16: return rewriteValueRISCV64_OpPopCount16(v) case OpPopCount32: @@ -532,6 +533,12 @@ func rewriteValueRISCV64(v *Value) bool { return rewriteValueRISCV64_OpRISCV64FSUBD(v) case OpRISCV64FSUBS: return rewriteValueRISCV64_OpRISCV64FSUBS(v) + case OpRISCV64LoweredPanicBoundsCR: + return rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsCR(v) + case OpRISCV64LoweredPanicBoundsRC: + return rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsRC(v) + case OpRISCV64LoweredPanicBoundsRR: + return rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsRR(v) case OpRISCV64MOVBUload: return rewriteValueRISCV64_OpRISCV64MOVBUload(v) case OpRISCV64MOVBUreg: @@ -3416,60 +3423,6 @@ func rewriteValueRISCV64_OpOffPtr(v *Value) bool { return true } } -func rewriteValueRISCV64_OpPanicBounds(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicBoundsA [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 0) { - break - } - v.reset(OpRISCV64LoweredPanicBoundsA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicBoundsB [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 1) { - break - } - v.reset(OpRISCV64LoweredPanicBoundsB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicBoundsC [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 2) { - break - } - v.reset(OpRISCV64LoweredPanicBoundsC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - return false -} func rewriteValueRISCV64_OpPopCount16(v *Value) bool { v_0 := v.Args[0] b := v.Block @@ -4239,6 +4192,86 @@ func rewriteValueRISCV64_OpRISCV64FSUBS(v *Value) bool { } return false } +func rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsCR(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpRISCV64MOVDconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpRISCV64LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsRC(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpRISCV64MOVDconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpRISCV64LoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsRR(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem) + // result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + x := v_0 + if v_1.Op != OpRISCV64MOVDconst { + break + } + c := auxIntToInt64(v_1.AuxInt) + mem := v_2 + v.reset(OpRISCV64LoweredPanicBoundsRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(x, mem) + return true + } + // match: (LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != OpRISCV64MOVDconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + y := v_1 + mem := v_2 + v.reset(OpRISCV64LoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(y, mem) + return true + } + return false +} func rewriteValueRISCV64_OpRISCV64MOVBUload(v *Value) bool { v_1 := v.Args[1] v_0 := v.Args[0] diff --git a/src/cmd/compile/internal/ssa/rewriteS390X.go b/src/cmd/compile/internal/ssa/rewriteS390X.go index 2e7492501a..07dbe7bf7a 100644 --- a/src/cmd/compile/internal/ssa/rewriteS390X.go +++ b/src/cmd/compile/internal/ssa/rewriteS390X.go @@ -368,6 +368,18 @@ func rewriteValueS390X(v *Value) bool { return rewriteValueS390X_OpLsh8x64(v) case OpLsh8x8: return rewriteValueS390X_OpLsh8x8(v) + case OpMax32F: + v.Op = OpS390XWFMAXSB + return true + case OpMax64F: + v.Op = OpS390XWFMAXDB + return true + case OpMin32F: + v.Op = OpS390XWFMINSB + return true + case OpMin64F: + v.Op = OpS390XWFMINDB + return true case OpMod16: return rewriteValueS390X_OpMod16(v) case OpMod16u: @@ -465,7 +477,8 @@ func rewriteValueS390X(v *Value) bool { v.Op = OpS390XORW return true case OpPanicBounds: - return rewriteValueS390X_OpPanicBounds(v) + v.Op = OpS390XLoweredPanicBoundsRR + return true case OpPopCount16: return rewriteValueS390X_OpPopCount16(v) case OpPopCount32: @@ -632,6 +645,12 @@ func rewriteValueS390X(v *Value) bool { return rewriteValueS390X_OpS390XLTDBR(v) case OpS390XLTEBR: return rewriteValueS390X_OpS390XLTEBR(v) + case OpS390XLoweredPanicBoundsCR: + return rewriteValueS390X_OpS390XLoweredPanicBoundsCR(v) + case OpS390XLoweredPanicBoundsRC: + return rewriteValueS390X_OpS390XLoweredPanicBoundsRC(v) + case OpS390XLoweredPanicBoundsRR: + return rewriteValueS390X_OpS390XLoweredPanicBoundsRR(v) case OpS390XLoweredRound32F: return rewriteValueS390X_OpS390XLoweredRound32F(v) case OpS390XLoweredRound64F: @@ -3959,60 +3978,6 @@ func rewriteValueS390X_OpOffPtr(v *Value) bool { return true } } -func rewriteValueS390X_OpPanicBounds(v *Value) bool { - v_2 := v.Args[2] - v_1 := v.Args[1] - v_0 := v.Args[0] - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 0 - // result: (LoweredPanicBoundsA [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 0) { - break - } - v.reset(OpS390XLoweredPanicBoundsA) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 1 - // result: (LoweredPanicBoundsB [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 1) { - break - } - v.reset(OpS390XLoweredPanicBoundsB) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - // match: (PanicBounds [kind] x y mem) - // cond: boundsABI(kind) == 2 - // result: (LoweredPanicBoundsC [kind] x y mem) - for { - kind := auxIntToInt64(v.AuxInt) - x := v_0 - y := v_1 - mem := v_2 - if !(boundsABI(kind) == 2) { - break - } - v.reset(OpS390XLoweredPanicBoundsC) - v.AuxInt = int64ToAuxInt(kind) - v.AddArg3(x, y, mem) - return true - } - return false -} func rewriteValueS390X_OpPopCount16(v *Value) bool { v_0 := v.Args[0] b := v.Block @@ -8135,6 +8100,86 @@ func rewriteValueS390X_OpS390XLTEBR(v *Value) bool { } return false } +func rewriteValueS390X_OpS390XLoweredPanicBoundsCR(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpS390XMOVDconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpS390XLoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueS390X_OpS390XLoweredPanicBoundsRC(v *Value) bool { + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem) + // result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + p := auxToPanicBoundsC(v.Aux) + if v_0.Op != OpS390XMOVDconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + mem := v_1 + v.reset(OpS390XLoweredPanicBoundsCC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C}) + v.AddArg(mem) + return true + } + return false +} +func rewriteValueS390X_OpS390XLoweredPanicBoundsRR(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + // match: (LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem) + // result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem) + for { + kind := auxIntToInt64(v.AuxInt) + x := v_0 + if v_1.Op != OpS390XMOVDconst { + break + } + c := auxIntToInt64(v_1.AuxInt) + mem := v_2 + v.reset(OpS390XLoweredPanicBoundsRC) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(x, mem) + return true + } + // match: (LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem) + // result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem) + for { + kind := auxIntToInt64(v.AuxInt) + if v_0.Op != OpS390XMOVDconst { + break + } + c := auxIntToInt64(v_0.AuxInt) + y := v_1 + mem := v_2 + v.reset(OpS390XLoweredPanicBoundsCR) + v.AuxInt = int64ToAuxInt(kind) + v.Aux = panicBoundsCToAux(PanicBoundsC{C: c}) + v.AddArg2(y, mem) + return true + } + return false +} func rewriteValueS390X_OpS390XLoweredRound32F(v *Value) bool { v_0 := v.Args[0] // match: (LoweredRound32F x:(FMOVSconst)) diff --git a/src/cmd/compile/internal/ssa/rewritegeneric.go b/src/cmd/compile/internal/ssa/rewritegeneric.go index b7a4ff95d1..fe61ceaff2 100644 --- a/src/cmd/compile/internal/ssa/rewritegeneric.go +++ b/src/cmd/compile/internal/ssa/rewritegeneric.go @@ -56,6 +56,8 @@ func rewriteValuegeneric(v *Value) bool { return rewriteValuegeneric_OpCom64(v) case OpCom8: return rewriteValuegeneric_OpCom8(v) + case OpCondSelect: + return rewriteValuegeneric_OpCondSelect(v) case OpConstInterface: return rewriteValuegeneric_OpConstInterface(v) case OpConstSlice: @@ -5694,6 +5696,504 @@ func rewriteValuegeneric_OpCom8(v *Value) bool { } return false } +func rewriteValuegeneric_OpCondSelect(v *Value) bool { + v_2 := v.Args[2] + v_1 := v.Args[1] + v_0 := v.Args[0] + b := v.Block + config := b.Func.Config + // match: (CondSelect x _ (ConstBool [true ])) + // result: x + for { + x := v_0 + if v_2.Op != OpConstBool || auxIntToBool(v_2.AuxInt) != true { + break + } + v.copyOf(x) + return true + } + // match: (CondSelect _ y (ConstBool [false])) + // result: y + for { + y := v_1 + if v_2.Op != OpConstBool || auxIntToBool(v_2.AuxInt) != false { + break + } + v.copyOf(y) + return true + } + // match: (CondSelect x x _) + // result: x + for { + x := v_0 + if x != v_1 { + break + } + v.copyOf(x) + return true + } + // match: (CondSelect (Add8 <t> x (Const8 [1])) x bool) + // cond: config.arch != "arm64" + // result: (Add8 x (CvtBoolToUint8 <t> bool)) + for { + if v_0.Op != OpAdd8 { + break + } + t := v_0.Type + _ = v_0.Args[1] + v_0_0 := v_0.Args[0] + v_0_1 := v_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { + x := v_0_0 + if v_0_1.Op != OpConst8 || auxIntToInt8(v_0_1.AuxInt) != 1 || x != v_1 { + continue + } + bool := v_2 + if !(config.arch != "arm64") { + continue + } + v.reset(OpAdd8) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, t) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + break + } + // match: (CondSelect (Add64 <t> x (Const64 [1])) x bool) + // cond: config.arch != "arm64" + // result: (Add64 x (ZeroExt8to64 <t> (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))) + for { + if v_0.Op != OpAdd64 { + break + } + t := v_0.Type + _ = v_0.Args[1] + v_0_0 := v_0.Args[0] + v_0_1 := v_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { + x := v_0_0 + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + continue + } + bool := v_2 + if !(config.arch != "arm64") { + continue + } + v.reset(OpAdd64) + v0 := b.NewValue0(v.Pos, OpZeroExt8to64, t) + v1 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v1.AddArg(bool) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } + break + } + // match: (CondSelect (Add32 <t> x (Const32 [1])) x bool) + // cond: config.arch != "arm64" + // result: (Add32 x (ZeroExt8to32 <t> (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))) + for { + if v_0.Op != OpAdd32 { + break + } + t := v_0.Type + _ = v_0.Args[1] + v_0_0 := v_0.Args[0] + v_0_1 := v_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { + x := v_0_0 + if v_0_1.Op != OpConst32 || auxIntToInt32(v_0_1.AuxInt) != 1 || x != v_1 { + continue + } + bool := v_2 + if !(config.arch != "arm64") { + continue + } + v.reset(OpAdd32) + v0 := b.NewValue0(v.Pos, OpZeroExt8to32, t) + v1 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v1.AddArg(bool) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } + break + } + // match: (CondSelect (Add16 <t> x (Const16 [1])) x bool) + // cond: config.arch != "arm64" + // result: (Add16 x (ZeroExt8to16 <t> (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))) + for { + if v_0.Op != OpAdd16 { + break + } + t := v_0.Type + _ = v_0.Args[1] + v_0_0 := v_0.Args[0] + v_0_1 := v_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { + x := v_0_0 + if v_0_1.Op != OpConst16 || auxIntToInt16(v_0_1.AuxInt) != 1 || x != v_1 { + continue + } + bool := v_2 + if !(config.arch != "arm64") { + continue + } + v.reset(OpAdd16) + v0 := b.NewValue0(v.Pos, OpZeroExt8to16, t) + v1 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v1.AddArg(bool) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } + break + } + // match: (CondSelect (Add8 <t> x (Const8 [-1])) x bool) + // result: (Sub8 x (CvtBoolToUint8 <t> bool)) + for { + if v_0.Op != OpAdd8 { + break + } + t := v_0.Type + _ = v_0.Args[1] + v_0_0 := v_0.Args[0] + v_0_1 := v_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { + x := v_0_0 + if v_0_1.Op != OpConst8 || auxIntToInt8(v_0_1.AuxInt) != -1 || x != v_1 { + continue + } + bool := v_2 + v.reset(OpSub8) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, t) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + break + } + // match: (CondSelect (Add64 <t> x (Const64 [-1])) x bool) + // result: (Sub64 x (ZeroExt8to64 <t> (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))) + for { + if v_0.Op != OpAdd64 { + break + } + t := v_0.Type + _ = v_0.Args[1] + v_0_0 := v_0.Args[0] + v_0_1 := v_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { + x := v_0_0 + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != -1 || x != v_1 { + continue + } + bool := v_2 + v.reset(OpSub64) + v0 := b.NewValue0(v.Pos, OpZeroExt8to64, t) + v1 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v1.AddArg(bool) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } + break + } + // match: (CondSelect (Add32 <t> x (Const32 [-1])) x bool) + // result: (Sub32 x (ZeroExt8to32 <t> (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))) + for { + if v_0.Op != OpAdd32 { + break + } + t := v_0.Type + _ = v_0.Args[1] + v_0_0 := v_0.Args[0] + v_0_1 := v_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { + x := v_0_0 + if v_0_1.Op != OpConst32 || auxIntToInt32(v_0_1.AuxInt) != -1 || x != v_1 { + continue + } + bool := v_2 + v.reset(OpSub32) + v0 := b.NewValue0(v.Pos, OpZeroExt8to32, t) + v1 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v1.AddArg(bool) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } + break + } + // match: (CondSelect (Add16 <t> x (Const16 [-1])) x bool) + // result: (Sub16 x (ZeroExt8to16 <t> (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))) + for { + if v_0.Op != OpAdd16 { + break + } + t := v_0.Type + _ = v_0.Args[1] + v_0_0 := v_0.Args[0] + v_0_1 := v_0.Args[1] + for _i0 := 0; _i0 <= 1; _i0, v_0_0, v_0_1 = _i0+1, v_0_1, v_0_0 { + x := v_0_0 + if v_0_1.Op != OpConst16 || auxIntToInt16(v_0_1.AuxInt) != -1 || x != v_1 { + continue + } + bool := v_2 + v.reset(OpSub16) + v0 := b.NewValue0(v.Pos, OpZeroExt8to16, t) + v1 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v1.AddArg(bool) + v0.AddArg(v1) + v.AddArg2(x, v0) + return true + } + break + } + // match: (CondSelect (Lsh64x64 x (Const64 [1])) x bool) + // result: (Lsh64x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpLsh64x64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpLsh64x8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Lsh32x64 x (Const64 [1])) x bool) + // result: (Lsh32x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpLsh32x64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpLsh32x8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Lsh16x64 x (Const64 [1])) x bool) + // result: (Lsh16x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpLsh16x64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpLsh16x8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Lsh8x64 x (Const64 [1])) x bool) + // result: (Lsh8x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpLsh8x64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpLsh8x8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Rsh64x64 x (Const64 [1])) x bool) + // result: (Rsh64x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpRsh64x64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpRsh64x8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Rsh32x64 x (Const64 [1])) x bool) + // result: (Rsh32x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpRsh32x64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpRsh32x8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Rsh16x64 x (Const64 [1])) x bool) + // result: (Rsh16x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpRsh16x64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpRsh16x8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Rsh8x64 x (Const64 [1])) x bool) + // result: (Rsh8x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpRsh8x64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpRsh8x8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Rsh64Ux64 x (Const64 [1])) x bool) + // result: (Rsh64Ux8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpRsh64Ux64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpRsh64Ux8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Rsh32Ux64 x (Const64 [1])) x bool) + // result: (Rsh32Ux8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpRsh32Ux64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpRsh32Ux8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Rsh16Ux64 x (Const64 [1])) x bool) + // result: (Rsh16Ux8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpRsh16Ux64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpRsh16Ux8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + // match: (CondSelect (Rsh8Ux64 x (Const64 [1])) x bool) + // result: (Rsh8Ux8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)) + for { + if v_0.Op != OpRsh8Ux64 { + break + } + _ = v_0.Args[1] + x := v_0.Args[0] + v_0_1 := v_0.Args[1] + if v_0_1.Op != OpConst64 || auxIntToInt64(v_0_1.AuxInt) != 1 || x != v_1 { + break + } + bool := v_2 + v.reset(OpRsh8Ux8) + v.AuxInt = boolToAuxInt(true) + v0 := b.NewValue0(v.Pos, OpCvtBoolToUint8, types.Types[types.TUINT8]) + v0.AddArg(bool) + v.AddArg2(x, v0) + return true + } + return false +} func rewriteValuegeneric_OpConstInterface(v *Value) bool { b := v.Block typ := &b.Func.Config.Types @@ -6490,20 +6990,20 @@ func rewriteValuegeneric_OpDiv16u(v *Value) bool { return true } // match: (Div16u n (Const16 [c])) - // cond: isPowerOfTwo(c) - // result: (Rsh16Ux64 n (Const64 <typ.UInt64> [log16(c)])) + // cond: isUnsignedPowerOfTwo(uint16(c)) + // result: (Rsh16Ux64 n (Const64 <typ.UInt64> [log16u(uint16(c))])) for { n := v_0 if v_1.Op != OpConst16 { break } c := auxIntToInt16(v_1.AuxInt) - if !(isPowerOfTwo(c)) { + if !(isUnsignedPowerOfTwo(uint16(c))) { break } v.reset(OpRsh16Ux64) v0 := b.NewValue0(v.Pos, OpConst64, typ.UInt64) - v0.AuxInt = int64ToAuxInt(log16(c)) + v0.AuxInt = int64ToAuxInt(log16u(uint16(c))) v.AddArg2(n, v0) return true } @@ -6900,20 +7400,20 @@ func rewriteValuegeneric_OpDiv32u(v *Value) bool { return true } // match: (Div32u n (Const32 [c])) - // cond: isPowerOfTwo(c) - // result: (Rsh32Ux64 n (Const64 <typ.UInt64> [log32(c)])) + // cond: isUnsignedPowerOfTwo(uint32(c)) + // result: (Rsh32Ux64 n (Const64 <typ.UInt64> [log32u(uint32(c))])) for { n := v_0 if v_1.Op != OpConst32 { break } c := auxIntToInt32(v_1.AuxInt) - if !(isPowerOfTwo(c)) { + if !(isUnsignedPowerOfTwo(uint32(c))) { break } v.reset(OpRsh32Ux64) v0 := b.NewValue0(v.Pos, OpConst64, typ.UInt64) - v0.AuxInt = int64ToAuxInt(log32(c)) + v0.AuxInt = int64ToAuxInt(log32u(uint32(c))) v.AddArg2(n, v0) return true } @@ -7339,33 +7839,20 @@ func rewriteValuegeneric_OpDiv64u(v *Value) bool { return true } // match: (Div64u n (Const64 [c])) - // cond: isPowerOfTwo(c) - // result: (Rsh64Ux64 n (Const64 <typ.UInt64> [log64(c)])) + // cond: isUnsignedPowerOfTwo(uint64(c)) + // result: (Rsh64Ux64 n (Const64 <typ.UInt64> [log64u(uint64(c))])) for { n := v_0 if v_1.Op != OpConst64 { break } c := auxIntToInt64(v_1.AuxInt) - if !(isPowerOfTwo(c)) { - break - } - v.reset(OpRsh64Ux64) - v0 := b.NewValue0(v.Pos, OpConst64, typ.UInt64) - v0.AuxInt = int64ToAuxInt(log64(c)) - v.AddArg2(n, v0) - return true - } - // match: (Div64u n (Const64 [-1<<63])) - // result: (Rsh64Ux64 n (Const64 <typ.UInt64> [63])) - for { - n := v_0 - if v_1.Op != OpConst64 || auxIntToInt64(v_1.AuxInt) != -1<<63 { + if !(isUnsignedPowerOfTwo(uint64(c))) { break } v.reset(OpRsh64Ux64) v0 := b.NewValue0(v.Pos, OpConst64, typ.UInt64) - v0.AuxInt = int64ToAuxInt(63) + v0.AuxInt = int64ToAuxInt(log64u(uint64(c))) v.AddArg2(n, v0) return true } @@ -7675,20 +8162,20 @@ func rewriteValuegeneric_OpDiv8u(v *Value) bool { return true } // match: (Div8u n (Const8 [c])) - // cond: isPowerOfTwo(c) - // result: (Rsh8Ux64 n (Const64 <typ.UInt64> [log8(c)])) + // cond: isUnsignedPowerOfTwo(uint8(c)) + // result: (Rsh8Ux64 n (Const64 <typ.UInt64> [log8u(uint8(c))])) for { n := v_0 if v_1.Op != OpConst8 { break } c := auxIntToInt8(v_1.AuxInt) - if !(isPowerOfTwo(c)) { + if !(isUnsignedPowerOfTwo(uint8(c))) { break } v.reset(OpRsh8Ux64) v0 := b.NewValue0(v.Pos, OpConst64, typ.UInt64) - v0.AuxInt = int64ToAuxInt(log8(c)) + v0.AuxInt = int64ToAuxInt(log8u(uint8(c))) v.AddArg2(n, v0) return true } @@ -16419,7 +16906,7 @@ func rewriteValuegeneric_OpMod16u(v *Value) bool { return true } // match: (Mod16u <t> n (Const16 [c])) - // cond: isPowerOfTwo(c) + // cond: isUnsignedPowerOfTwo(uint16(c)) // result: (And16 n (Const16 <t> [c-1])) for { t := v.Type @@ -16428,7 +16915,7 @@ func rewriteValuegeneric_OpMod16u(v *Value) bool { break } c := auxIntToInt16(v_1.AuxInt) - if !(isPowerOfTwo(c)) { + if !(isUnsignedPowerOfTwo(uint16(c))) { break } v.reset(OpAnd16) @@ -16573,7 +17060,7 @@ func rewriteValuegeneric_OpMod32u(v *Value) bool { return true } // match: (Mod32u <t> n (Const32 [c])) - // cond: isPowerOfTwo(c) + // cond: isUnsignedPowerOfTwo(uint32(c)) // result: (And32 n (Const32 <t> [c-1])) for { t := v.Type @@ -16582,7 +17069,7 @@ func rewriteValuegeneric_OpMod32u(v *Value) bool { break } c := auxIntToInt32(v_1.AuxInt) - if !(isPowerOfTwo(c)) { + if !(isUnsignedPowerOfTwo(uint32(c))) { break } v.reset(OpAnd32) @@ -16738,7 +17225,7 @@ func rewriteValuegeneric_OpMod64u(v *Value) bool { return true } // match: (Mod64u <t> n (Const64 [c])) - // cond: isPowerOfTwo(c) + // cond: isUnsignedPowerOfTwo(uint64(c)) // result: (And64 n (Const64 <t> [c-1])) for { t := v.Type @@ -16747,7 +17234,7 @@ func rewriteValuegeneric_OpMod64u(v *Value) bool { break } c := auxIntToInt64(v_1.AuxInt) - if !(isPowerOfTwo(c)) { + if !(isUnsignedPowerOfTwo(uint64(c))) { break } v.reset(OpAnd64) @@ -16756,20 +17243,6 @@ func rewriteValuegeneric_OpMod64u(v *Value) bool { v.AddArg2(n, v0) return true } - // match: (Mod64u <t> n (Const64 [-1<<63])) - // result: (And64 n (Const64 <t> [1<<63-1])) - for { - t := v.Type - n := v_0 - if v_1.Op != OpConst64 || auxIntToInt64(v_1.AuxInt) != -1<<63 { - break - } - v.reset(OpAnd64) - v0 := b.NewValue0(v.Pos, OpConst64, t) - v0.AuxInt = int64ToAuxInt(1<<63 - 1) - v.AddArg2(n, v0) - return true - } // match: (Mod64u <t> x (Const64 [c])) // cond: x.Op != OpConst64 && c > 0 && umagicOK64(c) // result: (Sub64 x (Mul64 <t> (Div64u <t> x (Const64 <t> [c])) (Const64 <t> [c]))) @@ -16906,7 +17379,7 @@ func rewriteValuegeneric_OpMod8u(v *Value) bool { return true } // match: (Mod8u <t> n (Const8 [c])) - // cond: isPowerOfTwo(c) + // cond: isUnsignedPowerOfTwo(uint8(c)) // result: (And8 n (Const8 <t> [c-1])) for { t := v.Type @@ -16915,7 +17388,7 @@ func rewriteValuegeneric_OpMod8u(v *Value) bool { break } c := auxIntToInt8(v_1.AuxInt) - if !(isPowerOfTwo(c)) { + if !(isUnsignedPowerOfTwo(uint8(c))) { break } v.reset(OpAnd8) @@ -29386,34 +29859,15 @@ func rewriteValuegeneric_OpSelectN(v *Value) bool { b := v.Block config := b.Func.Config typ := &b.Func.Config.Types - // match: (SelectN [0] (MakeResult x ___)) - // result: x + // match: (SelectN [n] m:(MakeResult ___)) + // result: m.Args[n] for { - if auxIntToInt64(v.AuxInt) != 0 || v_0.Op != OpMakeResult || len(v_0.Args) < 1 { - break - } - x := v_0.Args[0] - v.copyOf(x) - return true - } - // match: (SelectN [1] (MakeResult x y ___)) - // result: y - for { - if auxIntToInt64(v.AuxInt) != 1 || v_0.Op != OpMakeResult || len(v_0.Args) < 2 { - break - } - y := v_0.Args[1] - v.copyOf(y) - return true - } - // match: (SelectN [2] (MakeResult x y z ___)) - // result: z - for { - if auxIntToInt64(v.AuxInt) != 2 || v_0.Op != OpMakeResult || len(v_0.Args) < 3 { + n := auxIntToInt64(v.AuxInt) + m := v_0 + if m.Op != OpMakeResult { break } - z := v_0.Args[2] - v.copyOf(z) + v.copyOf(m.Args[n]) return true } // match: (SelectN [0] call:(StaticCall {sym} sptr (Const64 [c]) mem)) diff --git a/src/cmd/compile/internal/ssa/sparsemap.go b/src/cmd/compile/internal/ssa/sparsemap.go index 9443c8b4b4..255a346d37 100644 --- a/src/cmd/compile/internal/ssa/sparsemap.go +++ b/src/cmd/compile/internal/ssa/sparsemap.go @@ -7,70 +7,60 @@ package ssa // from https://research.swtch.com/sparse // in turn, from Briggs and Torczon -type sparseEntry struct { - key ID - val int32 +// sparseKey needs to be something we can index a slice with. +type sparseKey interface{ ~int | ~int32 } + +type sparseEntry[K sparseKey, V any] struct { + key K + val V } -type sparseMap struct { - dense []sparseEntry +type genericSparseMap[K sparseKey, V any] struct { + dense []sparseEntry[K, V] sparse []int32 } -// newSparseMap returns a sparseMap that can map -// integers between 0 and n-1 to int32s. -func newSparseMap(n int) *sparseMap { - return &sparseMap{dense: nil, sparse: make([]int32, n)} +// newGenericSparseMap returns a sparseMap that can map +// integers between 0 and n-1 to a value type. +func newGenericSparseMap[K sparseKey, V any](n int) *genericSparseMap[K, V] { + return &genericSparseMap[K, V]{dense: nil, sparse: make([]int32, n)} } -func (s *sparseMap) cap() int { +func (s *genericSparseMap[K, V]) cap() int { return len(s.sparse) } -func (s *sparseMap) size() int { +func (s *genericSparseMap[K, V]) size() int { return len(s.dense) } -func (s *sparseMap) contains(k ID) bool { +func (s *genericSparseMap[K, V]) contains(k K) bool { i := s.sparse[k] return i < int32(len(s.dense)) && s.dense[i].key == k } -// get returns the value for key k, or -1 if k does -// not appear in the map. -func (s *sparseMap) get(k ID) int32 { +// get returns the value for key k, or the zero V +// if k does not appear in the map. +func (s *genericSparseMap[K, V]) get(k K) (V, bool) { i := s.sparse[k] if i < int32(len(s.dense)) && s.dense[i].key == k { - return s.dense[i].val + return s.dense[i].val, true } - return -1 + var v V + return v, false } -func (s *sparseMap) set(k ID, v int32) { +func (s *genericSparseMap[K, V]) set(k K, v V) { i := s.sparse[k] if i < int32(len(s.dense)) && s.dense[i].key == k { s.dense[i].val = v return } - s.dense = append(s.dense, sparseEntry{k, v}) - s.sparse[k] = int32(len(s.dense)) - 1 -} - -// setBit sets the v'th bit of k's value, where 0 <= v < 32 -func (s *sparseMap) setBit(k ID, v uint) { - if v >= 32 { - panic("bit index too large.") - } - i := s.sparse[k] - if i < int32(len(s.dense)) && s.dense[i].key == k { - s.dense[i].val |= 1 << v - return - } - s.dense = append(s.dense, sparseEntry{k, 1 << v}) + s.dense = append(s.dense, sparseEntry[K, V]{k, v}) s.sparse[k] = int32(len(s.dense)) - 1 } -func (s *sparseMap) remove(k ID) { +func (s *genericSparseMap[K, V]) remove(k K) { i := s.sparse[k] if i < int32(len(s.dense)) && s.dense[i].key == k { y := s.dense[len(s.dense)-1] @@ -80,10 +70,18 @@ func (s *sparseMap) remove(k ID) { } } -func (s *sparseMap) clear() { +func (s *genericSparseMap[K, V]) clear() { s.dense = s.dense[:0] } -func (s *sparseMap) contents() []sparseEntry { +func (s *genericSparseMap[K, V]) contents() []sparseEntry[K, V] { return s.dense } + +type sparseMap = genericSparseMap[ID, int32] + +// newSparseMap returns a sparseMap that can map +// integers between 0 and n-1 to int32s. +func newSparseMap(n int) *sparseMap { + return newGenericSparseMap[ID, int32](n) +} diff --git a/src/cmd/compile/internal/ssa/testdata/i74576a.go b/src/cmd/compile/internal/ssa/testdata/i74576a.go new file mode 100644 index 0000000000..40bb7b6069 --- /dev/null +++ b/src/cmd/compile/internal/ssa/testdata/i74576a.go @@ -0,0 +1,17 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package main + +import ( + "runtime" +) + +func main() { + a := 1 + runtime.Breakpoint() + sink = a +} + +var sink any diff --git a/src/cmd/compile/internal/ssa/testdata/i74576b.go b/src/cmd/compile/internal/ssa/testdata/i74576b.go new file mode 100644 index 0000000000..fa89063299 --- /dev/null +++ b/src/cmd/compile/internal/ssa/testdata/i74576b.go @@ -0,0 +1,15 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package main + +import ( + "runtime" +) + +func main() { + a := 1 + runtime.Breakpoint() + _ = make([]int, a) +} diff --git a/src/cmd/compile/internal/ssa/testdata/i74576c.go b/src/cmd/compile/internal/ssa/testdata/i74576c.go new file mode 100644 index 0000000000..92cacaf0d7 --- /dev/null +++ b/src/cmd/compile/internal/ssa/testdata/i74576c.go @@ -0,0 +1,19 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package main + +import ( + "runtime" +) + +func main() { + s := S{1, 1} + runtime.Breakpoint() + sink = s +} + +type S struct{ a, b uint64 } + +var sink any diff --git a/src/cmd/compile/internal/ssa/tighten.go b/src/cmd/compile/internal/ssa/tighten.go index eb5007b26e..48efdb5609 100644 --- a/src/cmd/compile/internal/ssa/tighten.go +++ b/src/cmd/compile/internal/ssa/tighten.go @@ -82,7 +82,6 @@ func tighten(f *Func) { // We use this to make sure we don't tighten a value into a (deeper) loop. idom := f.Idom() loops := f.loopnest() - loops.calculateDepths() changed := true for changed { diff --git a/src/cmd/compile/internal/ssa/xposmap.go b/src/cmd/compile/internal/ssa/xposmap.go index 93582e1373..382f916571 100644 --- a/src/cmd/compile/internal/ssa/xposmap.go +++ b/src/cmd/compile/internal/ssa/xposmap.go @@ -69,10 +69,10 @@ func (m *xposmap) set(p src.XPos, v int32) { } // get returns the int32 associated with the file index and line of p. -func (m *xposmap) get(p src.XPos) int32 { +func (m *xposmap) get(p src.XPos) (int32, bool) { s := m.mapFor(p.FileIndex()) if s == nil { - return -1 + return 0, false } return s.get(p.Line()) } diff --git a/src/cmd/compile/internal/ssagen/arch.go b/src/cmd/compile/internal/ssagen/arch.go index 483e45cad4..ef5d8f59d7 100644 --- a/src/cmd/compile/internal/ssagen/arch.go +++ b/src/cmd/compile/internal/ssagen/arch.go @@ -25,8 +25,13 @@ type ArchInfo struct { PadFrame func(int64) int64 - // ZeroRange zeroes a range of memory on stack. It is only inserted - // at function entry, and it is ok to clobber registers. + // ZeroRange zeroes a range of memory the on stack. + // - it is only called at function entry + // - it is ok to clobber (non-arg) registers. + // - currently used only for small things, so it can be simple. + // - pointers to heap-allocated return values + // - open-coded deferred functions + // (Max size in make.bash is 40 bytes.) ZeroRange func(*objw.Progs, *obj.Prog, int64, int64, *uint32) *obj.Prog Ginsnop func(*objw.Progs) *obj.Prog diff --git a/src/cmd/compile/internal/ssagen/intrinsics.go b/src/cmd/compile/internal/ssagen/intrinsics.go index d7b25f2ab1..eae754da4e 100644 --- a/src/cmd/compile/internal/ssagen/intrinsics.go +++ b/src/cmd/compile/internal/ssagen/intrinsics.go @@ -1509,7 +1509,7 @@ func initIntrinsics(cfg *intrinsicBuildConfig) { // No PSIGNB, simply do byte equality with ctrlEmpty. // Load ctrlEmpty into each byte of a control word. - var ctrlsEmpty uint64 = abi.SwissMapCtrlEmpty + var ctrlsEmpty uint64 = abi.MapCtrlEmpty e := s.constInt64(types.Types[types.TUINT64], int64(ctrlsEmpty)) // Explicit copy to fp register. See // https://go.dev/issue/70451. diff --git a/src/cmd/compile/internal/ssagen/ssa.go b/src/cmd/compile/internal/ssagen/ssa.go index 3b406c0d6f..221f979996 100644 --- a/src/cmd/compile/internal/ssagen/ssa.go +++ b/src/cmd/compile/internal/ssagen/ssa.go @@ -94,12 +94,8 @@ func InitConfig() { _ = types.NewPtr(types.Types[types.TINT16]) // *int16 _ = types.NewPtr(types.Types[types.TINT64]) // *int64 _ = types.NewPtr(types.ErrorType) // *error - if buildcfg.Experiment.SwissMap { - _ = types.NewPtr(reflectdata.SwissMapType()) // *internal/runtime/maps.Map - } else { - _ = types.NewPtr(reflectdata.OldMapType()) // *runtime.hmap - } - _ = types.NewPtr(deferstruct()) // *runtime._defer + _ = types.NewPtr(reflectdata.MapType()) // *internal/runtime/maps.Map + _ = types.NewPtr(deferstruct()) // *runtime._defer types.NewPtrCacheEnabled = false ssaConfig = ssa.NewConfig(base.Ctxt.Arch.Name, *types_, base.Ctxt, base.Flag.N == 0, Arch.SoftFloat) ssaConfig.Race = base.Flag.Race @@ -137,6 +133,8 @@ func InitConfig() { ir.Syms.Asanwrite = typecheck.LookupRuntimeFunc("asanwrite") ir.Syms.Newobject = typecheck.LookupRuntimeFunc("newobject") ir.Syms.Newproc = typecheck.LookupRuntimeFunc("newproc") + ir.Syms.PanicBounds = typecheck.LookupRuntimeFunc("panicBounds") + ir.Syms.PanicExtend = typecheck.LookupRuntimeFunc("panicExtend") ir.Syms.Panicdivide = typecheck.LookupRuntimeFunc("panicdivide") ir.Syms.PanicdottypeE = typecheck.LookupRuntimeFunc("panicdottypeE") ir.Syms.PanicdottypeI = typecheck.LookupRuntimeFunc("panicdottypeI") @@ -3089,13 +3087,8 @@ func (s *state) exprCheckPtr(n ir.Node, checkPtrOK bool) *ssa.Value { return v } - // map <--> *hmap - var mt *types.Type - if buildcfg.Experiment.SwissMap { - mt = types.NewPtr(reflectdata.SwissMapType()) - } else { - mt = types.NewPtr(reflectdata.OldMapType()) - } + // map <--> *internal/runtime/maps.Map + mt := types.NewPtr(reflectdata.MapType()) if to.Kind() == types.TMAP && from == mt { return v } @@ -4001,7 +3994,7 @@ func (s *state) minMax(n *ir.CallExpr) *ssa.Value { if typ.IsFloat() { hasIntrinsic := false switch Arch.LinkArch.Family { - case sys.AMD64, sys.ARM64, sys.Loong64, sys.RISCV64: + case sys.AMD64, sys.ARM64, sys.Loong64, sys.RISCV64, sys.S390X: hasIntrinsic = true case sys.PPC64: hasIntrinsic = buildcfg.GOPPC64 >= 9 @@ -5767,13 +5760,13 @@ func (s *state) referenceTypeBuiltin(n *ir.UnaryExpr, x *ssa.Value) *ssa.Value { s.startBlock(bElse) switch n.Op() { case ir.OLEN: - if buildcfg.Experiment.SwissMap && n.X.Type().IsMap() { - // length is stored in the first word. - loadType := reflectdata.SwissMapType().Field(0).Type // uint64 + if n.X.Type().IsMap() { + // length is stored in the first word, but needs conversion to int. + loadType := reflectdata.MapType().Field(0).Type // uint64 load := s.load(loadType, x) s.vars[n] = s.conv(nil, load, loadType, lenType) // integer conversion doesn't need Node } else { - // length is stored in the first word for map/chan + // length is stored in the first word for chan, no conversion needed. s.vars[n] = s.load(lenType, x) } case ir.OCAP: @@ -6970,6 +6963,9 @@ func genssa(f *ssa.Func, pp *objw.Progs) { if base.Ctxt.Flag_locationlists { var debugInfo *ssa.FuncDebug debugInfo = e.curfn.DebugInfo.(*ssa.FuncDebug) + // Save off entry ID in case we need it later for DWARF generation + // for return values promoted to the heap. + debugInfo.EntryID = f.Entry.ID if e.curfn.ABI == obj.ABIInternal && base.Flag.N != 0 { ssa.BuildFuncDebugNoOptimized(base.Ctxt, f, base.Debug.LocationLists > 1, StackOffset, debugInfo) } else { diff --git a/src/cmd/compile/internal/test/inl_test.go b/src/cmd/compile/internal/test/inl_test.go index 091933e1e7..eda6084b48 100644 --- a/src/cmd/compile/internal/test/inl_test.go +++ b/src/cmd/compile/internal/test/inl_test.go @@ -6,7 +6,6 @@ package test import ( "bufio" - "internal/goexperiment" "internal/testenv" "io" "math/bits" @@ -47,7 +46,6 @@ func TestIntendedInlining(t *testing.T) { "getMCache", "heapSetTypeNoHeader", "heapSetTypeSmallHeader", - "isDirectIface", "itabHashFunc", "nextslicecap", "noescape", @@ -109,6 +107,7 @@ func TestIntendedInlining(t *testing.T) { "(*Buffer).tryGrowByReslice", }, "internal/abi": { + "(*Type).IsDirectIface", "UseInterfaceSwitchCache", }, "internal/runtime/math": { @@ -234,15 +233,6 @@ func TestIntendedInlining(t *testing.T) { }, } - if !goexperiment.SwissMap { - // Maps - want["runtime"] = append(want["runtime"], "bucketMask") - want["runtime"] = append(want["runtime"], "bucketShift") - want["runtime"] = append(want["runtime"], "evacuated") - want["runtime"] = append(want["runtime"], "tophash") - want["runtime"] = append(want["runtime"], "(*bmap).keys") - want["runtime"] = append(want["runtime"], "(*bmap).overflow") - } if runtime.GOARCH != "386" && runtime.GOARCH != "loong64" && runtime.GOARCH != "mips64" && runtime.GOARCH != "mips64le" && runtime.GOARCH != "riscv64" { // nextFreeFast calls sys.TrailingZeros64, which on 386 is implemented in asm and is not inlinable. // We currently don't have midstack inlining so nextFreeFast is also not inlinable on 386. diff --git a/src/cmd/compile/internal/test/mulconst_test.go b/src/cmd/compile/internal/test/mulconst_test.go index c4aed84432..1d1b351af1 100644 --- a/src/cmd/compile/internal/test/mulconst_test.go +++ b/src/cmd/compile/internal/test/mulconst_test.go @@ -143,7 +143,7 @@ func BenchmarkMulconstI32(b *testing.B) { } mulSinkI32 = x }) - // -120x = 8x - 120x + // -120x = 8x - 128x b.Run("-120", func(b *testing.B) { x := int32(1) for i := 0; i < b.N; i++ { @@ -202,7 +202,7 @@ func BenchmarkMulconstI64(b *testing.B) { } mulSinkI64 = x }) - // -120x = 8x - 120x + // -120x = 8x - 128x b.Run("-120", func(b *testing.B) { x := int64(1) for i := 0; i < b.N; i++ { diff --git a/src/cmd/compile/internal/typecheck/_builtin/runtime.go b/src/cmd/compile/internal/typecheck/_builtin/runtime.go index a1397b32b3..296bfdc281 100644 --- a/src/cmd/compile/internal/typecheck/_builtin/runtime.go +++ b/src/cmd/compile/internal/typecheck/_builtin/runtime.go @@ -25,7 +25,7 @@ func throwinit() func panicwrap() func gopanic(interface{}) -func gorecover(*int32) interface{} +func gorecover() interface{} func goschedguarded() // Note: these declarations are just for wasm port. @@ -152,14 +152,12 @@ func mapassign_fast32ptr(mapType *byte, hmap map[any]any, key unsafe.Pointer) (v func mapassign_fast64(mapType *byte, hmap map[any]any, key uint64) (val *any) func mapassign_fast64ptr(mapType *byte, hmap map[any]any, key unsafe.Pointer) (val *any) func mapassign_faststr(mapType *byte, hmap map[any]any, key string) (val *any) -func mapiterinit(mapType *byte, hmap map[any]any, hiter *any) // old maps -func mapIterStart(mapType *byte, hmap map[any]any, hiter *any) // swiss maps +func mapIterStart(mapType *byte, hmap map[any]any, hiter *any) func mapdelete(mapType *byte, hmap map[any]any, key *any) func mapdelete_fast32(mapType *byte, hmap map[any]any, key uint32) func mapdelete_fast64(mapType *byte, hmap map[any]any, key uint64) func mapdelete_faststr(mapType *byte, hmap map[any]any, key string) -func mapiternext(hiter *any) // old maps -func mapIterNext(hiter *any) // swiss maps +func mapIterNext(hiter *any) func mapclear(mapType *byte, hmap map[any]any) // *byte is really *runtime.Type diff --git a/src/cmd/compile/internal/typecheck/builtin.go b/src/cmd/compile/internal/typecheck/builtin.go index f3ab6766ec..535f0fb7e8 100644 --- a/src/cmd/compile/internal/typecheck/builtin.go +++ b/src/cmd/compile/internal/typecheck/builtin.go @@ -36,204 +36,202 @@ var runtimeDecls = [...]struct { {"throwinit", funcTag, 9}, {"panicwrap", funcTag, 9}, {"gopanic", funcTag, 11}, - {"gorecover", funcTag, 14}, + {"gorecover", funcTag, 12}, {"goschedguarded", funcTag, 9}, - {"goPanicIndex", funcTag, 16}, - {"goPanicIndexU", funcTag, 18}, - {"goPanicSliceAlen", funcTag, 16}, - {"goPanicSliceAlenU", funcTag, 18}, - {"goPanicSliceAcap", funcTag, 16}, - {"goPanicSliceAcapU", funcTag, 18}, - {"goPanicSliceB", funcTag, 16}, - {"goPanicSliceBU", funcTag, 18}, - {"goPanicSlice3Alen", funcTag, 16}, - {"goPanicSlice3AlenU", funcTag, 18}, - {"goPanicSlice3Acap", funcTag, 16}, - {"goPanicSlice3AcapU", funcTag, 18}, - {"goPanicSlice3B", funcTag, 16}, - {"goPanicSlice3BU", funcTag, 18}, - {"goPanicSlice3C", funcTag, 16}, - {"goPanicSlice3CU", funcTag, 18}, - {"goPanicSliceConvert", funcTag, 16}, - {"printbool", funcTag, 19}, - {"printfloat", funcTag, 21}, - {"printint", funcTag, 23}, - {"printhex", funcTag, 25}, - {"printuint", funcTag, 25}, - {"printcomplex", funcTag, 27}, - {"printstring", funcTag, 29}, - {"printpointer", funcTag, 30}, - {"printuintptr", funcTag, 31}, - {"printiface", funcTag, 30}, - {"printeface", funcTag, 30}, - {"printslice", funcTag, 30}, + {"goPanicIndex", funcTag, 14}, + {"goPanicIndexU", funcTag, 16}, + {"goPanicSliceAlen", funcTag, 14}, + {"goPanicSliceAlenU", funcTag, 16}, + {"goPanicSliceAcap", funcTag, 14}, + {"goPanicSliceAcapU", funcTag, 16}, + {"goPanicSliceB", funcTag, 14}, + {"goPanicSliceBU", funcTag, 16}, + {"goPanicSlice3Alen", funcTag, 14}, + {"goPanicSlice3AlenU", funcTag, 16}, + {"goPanicSlice3Acap", funcTag, 14}, + {"goPanicSlice3AcapU", funcTag, 16}, + {"goPanicSlice3B", funcTag, 14}, + {"goPanicSlice3BU", funcTag, 16}, + {"goPanicSlice3C", funcTag, 14}, + {"goPanicSlice3CU", funcTag, 16}, + {"goPanicSliceConvert", funcTag, 14}, + {"printbool", funcTag, 17}, + {"printfloat", funcTag, 19}, + {"printint", funcTag, 21}, + {"printhex", funcTag, 23}, + {"printuint", funcTag, 23}, + {"printcomplex", funcTag, 25}, + {"printstring", funcTag, 27}, + {"printpointer", funcTag, 28}, + {"printuintptr", funcTag, 29}, + {"printiface", funcTag, 28}, + {"printeface", funcTag, 28}, + {"printslice", funcTag, 28}, {"printnl", funcTag, 9}, {"printsp", funcTag, 9}, {"printlock", funcTag, 9}, {"printunlock", funcTag, 9}, - {"concatstring2", funcTag, 34}, - {"concatstring3", funcTag, 35}, - {"concatstring4", funcTag, 36}, - {"concatstring5", funcTag, 37}, - {"concatstrings", funcTag, 39}, - {"concatbyte2", funcTag, 41}, - {"concatbyte3", funcTag, 42}, - {"concatbyte4", funcTag, 43}, - {"concatbyte5", funcTag, 44}, - {"concatbytes", funcTag, 45}, - {"cmpstring", funcTag, 46}, - {"intstring", funcTag, 49}, - {"slicebytetostring", funcTag, 50}, - {"slicebytetostringtmp", funcTag, 51}, - {"slicerunetostring", funcTag, 54}, - {"stringtoslicebyte", funcTag, 55}, - {"stringtoslicerune", funcTag, 58}, - {"slicecopy", funcTag, 59}, - {"decoderune", funcTag, 60}, - {"countrunes", funcTag, 61}, - {"convT", funcTag, 62}, - {"convTnoptr", funcTag, 62}, - {"convT16", funcTag, 64}, - {"convT32", funcTag, 66}, - {"convT64", funcTag, 67}, - {"convTstring", funcTag, 68}, - {"convTslice", funcTag, 71}, - {"assertE2I", funcTag, 72}, - {"assertE2I2", funcTag, 72}, - {"panicdottypeE", funcTag, 73}, - {"panicdottypeI", funcTag, 73}, - {"panicnildottype", funcTag, 74}, - {"typeAssert", funcTag, 72}, - {"interfaceSwitch", funcTag, 75}, - {"ifaceeq", funcTag, 77}, - {"efaceeq", funcTag, 77}, - {"panicrangestate", funcTag, 78}, - {"deferrangefunc", funcTag, 79}, - {"rand", funcTag, 80}, - {"rand32", funcTag, 81}, - {"makemap64", funcTag, 83}, - {"makemap", funcTag, 84}, - {"makemap_small", funcTag, 85}, - {"mapaccess1", funcTag, 86}, - {"mapaccess1_fast32", funcTag, 87}, - {"mapaccess1_fast64", funcTag, 88}, - {"mapaccess1_faststr", funcTag, 89}, - {"mapaccess1_fat", funcTag, 90}, - {"mapaccess2", funcTag, 91}, - {"mapaccess2_fast32", funcTag, 92}, - {"mapaccess2_fast64", funcTag, 93}, - {"mapaccess2_faststr", funcTag, 94}, - {"mapaccess2_fat", funcTag, 95}, - {"mapassign", funcTag, 86}, - {"mapassign_fast32", funcTag, 87}, - {"mapassign_fast32ptr", funcTag, 96}, - {"mapassign_fast64", funcTag, 88}, - {"mapassign_fast64ptr", funcTag, 96}, - {"mapassign_faststr", funcTag, 89}, - {"mapiterinit", funcTag, 97}, - {"mapIterStart", funcTag, 97}, - {"mapdelete", funcTag, 97}, - {"mapdelete_fast32", funcTag, 98}, - {"mapdelete_fast64", funcTag, 99}, - {"mapdelete_faststr", funcTag, 100}, - {"mapiternext", funcTag, 101}, - {"mapIterNext", funcTag, 101}, - {"mapclear", funcTag, 102}, - {"makechan64", funcTag, 104}, - {"makechan", funcTag, 105}, - {"chanrecv1", funcTag, 107}, - {"chanrecv2", funcTag, 108}, - {"chansend1", funcTag, 110}, - {"closechan", funcTag, 111}, - {"chanlen", funcTag, 112}, - {"chancap", funcTag, 112}, - {"writeBarrier", varTag, 114}, - {"typedmemmove", funcTag, 115}, - {"typedmemclr", funcTag, 116}, - {"typedslicecopy", funcTag, 117}, - {"selectnbsend", funcTag, 118}, - {"selectnbrecv", funcTag, 119}, - {"selectsetpc", funcTag, 120}, - {"selectgo", funcTag, 121}, + {"concatstring2", funcTag, 32}, + {"concatstring3", funcTag, 33}, + {"concatstring4", funcTag, 34}, + {"concatstring5", funcTag, 35}, + {"concatstrings", funcTag, 37}, + {"concatbyte2", funcTag, 39}, + {"concatbyte3", funcTag, 40}, + {"concatbyte4", funcTag, 41}, + {"concatbyte5", funcTag, 42}, + {"concatbytes", funcTag, 43}, + {"cmpstring", funcTag, 44}, + {"intstring", funcTag, 47}, + {"slicebytetostring", funcTag, 48}, + {"slicebytetostringtmp", funcTag, 49}, + {"slicerunetostring", funcTag, 52}, + {"stringtoslicebyte", funcTag, 53}, + {"stringtoslicerune", funcTag, 56}, + {"slicecopy", funcTag, 57}, + {"decoderune", funcTag, 58}, + {"countrunes", funcTag, 59}, + {"convT", funcTag, 60}, + {"convTnoptr", funcTag, 60}, + {"convT16", funcTag, 62}, + {"convT32", funcTag, 64}, + {"convT64", funcTag, 65}, + {"convTstring", funcTag, 66}, + {"convTslice", funcTag, 69}, + {"assertE2I", funcTag, 70}, + {"assertE2I2", funcTag, 70}, + {"panicdottypeE", funcTag, 71}, + {"panicdottypeI", funcTag, 71}, + {"panicnildottype", funcTag, 72}, + {"typeAssert", funcTag, 70}, + {"interfaceSwitch", funcTag, 73}, + {"ifaceeq", funcTag, 75}, + {"efaceeq", funcTag, 75}, + {"panicrangestate", funcTag, 76}, + {"deferrangefunc", funcTag, 12}, + {"rand", funcTag, 77}, + {"rand32", funcTag, 78}, + {"makemap64", funcTag, 80}, + {"makemap", funcTag, 81}, + {"makemap_small", funcTag, 82}, + {"mapaccess1", funcTag, 83}, + {"mapaccess1_fast32", funcTag, 84}, + {"mapaccess1_fast64", funcTag, 85}, + {"mapaccess1_faststr", funcTag, 86}, + {"mapaccess1_fat", funcTag, 87}, + {"mapaccess2", funcTag, 88}, + {"mapaccess2_fast32", funcTag, 89}, + {"mapaccess2_fast64", funcTag, 90}, + {"mapaccess2_faststr", funcTag, 91}, + {"mapaccess2_fat", funcTag, 92}, + {"mapassign", funcTag, 83}, + {"mapassign_fast32", funcTag, 84}, + {"mapassign_fast32ptr", funcTag, 93}, + {"mapassign_fast64", funcTag, 85}, + {"mapassign_fast64ptr", funcTag, 93}, + {"mapassign_faststr", funcTag, 86}, + {"mapIterStart", funcTag, 94}, + {"mapdelete", funcTag, 94}, + {"mapdelete_fast32", funcTag, 95}, + {"mapdelete_fast64", funcTag, 96}, + {"mapdelete_faststr", funcTag, 97}, + {"mapIterNext", funcTag, 98}, + {"mapclear", funcTag, 99}, + {"makechan64", funcTag, 101}, + {"makechan", funcTag, 102}, + {"chanrecv1", funcTag, 104}, + {"chanrecv2", funcTag, 105}, + {"chansend1", funcTag, 107}, + {"closechan", funcTag, 108}, + {"chanlen", funcTag, 109}, + {"chancap", funcTag, 109}, + {"writeBarrier", varTag, 111}, + {"typedmemmove", funcTag, 112}, + {"typedmemclr", funcTag, 113}, + {"typedslicecopy", funcTag, 114}, + {"selectnbsend", funcTag, 115}, + {"selectnbrecv", funcTag, 116}, + {"selectsetpc", funcTag, 117}, + {"selectgo", funcTag, 118}, {"block", funcTag, 9}, - {"makeslice", funcTag, 122}, - {"makeslice64", funcTag, 123}, - {"makeslicecopy", funcTag, 124}, - {"growslice", funcTag, 126}, - {"unsafeslicecheckptr", funcTag, 127}, + {"makeslice", funcTag, 119}, + {"makeslice64", funcTag, 120}, + {"makeslicecopy", funcTag, 121}, + {"growslice", funcTag, 123}, + {"unsafeslicecheckptr", funcTag, 124}, {"panicunsafeslicelen", funcTag, 9}, {"panicunsafeslicenilptr", funcTag, 9}, - {"unsafestringcheckptr", funcTag, 128}, + {"unsafestringcheckptr", funcTag, 125}, {"panicunsafestringlen", funcTag, 9}, {"panicunsafestringnilptr", funcTag, 9}, - {"memmove", funcTag, 129}, - {"memclrNoHeapPointers", funcTag, 130}, - {"memclrHasPointers", funcTag, 130}, - {"memequal", funcTag, 131}, - {"memequal0", funcTag, 132}, - {"memequal8", funcTag, 132}, - {"memequal16", funcTag, 132}, - {"memequal32", funcTag, 132}, - {"memequal64", funcTag, 132}, - {"memequal128", funcTag, 132}, - {"f32equal", funcTag, 133}, - {"f64equal", funcTag, 133}, - {"c64equal", funcTag, 133}, - {"c128equal", funcTag, 133}, - {"strequal", funcTag, 133}, - {"interequal", funcTag, 133}, - {"nilinterequal", funcTag, 133}, - {"memhash", funcTag, 134}, - {"memhash0", funcTag, 135}, - {"memhash8", funcTag, 135}, - {"memhash16", funcTag, 135}, - {"memhash32", funcTag, 135}, - {"memhash64", funcTag, 135}, - {"memhash128", funcTag, 135}, - {"f32hash", funcTag, 136}, - {"f64hash", funcTag, 136}, - {"c64hash", funcTag, 136}, - {"c128hash", funcTag, 136}, - {"strhash", funcTag, 136}, - {"interhash", funcTag, 136}, - {"nilinterhash", funcTag, 136}, - {"int64div", funcTag, 137}, - {"uint64div", funcTag, 138}, - {"int64mod", funcTag, 137}, - {"uint64mod", funcTag, 138}, - {"float64toint64", funcTag, 139}, - {"float64touint64", funcTag, 140}, - {"float64touint32", funcTag, 141}, - {"int64tofloat64", funcTag, 142}, - {"int64tofloat32", funcTag, 144}, - {"uint64tofloat64", funcTag, 145}, - {"uint64tofloat32", funcTag, 146}, - {"uint32tofloat64", funcTag, 147}, - {"complex128div", funcTag, 148}, - {"racefuncenter", funcTag, 31}, + {"memmove", funcTag, 126}, + {"memclrNoHeapPointers", funcTag, 127}, + {"memclrHasPointers", funcTag, 127}, + {"memequal", funcTag, 128}, + {"memequal0", funcTag, 129}, + {"memequal8", funcTag, 129}, + {"memequal16", funcTag, 129}, + {"memequal32", funcTag, 129}, + {"memequal64", funcTag, 129}, + {"memequal128", funcTag, 129}, + {"f32equal", funcTag, 130}, + {"f64equal", funcTag, 130}, + {"c64equal", funcTag, 130}, + {"c128equal", funcTag, 130}, + {"strequal", funcTag, 130}, + {"interequal", funcTag, 130}, + {"nilinterequal", funcTag, 130}, + {"memhash", funcTag, 131}, + {"memhash0", funcTag, 132}, + {"memhash8", funcTag, 132}, + {"memhash16", funcTag, 132}, + {"memhash32", funcTag, 132}, + {"memhash64", funcTag, 132}, + {"memhash128", funcTag, 132}, + {"f32hash", funcTag, 133}, + {"f64hash", funcTag, 133}, + {"c64hash", funcTag, 133}, + {"c128hash", funcTag, 133}, + {"strhash", funcTag, 133}, + {"interhash", funcTag, 133}, + {"nilinterhash", funcTag, 133}, + {"int64div", funcTag, 134}, + {"uint64div", funcTag, 135}, + {"int64mod", funcTag, 134}, + {"uint64mod", funcTag, 135}, + {"float64toint64", funcTag, 136}, + {"float64touint64", funcTag, 137}, + {"float64touint32", funcTag, 138}, + {"int64tofloat64", funcTag, 139}, + {"int64tofloat32", funcTag, 141}, + {"uint64tofloat64", funcTag, 142}, + {"uint64tofloat32", funcTag, 143}, + {"uint32tofloat64", funcTag, 144}, + {"complex128div", funcTag, 145}, + {"racefuncenter", funcTag, 29}, {"racefuncexit", funcTag, 9}, - {"raceread", funcTag, 31}, - {"racewrite", funcTag, 31}, - {"racereadrange", funcTag, 149}, - {"racewriterange", funcTag, 149}, - {"msanread", funcTag, 149}, - {"msanwrite", funcTag, 149}, - {"msanmove", funcTag, 150}, - {"asanread", funcTag, 149}, - {"asanwrite", funcTag, 149}, - {"checkptrAlignment", funcTag, 151}, - {"checkptrArithmetic", funcTag, 153}, - {"libfuzzerTraceCmp1", funcTag, 154}, - {"libfuzzerTraceCmp2", funcTag, 155}, - {"libfuzzerTraceCmp4", funcTag, 156}, - {"libfuzzerTraceCmp8", funcTag, 157}, - {"libfuzzerTraceConstCmp1", funcTag, 154}, - {"libfuzzerTraceConstCmp2", funcTag, 155}, - {"libfuzzerTraceConstCmp4", funcTag, 156}, - {"libfuzzerTraceConstCmp8", funcTag, 157}, - {"libfuzzerHookStrCmp", funcTag, 158}, - {"libfuzzerHookEqualFold", funcTag, 158}, - {"addCovMeta", funcTag, 160}, + {"raceread", funcTag, 29}, + {"racewrite", funcTag, 29}, + {"racereadrange", funcTag, 146}, + {"racewriterange", funcTag, 146}, + {"msanread", funcTag, 146}, + {"msanwrite", funcTag, 146}, + {"msanmove", funcTag, 147}, + {"asanread", funcTag, 146}, + {"asanwrite", funcTag, 146}, + {"checkptrAlignment", funcTag, 148}, + {"checkptrArithmetic", funcTag, 150}, + {"libfuzzerTraceCmp1", funcTag, 151}, + {"libfuzzerTraceCmp2", funcTag, 152}, + {"libfuzzerTraceCmp4", funcTag, 153}, + {"libfuzzerTraceCmp8", funcTag, 154}, + {"libfuzzerTraceConstCmp1", funcTag, 151}, + {"libfuzzerTraceConstCmp2", funcTag, 152}, + {"libfuzzerTraceConstCmp4", funcTag, 153}, + {"libfuzzerTraceConstCmp8", funcTag, 154}, + {"libfuzzerHookStrCmp", funcTag, 155}, + {"libfuzzerHookEqualFold", funcTag, 155}, + {"addCovMeta", funcTag, 157}, {"x86HasPOPCNT", varTag, 6}, {"x86HasSSE41", varTag, 6}, {"x86HasFMA", varTag, 6}, @@ -243,11 +241,11 @@ var runtimeDecls = [...]struct { {"loong64HasLAM_BH", varTag, 6}, {"loong64HasLSX", varTag, 6}, {"riscv64HasZbb", varTag, 6}, - {"asanregisterglobals", funcTag, 130}, + {"asanregisterglobals", funcTag, 127}, } func runtimeTypes() []*types.Type { - var typs [161]*types.Type + var typs [158]*types.Type typs[0] = types.ByteType typs[1] = types.NewPtr(typs[0]) typs[2] = types.Types[types.TANY] @@ -260,155 +258,152 @@ func runtimeTypes() []*types.Type { typs[9] = newSig(nil, nil) typs[10] = types.Types[types.TINTER] typs[11] = newSig(params(typs[10]), nil) - typs[12] = types.Types[types.TINT32] - typs[13] = types.NewPtr(typs[12]) - typs[14] = newSig(params(typs[13]), params(typs[10])) - typs[15] = types.Types[types.TINT] - typs[16] = newSig(params(typs[15], typs[15]), nil) - typs[17] = types.Types[types.TUINT] - typs[18] = newSig(params(typs[17], typs[15]), nil) - typs[19] = newSig(params(typs[6]), nil) - typs[20] = types.Types[types.TFLOAT64] + typs[12] = newSig(nil, params(typs[10])) + typs[13] = types.Types[types.TINT] + typs[14] = newSig(params(typs[13], typs[13]), nil) + typs[15] = types.Types[types.TUINT] + typs[16] = newSig(params(typs[15], typs[13]), nil) + typs[17] = newSig(params(typs[6]), nil) + typs[18] = types.Types[types.TFLOAT64] + typs[19] = newSig(params(typs[18]), nil) + typs[20] = types.Types[types.TINT64] typs[21] = newSig(params(typs[20]), nil) - typs[22] = types.Types[types.TINT64] + typs[22] = types.Types[types.TUINT64] typs[23] = newSig(params(typs[22]), nil) - typs[24] = types.Types[types.TUINT64] + typs[24] = types.Types[types.TCOMPLEX128] typs[25] = newSig(params(typs[24]), nil) - typs[26] = types.Types[types.TCOMPLEX128] + typs[26] = types.Types[types.TSTRING] typs[27] = newSig(params(typs[26]), nil) - typs[28] = types.Types[types.TSTRING] - typs[29] = newSig(params(typs[28]), nil) - typs[30] = newSig(params(typs[2]), nil) - typs[31] = newSig(params(typs[5]), nil) - typs[32] = types.NewArray(typs[0], 32) - typs[33] = types.NewPtr(typs[32]) - typs[34] = newSig(params(typs[33], typs[28], typs[28]), params(typs[28])) - typs[35] = newSig(params(typs[33], typs[28], typs[28], typs[28]), params(typs[28])) - typs[36] = newSig(params(typs[33], typs[28], typs[28], typs[28], typs[28]), params(typs[28])) - typs[37] = newSig(params(typs[33], typs[28], typs[28], typs[28], typs[28], typs[28]), params(typs[28])) - typs[38] = types.NewSlice(typs[28]) - typs[39] = newSig(params(typs[33], typs[38]), params(typs[28])) - typs[40] = types.NewSlice(typs[0]) - typs[41] = newSig(params(typs[33], typs[28], typs[28]), params(typs[40])) - typs[42] = newSig(params(typs[33], typs[28], typs[28], typs[28]), params(typs[40])) - typs[43] = newSig(params(typs[33], typs[28], typs[28], typs[28], typs[28]), params(typs[40])) - typs[44] = newSig(params(typs[33], typs[28], typs[28], typs[28], typs[28], typs[28]), params(typs[40])) - typs[45] = newSig(params(typs[33], typs[38]), params(typs[40])) - typs[46] = newSig(params(typs[28], typs[28]), params(typs[15])) - typs[47] = types.NewArray(typs[0], 4) - typs[48] = types.NewPtr(typs[47]) - typs[49] = newSig(params(typs[48], typs[22]), params(typs[28])) - typs[50] = newSig(params(typs[33], typs[1], typs[15]), params(typs[28])) - typs[51] = newSig(params(typs[1], typs[15]), params(typs[28])) - typs[52] = types.RuneType - typs[53] = types.NewSlice(typs[52]) - typs[54] = newSig(params(typs[33], typs[53]), params(typs[28])) - typs[55] = newSig(params(typs[33], typs[28]), params(typs[40])) - typs[56] = types.NewArray(typs[52], 32) - typs[57] = types.NewPtr(typs[56]) - typs[58] = newSig(params(typs[57], typs[28]), params(typs[53])) - typs[59] = newSig(params(typs[3], typs[15], typs[3], typs[15], typs[5]), params(typs[15])) - typs[60] = newSig(params(typs[28], typs[15]), params(typs[52], typs[15])) - typs[61] = newSig(params(typs[28]), params(typs[15])) - typs[62] = newSig(params(typs[1], typs[3]), params(typs[7])) - typs[63] = types.Types[types.TUINT16] + typs[28] = newSig(params(typs[2]), nil) + typs[29] = newSig(params(typs[5]), nil) + typs[30] = types.NewArray(typs[0], 32) + typs[31] = types.NewPtr(typs[30]) + typs[32] = newSig(params(typs[31], typs[26], typs[26]), params(typs[26])) + typs[33] = newSig(params(typs[31], typs[26], typs[26], typs[26]), params(typs[26])) + typs[34] = newSig(params(typs[31], typs[26], typs[26], typs[26], typs[26]), params(typs[26])) + typs[35] = newSig(params(typs[31], typs[26], typs[26], typs[26], typs[26], typs[26]), params(typs[26])) + typs[36] = types.NewSlice(typs[26]) + typs[37] = newSig(params(typs[31], typs[36]), params(typs[26])) + typs[38] = types.NewSlice(typs[0]) + typs[39] = newSig(params(typs[31], typs[26], typs[26]), params(typs[38])) + typs[40] = newSig(params(typs[31], typs[26], typs[26], typs[26]), params(typs[38])) + typs[41] = newSig(params(typs[31], typs[26], typs[26], typs[26], typs[26]), params(typs[38])) + typs[42] = newSig(params(typs[31], typs[26], typs[26], typs[26], typs[26], typs[26]), params(typs[38])) + typs[43] = newSig(params(typs[31], typs[36]), params(typs[38])) + typs[44] = newSig(params(typs[26], typs[26]), params(typs[13])) + typs[45] = types.NewArray(typs[0], 4) + typs[46] = types.NewPtr(typs[45]) + typs[47] = newSig(params(typs[46], typs[20]), params(typs[26])) + typs[48] = newSig(params(typs[31], typs[1], typs[13]), params(typs[26])) + typs[49] = newSig(params(typs[1], typs[13]), params(typs[26])) + typs[50] = types.RuneType + typs[51] = types.NewSlice(typs[50]) + typs[52] = newSig(params(typs[31], typs[51]), params(typs[26])) + typs[53] = newSig(params(typs[31], typs[26]), params(typs[38])) + typs[54] = types.NewArray(typs[50], 32) + typs[55] = types.NewPtr(typs[54]) + typs[56] = newSig(params(typs[55], typs[26]), params(typs[51])) + typs[57] = newSig(params(typs[3], typs[13], typs[3], typs[13], typs[5]), params(typs[13])) + typs[58] = newSig(params(typs[26], typs[13]), params(typs[50], typs[13])) + typs[59] = newSig(params(typs[26]), params(typs[13])) + typs[60] = newSig(params(typs[1], typs[3]), params(typs[7])) + typs[61] = types.Types[types.TUINT16] + typs[62] = newSig(params(typs[61]), params(typs[7])) + typs[63] = types.Types[types.TUINT32] typs[64] = newSig(params(typs[63]), params(typs[7])) - typs[65] = types.Types[types.TUINT32] - typs[66] = newSig(params(typs[65]), params(typs[7])) - typs[67] = newSig(params(typs[24]), params(typs[7])) - typs[68] = newSig(params(typs[28]), params(typs[7])) - typs[69] = types.Types[types.TUINT8] - typs[70] = types.NewSlice(typs[69]) - typs[71] = newSig(params(typs[70]), params(typs[7])) - typs[72] = newSig(params(typs[1], typs[1]), params(typs[1])) - typs[73] = newSig(params(typs[1], typs[1], typs[1]), nil) - typs[74] = newSig(params(typs[1]), nil) - typs[75] = newSig(params(typs[1], typs[1]), params(typs[15], typs[1])) - typs[76] = types.NewPtr(typs[5]) - typs[77] = newSig(params(typs[76], typs[7], typs[7]), params(typs[6])) - typs[78] = newSig(params(typs[15]), nil) - typs[79] = newSig(nil, params(typs[10])) - typs[80] = newSig(nil, params(typs[24])) - typs[81] = newSig(nil, params(typs[65])) - typs[82] = types.NewMap(typs[2], typs[2]) - typs[83] = newSig(params(typs[1], typs[22], typs[3]), params(typs[82])) - typs[84] = newSig(params(typs[1], typs[15], typs[3]), params(typs[82])) - typs[85] = newSig(nil, params(typs[82])) - typs[86] = newSig(params(typs[1], typs[82], typs[3]), params(typs[3])) - typs[87] = newSig(params(typs[1], typs[82], typs[65]), params(typs[3])) - typs[88] = newSig(params(typs[1], typs[82], typs[24]), params(typs[3])) - typs[89] = newSig(params(typs[1], typs[82], typs[28]), params(typs[3])) - typs[90] = newSig(params(typs[1], typs[82], typs[3], typs[1]), params(typs[3])) - typs[91] = newSig(params(typs[1], typs[82], typs[3]), params(typs[3], typs[6])) - typs[92] = newSig(params(typs[1], typs[82], typs[65]), params(typs[3], typs[6])) - typs[93] = newSig(params(typs[1], typs[82], typs[24]), params(typs[3], typs[6])) - typs[94] = newSig(params(typs[1], typs[82], typs[28]), params(typs[3], typs[6])) - typs[95] = newSig(params(typs[1], typs[82], typs[3], typs[1]), params(typs[3], typs[6])) - typs[96] = newSig(params(typs[1], typs[82], typs[7]), params(typs[3])) - typs[97] = newSig(params(typs[1], typs[82], typs[3]), nil) - typs[98] = newSig(params(typs[1], typs[82], typs[65]), nil) - typs[99] = newSig(params(typs[1], typs[82], typs[24]), nil) - typs[100] = newSig(params(typs[1], typs[82], typs[28]), nil) - typs[101] = newSig(params(typs[3]), nil) - typs[102] = newSig(params(typs[1], typs[82]), nil) - typs[103] = types.NewChan(typs[2], types.Cboth) - typs[104] = newSig(params(typs[1], typs[22]), params(typs[103])) - typs[105] = newSig(params(typs[1], typs[15]), params(typs[103])) - typs[106] = types.NewChan(typs[2], types.Crecv) + typs[65] = newSig(params(typs[22]), params(typs[7])) + typs[66] = newSig(params(typs[26]), params(typs[7])) + typs[67] = types.Types[types.TUINT8] + typs[68] = types.NewSlice(typs[67]) + typs[69] = newSig(params(typs[68]), params(typs[7])) + typs[70] = newSig(params(typs[1], typs[1]), params(typs[1])) + typs[71] = newSig(params(typs[1], typs[1], typs[1]), nil) + typs[72] = newSig(params(typs[1]), nil) + typs[73] = newSig(params(typs[1], typs[1]), params(typs[13], typs[1])) + typs[74] = types.NewPtr(typs[5]) + typs[75] = newSig(params(typs[74], typs[7], typs[7]), params(typs[6])) + typs[76] = newSig(params(typs[13]), nil) + typs[77] = newSig(nil, params(typs[22])) + typs[78] = newSig(nil, params(typs[63])) + typs[79] = types.NewMap(typs[2], typs[2]) + typs[80] = newSig(params(typs[1], typs[20], typs[3]), params(typs[79])) + typs[81] = newSig(params(typs[1], typs[13], typs[3]), params(typs[79])) + typs[82] = newSig(nil, params(typs[79])) + typs[83] = newSig(params(typs[1], typs[79], typs[3]), params(typs[3])) + typs[84] = newSig(params(typs[1], typs[79], typs[63]), params(typs[3])) + typs[85] = newSig(params(typs[1], typs[79], typs[22]), params(typs[3])) + typs[86] = newSig(params(typs[1], typs[79], typs[26]), params(typs[3])) + typs[87] = newSig(params(typs[1], typs[79], typs[3], typs[1]), params(typs[3])) + typs[88] = newSig(params(typs[1], typs[79], typs[3]), params(typs[3], typs[6])) + typs[89] = newSig(params(typs[1], typs[79], typs[63]), params(typs[3], typs[6])) + typs[90] = newSig(params(typs[1], typs[79], typs[22]), params(typs[3], typs[6])) + typs[91] = newSig(params(typs[1], typs[79], typs[26]), params(typs[3], typs[6])) + typs[92] = newSig(params(typs[1], typs[79], typs[3], typs[1]), params(typs[3], typs[6])) + typs[93] = newSig(params(typs[1], typs[79], typs[7]), params(typs[3])) + typs[94] = newSig(params(typs[1], typs[79], typs[3]), nil) + typs[95] = newSig(params(typs[1], typs[79], typs[63]), nil) + typs[96] = newSig(params(typs[1], typs[79], typs[22]), nil) + typs[97] = newSig(params(typs[1], typs[79], typs[26]), nil) + typs[98] = newSig(params(typs[3]), nil) + typs[99] = newSig(params(typs[1], typs[79]), nil) + typs[100] = types.NewChan(typs[2], types.Cboth) + typs[101] = newSig(params(typs[1], typs[20]), params(typs[100])) + typs[102] = newSig(params(typs[1], typs[13]), params(typs[100])) + typs[103] = types.NewChan(typs[2], types.Crecv) + typs[104] = newSig(params(typs[103], typs[3]), nil) + typs[105] = newSig(params(typs[103], typs[3]), params(typs[6])) + typs[106] = types.NewChan(typs[2], types.Csend) typs[107] = newSig(params(typs[106], typs[3]), nil) - typs[108] = newSig(params(typs[106], typs[3]), params(typs[6])) - typs[109] = types.NewChan(typs[2], types.Csend) - typs[110] = newSig(params(typs[109], typs[3]), nil) - typs[111] = newSig(params(typs[109]), nil) - typs[112] = newSig(params(typs[2]), params(typs[15])) - typs[113] = types.NewArray(typs[0], 3) - typs[114] = types.NewStruct([]*types.Field{types.NewField(src.NoXPos, Lookup("enabled"), typs[6]), types.NewField(src.NoXPos, Lookup("pad"), typs[113]), types.NewField(src.NoXPos, Lookup("cgo"), typs[6]), types.NewField(src.NoXPos, Lookup("alignme"), typs[24])}) - typs[115] = newSig(params(typs[1], typs[3], typs[3]), nil) - typs[116] = newSig(params(typs[1], typs[3]), nil) - typs[117] = newSig(params(typs[1], typs[3], typs[15], typs[3], typs[15]), params(typs[15])) - typs[118] = newSig(params(typs[109], typs[3]), params(typs[6])) - typs[119] = newSig(params(typs[3], typs[106]), params(typs[6], typs[6])) - typs[120] = newSig(params(typs[76]), nil) - typs[121] = newSig(params(typs[1], typs[1], typs[76], typs[15], typs[15], typs[6]), params(typs[15], typs[6])) - typs[122] = newSig(params(typs[1], typs[15], typs[15]), params(typs[7])) - typs[123] = newSig(params(typs[1], typs[22], typs[22]), params(typs[7])) - typs[124] = newSig(params(typs[1], typs[15], typs[15], typs[7]), params(typs[7])) - typs[125] = types.NewSlice(typs[2]) - typs[126] = newSig(params(typs[3], typs[15], typs[15], typs[15], typs[1]), params(typs[125])) - typs[127] = newSig(params(typs[1], typs[7], typs[22]), nil) - typs[128] = newSig(params(typs[7], typs[22]), nil) - typs[129] = newSig(params(typs[3], typs[3], typs[5]), nil) - typs[130] = newSig(params(typs[7], typs[5]), nil) - typs[131] = newSig(params(typs[3], typs[3], typs[5]), params(typs[6])) - typs[132] = newSig(params(typs[3], typs[3]), params(typs[6])) - typs[133] = newSig(params(typs[7], typs[7]), params(typs[6])) - typs[134] = newSig(params(typs[3], typs[5], typs[5]), params(typs[5])) - typs[135] = newSig(params(typs[7], typs[5]), params(typs[5])) - typs[136] = newSig(params(typs[3], typs[5]), params(typs[5])) - typs[137] = newSig(params(typs[22], typs[22]), params(typs[22])) - typs[138] = newSig(params(typs[24], typs[24]), params(typs[24])) - typs[139] = newSig(params(typs[20]), params(typs[22])) - typs[140] = newSig(params(typs[20]), params(typs[24])) - typs[141] = newSig(params(typs[20]), params(typs[65])) - typs[142] = newSig(params(typs[22]), params(typs[20])) - typs[143] = types.Types[types.TFLOAT32] - typs[144] = newSig(params(typs[22]), params(typs[143])) - typs[145] = newSig(params(typs[24]), params(typs[20])) - typs[146] = newSig(params(typs[24]), params(typs[143])) - typs[147] = newSig(params(typs[65]), params(typs[20])) - typs[148] = newSig(params(typs[26], typs[26]), params(typs[26])) - typs[149] = newSig(params(typs[5], typs[5]), nil) - typs[150] = newSig(params(typs[5], typs[5], typs[5]), nil) - typs[151] = newSig(params(typs[7], typs[1], typs[5]), nil) - typs[152] = types.NewSlice(typs[7]) - typs[153] = newSig(params(typs[7], typs[152]), nil) - typs[154] = newSig(params(typs[69], typs[69], typs[17]), nil) - typs[155] = newSig(params(typs[63], typs[63], typs[17]), nil) - typs[156] = newSig(params(typs[65], typs[65], typs[17]), nil) - typs[157] = newSig(params(typs[24], typs[24], typs[17]), nil) - typs[158] = newSig(params(typs[28], typs[28], typs[17]), nil) - typs[159] = types.NewArray(typs[0], 16) - typs[160] = newSig(params(typs[7], typs[65], typs[159], typs[28], typs[15], typs[69], typs[69]), params(typs[65])) + typs[108] = newSig(params(typs[106]), nil) + typs[109] = newSig(params(typs[2]), params(typs[13])) + typs[110] = types.NewArray(typs[0], 3) + typs[111] = types.NewStruct([]*types.Field{types.NewField(src.NoXPos, Lookup("enabled"), typs[6]), types.NewField(src.NoXPos, Lookup("pad"), typs[110]), types.NewField(src.NoXPos, Lookup("cgo"), typs[6]), types.NewField(src.NoXPos, Lookup("alignme"), typs[22])}) + typs[112] = newSig(params(typs[1], typs[3], typs[3]), nil) + typs[113] = newSig(params(typs[1], typs[3]), nil) + typs[114] = newSig(params(typs[1], typs[3], typs[13], typs[3], typs[13]), params(typs[13])) + typs[115] = newSig(params(typs[106], typs[3]), params(typs[6])) + typs[116] = newSig(params(typs[3], typs[103]), params(typs[6], typs[6])) + typs[117] = newSig(params(typs[74]), nil) + typs[118] = newSig(params(typs[1], typs[1], typs[74], typs[13], typs[13], typs[6]), params(typs[13], typs[6])) + typs[119] = newSig(params(typs[1], typs[13], typs[13]), params(typs[7])) + typs[120] = newSig(params(typs[1], typs[20], typs[20]), params(typs[7])) + typs[121] = newSig(params(typs[1], typs[13], typs[13], typs[7]), params(typs[7])) + typs[122] = types.NewSlice(typs[2]) + typs[123] = newSig(params(typs[3], typs[13], typs[13], typs[13], typs[1]), params(typs[122])) + typs[124] = newSig(params(typs[1], typs[7], typs[20]), nil) + typs[125] = newSig(params(typs[7], typs[20]), nil) + typs[126] = newSig(params(typs[3], typs[3], typs[5]), nil) + typs[127] = newSig(params(typs[7], typs[5]), nil) + typs[128] = newSig(params(typs[3], typs[3], typs[5]), params(typs[6])) + typs[129] = newSig(params(typs[3], typs[3]), params(typs[6])) + typs[130] = newSig(params(typs[7], typs[7]), params(typs[6])) + typs[131] = newSig(params(typs[3], typs[5], typs[5]), params(typs[5])) + typs[132] = newSig(params(typs[7], typs[5]), params(typs[5])) + typs[133] = newSig(params(typs[3], typs[5]), params(typs[5])) + typs[134] = newSig(params(typs[20], typs[20]), params(typs[20])) + typs[135] = newSig(params(typs[22], typs[22]), params(typs[22])) + typs[136] = newSig(params(typs[18]), params(typs[20])) + typs[137] = newSig(params(typs[18]), params(typs[22])) + typs[138] = newSig(params(typs[18]), params(typs[63])) + typs[139] = newSig(params(typs[20]), params(typs[18])) + typs[140] = types.Types[types.TFLOAT32] + typs[141] = newSig(params(typs[20]), params(typs[140])) + typs[142] = newSig(params(typs[22]), params(typs[18])) + typs[143] = newSig(params(typs[22]), params(typs[140])) + typs[144] = newSig(params(typs[63]), params(typs[18])) + typs[145] = newSig(params(typs[24], typs[24]), params(typs[24])) + typs[146] = newSig(params(typs[5], typs[5]), nil) + typs[147] = newSig(params(typs[5], typs[5], typs[5]), nil) + typs[148] = newSig(params(typs[7], typs[1], typs[5]), nil) + typs[149] = types.NewSlice(typs[7]) + typs[150] = newSig(params(typs[7], typs[149]), nil) + typs[151] = newSig(params(typs[67], typs[67], typs[15]), nil) + typs[152] = newSig(params(typs[61], typs[61], typs[15]), nil) + typs[153] = newSig(params(typs[63], typs[63], typs[15]), nil) + typs[154] = newSig(params(typs[22], typs[22], typs[15]), nil) + typs[155] = newSig(params(typs[26], typs[26], typs[15]), nil) + typs[156] = types.NewArray(typs[0], 16) + typs[157] = newSig(params(typs[7], typs[63], typs[156], typs[26], typs[13], typs[67], typs[67]), params(typs[63])) return typs[:] } diff --git a/src/cmd/compile/internal/typecheck/const.go b/src/cmd/compile/internal/typecheck/const.go index fc6e799e74..6a664156af 100644 --- a/src/cmd/compile/internal/typecheck/const.go +++ b/src/cmd/compile/internal/typecheck/const.go @@ -455,7 +455,6 @@ func callOrChan(n ir.Node) bool { ir.OPRINTLN, ir.OREAL, ir.ORECOVER, - ir.ORECOVERFP, ir.ORECV, ir.OUNSAFEADD, ir.OUNSAFESLICE, diff --git a/src/cmd/compile/internal/typecheck/func.go b/src/cmd/compile/internal/typecheck/func.go index 02e59fa360..5765731546 100644 --- a/src/cmd/compile/internal/typecheck/func.go +++ b/src/cmd/compile/internal/typecheck/func.go @@ -758,17 +758,7 @@ func tcRecover(n *ir.CallExpr) ir.Node { return n } - // FP is equal to caller's SP plus FixedFrameSize. - var fp ir.Node = ir.NewCallExpr(n.Pos(), ir.OGETCALLERSP, nil, nil) - if off := base.Ctxt.Arch.FixedFrameSize; off != 0 { - fp = ir.NewBinaryExpr(n.Pos(), ir.OADD, fp, ir.NewInt(base.Pos, off)) - } - // TODO(mdempsky): Replace *int32 with unsafe.Pointer, without upsetting checkptr. - fp = ir.NewConvExpr(n.Pos(), ir.OCONVNOP, types.NewPtr(types.Types[types.TINT32]), fp) - - n.SetOp(ir.ORECOVERFP) n.SetType(types.Types[types.TINTER]) - n.Args = []ir.Node{Expr(fp)} return n } diff --git a/src/cmd/compile/internal/typecheck/stmt.go b/src/cmd/compile/internal/typecheck/stmt.go index 8d792485d8..ac49f251bb 100644 --- a/src/cmd/compile/internal/typecheck/stmt.go +++ b/src/cmd/compile/internal/typecheck/stmt.go @@ -319,7 +319,7 @@ func normalizeGoDeferCall(pos src.XPos, op ir.Op, call ir.Node, init *ir.Nodes) argps = append(argps, &call.Fun.(*ir.SelectorExpr).X) // must be first for OCHECKNIL; see below visitList(call.Args) - case ir.OAPPEND, ir.ODELETE, ir.OPRINT, ir.OPRINTLN, ir.ORECOVERFP: + case ir.OAPPEND, ir.ODELETE, ir.OPRINT, ir.OPRINTLN, ir.ORECOVER: call := call.(*ir.CallExpr) visitList(call.Args) visit(&call.RType) diff --git a/src/cmd/compile/internal/types/fmt.go b/src/cmd/compile/internal/types/fmt.go index 139defafe2..67e2e99f02 100644 --- a/src/cmd/compile/internal/types/fmt.go +++ b/src/cmd/compile/internal/types/fmt.go @@ -471,12 +471,10 @@ func tconv2(b *bytes.Buffer, t *Type, verb rune, mode fmtMode, visited map[*Type case TSTRUCT: if m := t.StructType().Map; m != nil { mt := m.MapType() - // Format the bucket struct for map[x]y as map.bucket[x]y. + // Format the bucket struct for map[x]y as map.group[x]y. // This avoids a recursive print that generates very long names. switch t { - case mt.OldBucket: - b.WriteString("map.bucket[") - case mt.SwissGroup: + case mt.Group: b.WriteString("map.group[") default: base.Fatalf("unknown internal map type") diff --git a/src/cmd/compile/internal/types/sizeof_test.go b/src/cmd/compile/internal/types/sizeof_test.go index 3b2aeece3e..ba033ec499 100644 --- a/src/cmd/compile/internal/types/sizeof_test.go +++ b/src/cmd/compile/internal/types/sizeof_test.go @@ -22,7 +22,7 @@ func TestSizeof(t *testing.T) { }{ {Sym{}, 32, 64}, {Type{}, 60, 96}, - {Map{}, 16, 32}, + {Map{}, 12, 24}, {Forward{}, 20, 32}, {Func{}, 32, 56}, {Struct{}, 12, 24}, diff --git a/src/cmd/compile/internal/types/type.go b/src/cmd/compile/internal/types/type.go index f7b9b0f3f7..8c2f7a3b5d 100644 --- a/src/cmd/compile/internal/types/type.go +++ b/src/cmd/compile/internal/types/type.go @@ -10,7 +10,6 @@ import ( "cmd/internal/src" "fmt" "go/constant" - "internal/buildcfg" "internal/types/errors" "sync" ) @@ -282,17 +281,7 @@ type Map struct { Key *Type // Key type Elem *Type // Val (elem) type - // Note: It would be cleaner to completely split Map into OldMap and - // SwissMap, but 99% of the types map code doesn't care about the - // implementation at all, so it is tons of churn to split the type. - // Only code that looks at the bucket field can care about the - // implementation. - - // GOEXPERIMENT=noswissmap fields - OldBucket *Type // internal struct type representing a hash bucket - - // GOEXPERIMENT=swissmap fields - SwissGroup *Type // internal struct type representing a slot group + Group *Type // internal struct type representing a slot group } // MapType returns t's extra map-specific fields. @@ -1193,37 +1182,20 @@ func (t *Type) cmp(x *Type) Cmp { // by the general code after the switch. case TSTRUCT: - if buildcfg.Experiment.SwissMap { - // Is this a map group type? - if t.StructType().Map == nil { - if x.StructType().Map != nil { - return CMPlt // nil < non-nil - } - // to the fallthrough - } else if x.StructType().Map == nil { - return CMPgt // nil > non-nil - } - // Both have non-nil Map, fallthrough to the general - // case. Note that the map type does not directly refer - // to the group type (it uses unsafe.Pointer). If it - // did, this would need special handling to avoid - // infinite recursion. - } else { - // Is this a map bucket type? - if t.StructType().Map == nil { - if x.StructType().Map != nil { - return CMPlt // nil < non-nil - } - // to the fallthrough - } else if x.StructType().Map == nil { - return CMPgt // nil > non-nil + // Is this a map group type? + if t.StructType().Map == nil { + if x.StructType().Map != nil { + return CMPlt // nil < non-nil } - // Both have non-nil Map, fallthrough to the general - // case. Note that the map type does not directly refer - // to the bucket type (it uses unsafe.Pointer). If it - // did, this would need special handling to avoid - // infinite recursion. + // to the general case + } else if x.StructType().Map == nil { + return CMPgt // nil > non-nil } + // Both have non-nil Map, fallthrough to the general + // case. Note that the map type does not directly refer + // to the group type (it uses unsafe.Pointer). If it + // did, this would need special handling to avoid + // infinite recursion. tfs := t.Fields() xfs := x.Fields() diff --git a/src/cmd/compile/internal/types2/alias.go b/src/cmd/compile/internal/types2/alias.go index 6a6b96a6e3..90dda18cc8 100644 --- a/src/cmd/compile/internal/types2/alias.go +++ b/src/cmd/compile/internal/types2/alias.go @@ -6,7 +6,6 @@ package types2 import ( "cmd/compile/internal/syntax" - "fmt" ) // An Alias represents an alias type. @@ -50,7 +49,7 @@ type Alias struct { } // NewAlias creates a new Alias type with the given type name and rhs. -// rhs must not be nil. +// If rhs is nil, the alias is incomplete. func NewAlias(obj *TypeName, rhs Type) *Alias { alias := (*Checker)(nil).newAlias(obj, rhs) // Ensure that alias.actual is set (#65455). @@ -98,6 +97,7 @@ func (a *Alias) Rhs() Type { return a.fromRHS } // otherwise it follows t's alias chain until it // reaches a non-alias type which is then returned. // Consequently, the result is never an alias type. +// Returns nil if the alias is incomplete. func Unalias(t Type) Type { if a0, _ := t.(*Alias); a0 != nil { return unalias(a0) @@ -113,19 +113,10 @@ func unalias(a0 *Alias) Type { for a := a0; a != nil; a, _ = t.(*Alias) { t = a.fromRHS } - if t == nil { - panic(fmt.Sprintf("non-terminated alias %s", a0.obj.name)) - } - - // Memoize the type only if valid. - // In the presence of unfinished cyclic declarations, Unalias - // would otherwise latch the invalid value (#66704). - // TODO(adonovan): rethink, along with checker.typeDecl's use - // of Invalid to mark unfinished aliases. - if t != Typ[Invalid] { - a0.actual = t - } + // It's fine to memoize nil types since it's the zero value for actual. + // It accomplishes nothing. + a0.actual = t return t } @@ -137,9 +128,8 @@ func asNamed(t Type) *Named { } // newAlias creates a new Alias type with the given type name and rhs. -// rhs must not be nil. +// If rhs is nil, the alias is incomplete. func (check *Checker) newAlias(obj *TypeName, rhs Type) *Alias { - assert(rhs != nil) a := new(Alias) a.obj = obj a.orig = a @@ -172,12 +162,6 @@ func (check *Checker) newAliasInstance(pos syntax.Pos, orig *Alias, targs []Type func (a *Alias) cleanup() { // Ensure a.actual is set before types are published, - // so Unalias is a pure "getter", not a "setter". - actual := Unalias(a) - - if actual == Typ[Invalid] { - // We don't set a.actual to Typ[Invalid] during type checking, - // as it may indicate that the RHS is not fully set up. - a.actual = actual - } + // so unalias is a pure "getter", not a "setter". + unalias(a) } diff --git a/src/cmd/compile/internal/types2/builtins.go b/src/cmd/compile/internal/types2/builtins.go index fe46b4e997..4bb2135755 100644 --- a/src/cmd/compile/internal/types2/builtins.go +++ b/src/cmd/compile/internal/types2/builtins.go @@ -91,22 +91,25 @@ func (check *Checker) builtin(x *operand, call *syntax.CallExpr, id builtinId) ( // to type []byte with a second argument of string type followed by ... . // This form appends the bytes of the string." - // get special case out of the way + // Handle append(bytes, y...) special case, where + // the type set of y is {string} or {string, []byte}. var sig *Signature if nargs == 2 && hasDots(call) { if ok, _ := x.assignableTo(check, NewSlice(universeByte), nil); ok { y := args[1] + hasString := false typeset(y.typ, func(_, u Type) bool { if s, _ := u.(*Slice); s != nil && Identical(s.elem, universeByte) { return true } if isString(u) { + hasString = true return true } y = nil return false }) - if y != nil { + if y != nil && hasString { // setting the signature also signals that we're done sig = makeSig(x.typ, x.typ, y.typ) sig.variadic = true diff --git a/src/cmd/compile/internal/types2/check_test.go b/src/cmd/compile/internal/types2/check_test.go index 35bbcec5c5..8b97a9f676 100644 --- a/src/cmd/compile/internal/types2/check_test.go +++ b/src/cmd/compile/internal/types2/check_test.go @@ -399,12 +399,6 @@ func TestIssue47243_TypedRHS(t *testing.T) { } func TestCheck(t *testing.T) { - old := buildcfg.Experiment.RangeFunc - defer func() { - buildcfg.Experiment.RangeFunc = old - }() - buildcfg.Experiment.RangeFunc = true - DefPredeclaredTestFuncs() testDirFiles(t, "../../../../internal/types/testdata/check", 50, false) // TODO(gri) narrow column tolerance } diff --git a/src/cmd/compile/internal/types2/decl.go b/src/cmd/compile/internal/types2/decl.go index bedcc4c015..64047aa84f 100644 --- a/src/cmd/compile/internal/types2/decl.go +++ b/src/cmd/compile/internal/types2/decl.go @@ -320,11 +320,15 @@ func (check *Checker) cycleError(cycle []Object, start int) { // If obj is a type alias, mark it as valid (not broken) in order to avoid follow-on errors. obj := cycle[start] tname, _ := obj.(*TypeName) - if tname != nil && tname.IsAlias() { - // If we use Alias nodes, it is initialized with Typ[Invalid]. - // TODO(gri) Adjust this code if we initialize with nil. - if !check.conf.EnableAlias { - check.validAlias(tname, Typ[Invalid]) + if tname != nil { + if check.conf.EnableAlias { + if a, ok := tname.Type().(*Alias); ok { + a.fromRHS = Typ[Invalid] + } + } else { + if tname.IsAlias() { + check.validAlias(tname, Typ[Invalid]) + } } } @@ -507,17 +511,18 @@ func (check *Checker) typeDecl(obj *TypeName, tdecl *syntax.TypeDecl, def *TypeN } if check.conf.EnableAlias { - // TODO(gri) Should be able to use nil instead of Typ[Invalid] to mark - // the alias as incomplete. Currently this causes problems - // with certain cycles. Investigate. - // - // NOTE(adonovan): to avoid the Invalid being prematurely observed - // by (e.g.) a var whose type is an unfinished cycle, - // Unalias does not memoize if Invalid. Perhaps we should use a - // special sentinel distinct from Invalid. - alias := check.newAlias(obj, Typ[Invalid]) + alias := check.newAlias(obj, nil) setDefType(def, alias) + // If we could not type the RHS, set it to invalid. This should + // only ever happen if we panic before setting. + defer func() { + if alias.fromRHS == nil { + alias.fromRHS = Typ[Invalid] + unalias(alias) + } + }() + // handle type parameters even if not allowed (Alias type is supported) if tparam0 != nil { if !versionErr && !buildcfg.Experiment.AliasTypeParams { @@ -531,8 +536,9 @@ func (check *Checker) typeDecl(obj *TypeName, tdecl *syntax.TypeDecl, def *TypeN rhs = check.definedType(tdecl.Type, obj) assert(rhs != nil) + alias.fromRHS = rhs - Unalias(alias) // resolve alias.actual + unalias(alias) // resolve alias.actual } else { if !versionErr && tparam0 != nil { check.error(tdecl, UnsupportedFeature, "generic type alias requires GODEBUG=gotypesalias=1 or unset") diff --git a/src/cmd/compile/internal/types2/expr.go b/src/cmd/compile/internal/types2/expr.go index eaa55e20c9..e5f9a1c6f7 100644 --- a/src/cmd/compile/internal/types2/expr.go +++ b/src/cmd/compile/internal/types2/expr.go @@ -895,6 +895,10 @@ func (check *Checker) matchTypes(x, y *operand) { if isTyped(x.typ) && isTyped(y.typ) { return false } + // A numeric type can only convert to another numeric type. + if allNumeric(x.typ) != allNumeric(y.typ) { + return false + } // An untyped operand may convert to its default type when paired with an empty interface // TODO(gri) This should only matter for comparisons (the only binary operation that is // valid with interfaces), but in that case the assignability check should take diff --git a/src/cmd/compile/internal/types2/named.go b/src/cmd/compile/internal/types2/named.go index a9a27c9320..dbb1fa0b3e 100644 --- a/src/cmd/compile/internal/types2/named.go +++ b/src/cmd/compile/internal/types2/named.go @@ -127,8 +127,8 @@ type Named struct { // accessed. methods []*Func - // loader may be provided to lazily load type parameters, underlying type, and methods. - loader func(*Named) (tparams []*TypeParam, underlying Type, methods []*Func) + // loader may be provided to lazily load type parameters, underlying type, methods, and delayed functions + loader func(*Named) ([]*TypeParam, Type, []*Func, []func()) } // instance holds information that is only necessary for instantiated named @@ -143,9 +143,11 @@ type instance struct { // namedState represents the possible states that a named type may assume. type namedState uint32 +// Note: the order of states is relevant const ( unresolved namedState = iota // tparams, underlying type and methods might be unavailable - resolved // resolve has run; methods might be incomplete (for instances) + resolved // resolve has run; methods might be unexpanded (for instances) + loaded // loader has run; constraints might be unexpanded (for generic types) complete // all data is known ) @@ -167,7 +169,7 @@ func NewNamed(obj *TypeName, underlying Type, methods []*Func) *Named { // accessible; but if n is an instantiated type, its methods may still be // unexpanded. func (n *Named) resolve() *Named { - if n.state() >= resolved { // avoid locking below + if n.state() > unresolved { // avoid locking below return n } @@ -176,7 +178,7 @@ func (n *Named) resolve() *Named { n.mu.Lock() defer n.mu.Unlock() - if n.state() >= resolved { + if n.state() > unresolved { return n } @@ -212,13 +214,20 @@ func (n *Named) resolve() *Named { assert(n.underlying == nil) assert(n.TypeArgs().Len() == 0) // instances are created by instantiation, in which case n.loader is nil - tparams, underlying, methods := n.loader(n) + tparams, underlying, methods, delayed := n.loader(n) + n.loader = nil n.tparams = bindTParams(tparams) n.underlying = underlying n.fromRHS = underlying // for cycle detection n.methods = methods - n.loader = nil + + // advance state to avoid deadlock calling delayed functions + n.setState(loaded) + + for _, f := range delayed { + f() + } } n.setState(complete) diff --git a/src/cmd/compile/internal/types2/object.go b/src/cmd/compile/internal/types2/object.go index 26752c44b0..7096c55697 100644 --- a/src/cmd/compile/internal/types2/object.go +++ b/src/cmd/compile/internal/types2/object.go @@ -293,7 +293,7 @@ func NewTypeName(pos syntax.Pos, pkg *Package, name string, typ Type) *TypeName // NewTypeNameLazy returns a new defined type like NewTypeName, but it // lazily calls resolve to finish constructing the Named object. -func NewTypeNameLazy(pos syntax.Pos, pkg *Package, name string, load func(named *Named) (tparams []*TypeParam, underlying Type, methods []*Func)) *TypeName { +func NewTypeNameLazy(pos syntax.Pos, pkg *Package, name string, load func(*Named) ([]*TypeParam, Type, []*Func, []func())) *TypeName { obj := NewTypeName(pos, pkg, name, nil) NewNamed(obj, nil, nil).loader = load return obj diff --git a/src/cmd/compile/internal/types2/range.go b/src/cmd/compile/internal/types2/range.go index dc0d81d05b..b654601eaf 100644 --- a/src/cmd/compile/internal/types2/range.go +++ b/src/cmd/compile/internal/types2/range.go @@ -9,7 +9,6 @@ package types2 import ( "cmd/compile/internal/syntax" "go/constant" - "internal/buildcfg" . "internal/types/errors" ) @@ -237,7 +236,7 @@ func rangeKeyVal(check *Checker, orig Type, allowVersion func(goVersion) bool) ( assert(typ.dir != SendOnly) return typ.elem, nil, "", true case *Signature: - if !buildcfg.Experiment.RangeFunc && allowVersion != nil && !allowVersion(go1_23) { + if allowVersion != nil && !allowVersion(go1_23) { return bad("requires go1.23 or later") } // check iterator arity diff --git a/src/cmd/compile/internal/walk/builtin.go b/src/cmd/compile/internal/walk/builtin.go index 84e7436103..974eb06886 100644 --- a/src/cmd/compile/internal/walk/builtin.go +++ b/src/cmd/compile/internal/walk/builtin.go @@ -9,7 +9,6 @@ import ( "go/constant" "go/token" "internal/abi" - "internal/buildcfg" "strings" "cmd/compile/internal/base" @@ -313,15 +312,8 @@ func walkMakeChan(n *ir.MakeExpr, init *ir.Nodes) ir.Node { // walkMakeMap walks an OMAKEMAP node. func walkMakeMap(n *ir.MakeExpr, init *ir.Nodes) ir.Node { - if buildcfg.Experiment.SwissMap { - return walkMakeSwissMap(n, init) - } - return walkMakeOldMap(n, init) -} - -func walkMakeSwissMap(n *ir.MakeExpr, init *ir.Nodes) ir.Node { t := n.Type() - mapType := reflectdata.SwissMapType() + mapType := reflectdata.MapType() hint := n.Len // var m *Map @@ -334,28 +326,28 @@ func walkMakeSwissMap(n *ir.MakeExpr, init *ir.Nodes) ir.Node { m = stackTempAddr(init, mapType) // Allocate one group pointed to by m.dirPtr on stack if hint - // is not larger than SwissMapGroupSlots. In case hint is + // is not larger than MapGroupSlots. In case hint is // larger, runtime.makemap will allocate on the heap. // Maximum key and elem size is 128 bytes, larger objects // are stored with an indirection. So max bucket size is 2048+eps. if !ir.IsConst(hint, constant.Int) || - constant.Compare(hint.Val(), token.LEQ, constant.MakeInt64(abi.SwissMapGroupSlots)) { + constant.Compare(hint.Val(), token.LEQ, constant.MakeInt64(abi.MapGroupSlots)) { - // In case hint is larger than SwissMapGroupSlots + // In case hint is larger than MapGroupSlots // runtime.makemap will allocate on the heap, see // #20184 // - // if hint <= abi.SwissMapGroupSlots { + // if hint <= abi.MapGroupSlots { // var gv group // g = &gv - // g.ctrl = abi.SwissMapCtrlEmpty + // g.ctrl = abi.MapCtrlEmpty // m.dirPtr = g // } - nif := ir.NewIfStmt(base.Pos, ir.NewBinaryExpr(base.Pos, ir.OLE, hint, ir.NewInt(base.Pos, abi.SwissMapGroupSlots)), nil, nil) + nif := ir.NewIfStmt(base.Pos, ir.NewBinaryExpr(base.Pos, ir.OLE, hint, ir.NewInt(base.Pos, abi.MapGroupSlots)), nil, nil) nif.Likely = true - groupType := reflectdata.SwissMapGroupType(t) + groupType := reflectdata.MapGroupType(t) // var gv group // g = &gv @@ -363,27 +355,27 @@ func walkMakeSwissMap(n *ir.MakeExpr, init *ir.Nodes) ir.Node { // Can't use ir.NewInt because bit 63 is set, which // makes conversion to uint64 upset. - empty := ir.NewBasicLit(base.Pos, types.UntypedInt, constant.MakeUint64(abi.SwissMapCtrlEmpty)) + empty := ir.NewBasicLit(base.Pos, types.UntypedInt, constant.MakeUint64(abi.MapCtrlEmpty)) - // g.ctrl = abi.SwissMapCtrlEmpty - csym := groupType.Field(0).Sym // g.ctrl see reflectdata/map_swiss.go + // g.ctrl = abi.MapCtrlEmpty + csym := groupType.Field(0).Sym // g.ctrl see reflectdata/map.go ca := ir.NewAssignStmt(base.Pos, ir.NewSelectorExpr(base.Pos, ir.ODOT, g, csym), empty) nif.Body.Append(ca) // m.dirPtr = g - dsym := mapType.Field(2).Sym // m.dirPtr see reflectdata/map_swiss.go + dsym := mapType.Field(2).Sym // m.dirPtr see reflectdata/map.go na := ir.NewAssignStmt(base.Pos, ir.NewSelectorExpr(base.Pos, ir.ODOT, m, dsym), typecheck.ConvNop(g, types.Types[types.TUNSAFEPTR])) nif.Body.Append(na) appendWalkStmt(init, nif) } } - if ir.IsConst(hint, constant.Int) && constant.Compare(hint.Val(), token.LEQ, constant.MakeInt64(abi.SwissMapGroupSlots)) { + if ir.IsConst(hint, constant.Int) && constant.Compare(hint.Val(), token.LEQ, constant.MakeInt64(abi.MapGroupSlots)) { // Handling make(map[any]any) and - // make(map[any]any, hint) where hint <= abi.SwissMapGroupSlots + // make(map[any]any, hint) where hint <= abi.MapGroupSlots // specially allows for faster map initialization and // improves binary size by using calls with fewer arguments. - // For hint <= abi.SwissMapGroupSlots no groups will be + // For hint <= abi.MapGroupSlots no groups will be // allocated by makemap. Therefore, no groups need to be // allocated in this code path. if n.Esc() == ir.EscNone { @@ -391,7 +383,7 @@ func walkMakeSwissMap(n *ir.MakeExpr, init *ir.Nodes) ir.Node { // m map has been allocated on the stack already. // m.seed = uintptr(rand()) rand := mkcall("rand", types.Types[types.TUINT64], init) - seedSym := mapType.Field(1).Sym // m.seed see reflectdata/map_swiss.go + seedSym := mapType.Field(1).Sym // m.seed see reflectdata/map.go appendWalkStmt(init, ir.NewAssignStmt(base.Pos, ir.NewSelectorExpr(base.Pos, ir.ODOT, m, seedSym), typecheck.Conv(rand, types.Types[types.TUINTPTR]))) return typecheck.ConvNop(m, t) } @@ -428,101 +420,6 @@ func walkMakeSwissMap(n *ir.MakeExpr, init *ir.Nodes) ir.Node { return mkcall1(fn, n.Type(), init, reflectdata.MakeMapRType(base.Pos, n), typecheck.Conv(hint, argtype), m) } -func walkMakeOldMap(n *ir.MakeExpr, init *ir.Nodes) ir.Node { - t := n.Type() - hmapType := reflectdata.OldMapType() - hint := n.Len - - // var h *hmap - var h ir.Node - if n.Esc() == ir.EscNone { - // Allocate hmap on stack. - - // var hv hmap - // h = &hv - h = stackTempAddr(init, hmapType) - - // Allocate one bucket pointed to by hmap.buckets on stack if hint - // is not larger than BUCKETSIZE. In case hint is larger than - // BUCKETSIZE runtime.makemap will allocate the buckets on the heap. - // Maximum key and elem size is 128 bytes, larger objects - // are stored with an indirection. So max bucket size is 2048+eps. - if !ir.IsConst(hint, constant.Int) || - constant.Compare(hint.Val(), token.LEQ, constant.MakeInt64(abi.OldMapBucketCount)) { - - // In case hint is larger than BUCKETSIZE runtime.makemap - // will allocate the buckets on the heap, see #20184 - // - // if hint <= BUCKETSIZE { - // var bv bmap - // b = &bv - // h.buckets = b - // } - - nif := ir.NewIfStmt(base.Pos, ir.NewBinaryExpr(base.Pos, ir.OLE, hint, ir.NewInt(base.Pos, abi.OldMapBucketCount)), nil, nil) - nif.Likely = true - - // var bv bmap - // b = &bv - b := stackTempAddr(&nif.Body, reflectdata.OldMapBucketType(t)) - - // h.buckets = b - bsym := hmapType.Field(5).Sym // hmap.buckets see reflect.go:hmap - na := ir.NewAssignStmt(base.Pos, ir.NewSelectorExpr(base.Pos, ir.ODOT, h, bsym), typecheck.ConvNop(b, types.Types[types.TUNSAFEPTR])) - nif.Body.Append(na) - appendWalkStmt(init, nif) - } - } - - if ir.IsConst(hint, constant.Int) && constant.Compare(hint.Val(), token.LEQ, constant.MakeInt64(abi.OldMapBucketCount)) { - // Handling make(map[any]any) and - // make(map[any]any, hint) where hint <= BUCKETSIZE - // special allows for faster map initialization and - // improves binary size by using calls with fewer arguments. - // For hint <= BUCKETSIZE overLoadFactor(hint, 0) is false - // and no buckets will be allocated by makemap. Therefore, - // no buckets need to be allocated in this code path. - if n.Esc() == ir.EscNone { - // Only need to initialize h.hash0 since - // hmap h has been allocated on the stack already. - // h.hash0 = rand32() - rand := mkcall("rand32", types.Types[types.TUINT32], init) - hashsym := hmapType.Field(4).Sym // hmap.hash0 see reflect.go:hmap - appendWalkStmt(init, ir.NewAssignStmt(base.Pos, ir.NewSelectorExpr(base.Pos, ir.ODOT, h, hashsym), rand)) - return typecheck.ConvNop(h, t) - } - // Call runtime.makemap_small to allocate an - // hmap on the heap and initialize hmap's hash0 field. - fn := typecheck.LookupRuntime("makemap_small", t.Key(), t.Elem()) - return mkcall1(fn, n.Type(), init) - } - - if n.Esc() != ir.EscNone { - h = typecheck.NodNil() - } - // Map initialization with a variable or large hint is - // more complicated. We therefore generate a call to - // runtime.makemap to initialize hmap and allocate the - // map buckets. - - // When hint fits into int, use makemap instead of - // makemap64, which is faster and shorter on 32 bit platforms. - fnname := "makemap64" - argtype := types.Types[types.TINT64] - - // Type checking guarantees that TIDEAL hint is positive and fits in an int. - // See checkmake call in TMAP case of OMAKE case in OpSwitch in typecheck1 function. - // The case of hint overflow when converting TUINT or TUINTPTR to TINT - // will be handled by the negative range checks in makemap during runtime. - if hint.Type().IsKind(types.TIDEAL) || hint.Type().Size() <= types.Types[types.TUINT].Size() { - fnname = "makemap" - argtype = types.Types[types.TINT] - } - - fn := typecheck.LookupRuntime(fnname, hmapType, t.Key(), t.Elem()) - return mkcall1(fn, n.Type(), init, reflectdata.MakeMapRType(base.Pos, n), typecheck.Conv(hint, argtype), h) -} - // walkMakeSlice walks an OMAKESLICE node. func walkMakeSlice(n *ir.MakeExpr, init *ir.Nodes) ir.Node { len := n.Len @@ -860,9 +757,9 @@ func walkPrint(nn *ir.CallExpr, init *ir.Nodes) ir.Node { return walkStmt(typecheck.Stmt(r)) } -// walkRecoverFP walks an ORECOVERFP node. -func walkRecoverFP(nn *ir.CallExpr, init *ir.Nodes) ir.Node { - return mkcall("gorecover", nn.Type(), init, walkExpr(nn.Args[0], init)) +// walkRecover walks an ORECOVER node. +func walkRecover(nn *ir.CallExpr, init *ir.Nodes) ir.Node { + return mkcall("gorecover", nn.Type(), init) } // walkUnsafeData walks an OUNSAFESLICEDATA or OUNSAFESTRINGDATA expression. diff --git a/src/cmd/compile/internal/walk/expr.go b/src/cmd/compile/internal/walk/expr.go index 6775bc4fc8..fbfc56a39c 100644 --- a/src/cmd/compile/internal/walk/expr.go +++ b/src/cmd/compile/internal/walk/expr.go @@ -182,8 +182,8 @@ func walkExpr1(n ir.Node, init *ir.Nodes) ir.Node { n := n.(*ir.UnaryExpr) return mkcall("gopanic", nil, init, n.X) - case ir.ORECOVERFP: - return walkRecoverFP(n.(*ir.CallExpr), init) + case ir.ORECOVER: + return walkRecover(n.(*ir.CallExpr), init) case ir.OCFUNC: return n diff --git a/src/cmd/compile/internal/walk/order.go b/src/cmd/compile/internal/walk/order.go index cb022faddf..4b0e36da85 100644 --- a/src/cmd/compile/internal/walk/order.go +++ b/src/cmd/compile/internal/walk/order.go @@ -8,7 +8,6 @@ import ( "fmt" "go/constant" "internal/abi" - "internal/buildcfg" "cmd/compile/internal/base" "cmd/compile/internal/ir" @@ -846,7 +845,7 @@ func (o *orderState) stmt(n ir.Node) { o.out = append(o.out, n) o.popTemp(t) - case ir.OPRINT, ir.OPRINTLN, ir.ORECOVERFP: + case ir.OPRINT, ir.OPRINTLN, ir.ORECOVER: n := n.(*ir.CallExpr) t := o.markTemp() o.call(n) @@ -968,11 +967,7 @@ func (o *orderState) stmt(n ir.Node) { // n.Prealloc is the temp for the iterator. // MapIterType contains pointers and needs to be zeroed. - if buildcfg.Experiment.SwissMap { - n.Prealloc = o.newTemp(reflectdata.SwissMapIterType(), true) - } else { - n.Prealloc = o.newTemp(reflectdata.OldMapIterType(), true) - } + n.Prealloc = o.newTemp(reflectdata.MapIterType(), true) } n.Key = o.exprInPlace(n.Key) n.Value = o.exprInPlace(n.Value) @@ -1355,7 +1350,7 @@ func (o *orderState) expr1(n, lhs ir.Node) ir.Node { ir.OMIN, ir.ONEW, ir.OREAL, - ir.ORECOVERFP, + ir.ORECOVER, ir.OSTR2BYTES, ir.OSTR2BYTESTMP, ir.OSTR2RUNES: diff --git a/src/cmd/compile/internal/walk/range.go b/src/cmd/compile/internal/walk/range.go index 3d3547b84b..139343a8ed 100644 --- a/src/cmd/compile/internal/walk/range.go +++ b/src/cmd/compile/internal/walk/range.go @@ -6,7 +6,6 @@ package walk import ( "go/constant" - "internal/buildcfg" "unicode/utf8" "cmd/compile/internal/base" @@ -247,20 +246,11 @@ func walkRange(nrange *ir.RangeStmt) ir.Node { hit := nrange.Prealloc th := hit.Type() // depends on layout of iterator struct. - // See cmd/compile/internal/reflectdata/reflect.go:MapIterType - var keysym, elemsym *types.Sym - var iterInit, iterNext string - if buildcfg.Experiment.SwissMap { - keysym = th.Field(0).Sym - elemsym = th.Field(1).Sym // ditto - iterInit = "mapIterStart" - iterNext = "mapIterNext" - } else { - keysym = th.Field(0).Sym - elemsym = th.Field(1).Sym // ditto - iterInit = "mapiterinit" - iterNext = "mapiternext" - } + // See cmd/compile/internal/reflectdata/map.go:MapIterType + keysym := th.Field(0).Sym + elemsym := th.Field(1).Sym // ditto + iterInit := "mapIterStart" + iterNext := "mapIterNext" fn := typecheck.LookupRuntime(iterInit, t.Key(), t.Elem(), th) init = append(init, mkcallstmt1(fn, reflectdata.RangeMapRType(base.Pos, nrange), ha, typecheck.NodAddr(hit))) diff --git a/src/cmd/compile/internal/walk/stmt.go b/src/cmd/compile/internal/walk/stmt.go index b2a226e078..2c01fd10f1 100644 --- a/src/cmd/compile/internal/walk/stmt.go +++ b/src/cmd/compile/internal/walk/stmt.go @@ -50,7 +50,7 @@ func walkStmt(n ir.Node) ir.Node { ir.OPRINT, ir.OPRINTLN, ir.OPANIC, - ir.ORECOVERFP, + ir.ORECOVER, ir.OGETG: if n.Typecheck() == 0 { base.Fatalf("missing typecheck: %+v", n) diff --git a/src/cmd/compile/internal/walk/walk.go b/src/cmd/compile/internal/walk/walk.go index 8b4381980d..25add3d804 100644 --- a/src/cmd/compile/internal/walk/walk.go +++ b/src/cmd/compile/internal/walk/walk.go @@ -7,7 +7,6 @@ package walk import ( "fmt" "internal/abi" - "internal/buildcfg" "cmd/compile/internal/base" "cmd/compile/internal/ir" @@ -192,42 +191,7 @@ var mapassign = mkmapnames("mapassign", "ptr") var mapdelete = mkmapnames("mapdelete", "") func mapfast(t *types.Type) int { - if buildcfg.Experiment.SwissMap { - return mapfastSwiss(t) - } - return mapfastOld(t) -} - -func mapfastSwiss(t *types.Type) int { - if t.Elem().Size() > abi.OldMapMaxElemBytes { - return mapslow - } - switch reflectdata.AlgType(t.Key()) { - case types.AMEM32: - if !t.Key().HasPointers() { - return mapfast32 - } - if types.PtrSize == 4 { - return mapfast32ptr - } - base.Fatalf("small pointer %v", t.Key()) - case types.AMEM64: - if !t.Key().HasPointers() { - return mapfast64 - } - if types.PtrSize == 8 { - return mapfast64ptr - } - // Two-word object, at least one of which is a pointer. - // Use the slow path. - case types.ASTRING: - return mapfaststr - } - return mapslow -} - -func mapfastOld(t *types.Type) int { - if t.Elem().Size() > abi.OldMapMaxElemBytes { + if t.Elem().Size() > abi.MapMaxElemBytes { return mapslow } switch reflectdata.AlgType(t.Key()) { diff --git a/src/cmd/compile/internal/x86/ssa.go b/src/cmd/compile/internal/x86/ssa.go index 347c5cb560..3347b38b28 100644 --- a/src/cmd/compile/internal/x86/ssa.go +++ b/src/cmd/compile/internal/x86/ssa.go @@ -16,6 +16,7 @@ import ( "cmd/compile/internal/types" "cmd/internal/obj" "cmd/internal/obj/x86" + "internal/abi" ) // ssaMarkMoves marks any MOVXconst ops that need to avoid clobbering flags. @@ -740,19 +741,165 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) { // AuxInt encodes how many buffer entries we need. p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1] - case ssa.Op386LoweredPanicBoundsA, ssa.Op386LoweredPanicBoundsB, ssa.Op386LoweredPanicBoundsC: - p := s.Prog(obj.ACALL) - p.To.Type = obj.TYPE_MEM - p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt] - s.UseArgs(8) // space used in callee args area by assembly stubs + case ssa.Op386LoweredPanicBoundsRR, ssa.Op386LoweredPanicBoundsRC, ssa.Op386LoweredPanicBoundsCR, ssa.Op386LoweredPanicBoundsCC, + ssa.Op386LoweredPanicExtendRR, ssa.Op386LoweredPanicExtendRC: + // Compute the constant we put in the PCData entry for this call. + code, signed := ssa.BoundsKind(v.AuxInt).Code() + xIsReg := false + yIsReg := false + xVal := 0 + yVal := 0 + extend := false + switch v.Op { + case ssa.Op386LoweredPanicBoundsRR: + xIsReg = true + xVal = int(v.Args[0].Reg() - x86.REG_AX) + yIsReg = true + yVal = int(v.Args[1].Reg() - x86.REG_AX) + case ssa.Op386LoweredPanicExtendRR: + extend = true + xIsReg = true + hi := int(v.Args[0].Reg() - x86.REG_AX) + lo := int(v.Args[1].Reg() - x86.REG_AX) + xVal = hi<<2 + lo // encode 2 register numbers + yIsReg = true + yVal = int(v.Args[2].Reg() - x86.REG_AX) + case ssa.Op386LoweredPanicBoundsRC: + xIsReg = true + xVal = int(v.Args[0].Reg() - x86.REG_AX) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + if yVal == xVal { + yVal = 1 + } + p := s.Prog(x86.AMOVL) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(yVal) + } + case ssa.Op386LoweredPanicExtendRC: + extend = true + xIsReg = true + hi := int(v.Args[0].Reg() - x86.REG_AX) + lo := int(v.Args[1].Reg() - x86.REG_AX) + xVal = hi<<2 + lo // encode 2 register numbers + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + for yVal == hi || yVal == lo { + yVal++ + } + p := s.Prog(x86.AMOVL) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(yVal) + } + case ssa.Op386LoweredPanicBoundsCR: + yIsReg = true + yVal := int(v.Args[0].Reg() - x86.REG_AX) + c := v.Aux.(ssa.PanicBoundsC).C + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else if signed && int64(int32(c)) == c || !signed && int64(uint32(c)) == c { + // Move constant to a register + xIsReg = true + if xVal == yVal { + xVal = 1 + } + p := s.Prog(x86.AMOVL) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(xVal) + } else { + // Move constant to two registers + extend = true + xIsReg = true + hi := 0 + lo := 1 + if hi == yVal { + hi = 2 + } + if lo == yVal { + lo = 2 + } + xVal = hi<<2 + lo + p := s.Prog(x86.AMOVL) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c >> 32 + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(hi) + p = s.Prog(x86.AMOVL) + p.From.Type = obj.TYPE_CONST + p.From.Offset = int64(int32(c)) + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(lo) + } + case ssa.Op386LoweredPanicBoundsCC: + c := v.Aux.(ssa.PanicBoundsCC).Cx + if c >= 0 && c <= abi.BoundsMaxConst { + xVal = int(c) + } else if signed && int64(int32(c)) == c || !signed && int64(uint32(c)) == c { + // Move constant to a register + xIsReg = true + p := s.Prog(x86.AMOVL) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(xVal) + } else { + // Move constant to two registers + extend = true + xIsReg = true + hi := 0 + lo := 1 + xVal = hi<<2 + lo + p := s.Prog(x86.AMOVL) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c >> 32 + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(hi) + p = s.Prog(x86.AMOVL) + p.From.Type = obj.TYPE_CONST + p.From.Offset = int64(int32(c)) + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(lo) + } + c = v.Aux.(ssa.PanicBoundsCC).Cy + if c >= 0 && c <= abi.BoundsMaxConst { + yVal = int(c) + } else { + // Move constant to a register + yIsReg = true + yVal = 2 + p := s.Prog(x86.AMOVL) + p.From.Type = obj.TYPE_CONST + p.From.Offset = c + p.To.Type = obj.TYPE_REG + p.To.Reg = x86.REG_AX + int16(yVal) + } + } + c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal) - case ssa.Op386LoweredPanicExtendA, ssa.Op386LoweredPanicExtendB, ssa.Op386LoweredPanicExtendC: - p := s.Prog(obj.ACALL) + p := s.Prog(obj.APCDATA) + p.From.SetConst(abi.PCDATA_PanicBounds) + p.To.SetConst(int64(c)) + p = s.Prog(obj.ACALL) p.To.Type = obj.TYPE_MEM p.To.Name = obj.NAME_EXTERN - p.To.Sym = ssagen.ExtendCheckFunc[v.AuxInt] - s.UseArgs(12) // space used in callee args area by assembly stubs + if extend { + p.To.Sym = ir.Syms.PanicExtend + } else { + p.To.Sym = ir.Syms.PanicBounds + } case ssa.Op386CALLstatic, ssa.Op386CALLclosure, ssa.Op386CALLinter: s.Call(v) diff --git a/src/cmd/doc/doc.go b/src/cmd/doc/doc.go deleted file mode 100644 index ac15ad9c7d..0000000000 --- a/src/cmd/doc/doc.go +++ /dev/null @@ -1,55 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Doc (usually run as go doc) accepts zero, one or two arguments. -// -// Zero arguments: -// -// go doc -// -// Show the documentation for the package in the current directory. -// -// One argument: -// -// go doc <pkg> -// go doc <sym>[.<methodOrField>] -// go doc [<pkg>.]<sym>[.<methodOrField>] -// go doc [<pkg>.][<sym>.]<methodOrField> -// -// The first item in this list that succeeds is the one whose documentation -// is printed. If there is a symbol but no package, the package in the current -// directory is chosen. However, if the argument begins with a capital -// letter it is always assumed to be a symbol in the current directory. -// -// Two arguments: -// -// go doc <pkg> <sym>[.<methodOrField>] -// -// Show the documentation for the package, symbol, and method or field. The -// first argument must be a full package path. This is similar to the -// command-line usage for the godoc command. -// -// For commands, unless the -cmd flag is present "go doc command" -// shows only the package-level docs for the package. -// -// The -src flag causes doc to print the full source code for the symbol, such -// as the body of a struct, function or method. -// -// The -all flag causes doc to print all documentation for the package and -// all its visible symbols. The argument must identify a package. -// -// For complete documentation, run "go help doc". -package main - -import ( - "cmd/internal/doc" - "cmd/internal/telemetry/counter" - "os" -) - -func main() { - counter.Open() - counter.Inc("doc/invocations") - doc.Main(os.Args[1:]) -} diff --git a/src/cmd/go/internal/base/base.go b/src/cmd/go/internal/base/base.go index 83cbad401e..d5d5f8d36e 100644 --- a/src/cmd/go/internal/base/base.go +++ b/src/cmd/go/internal/base/base.go @@ -62,11 +62,11 @@ var Go = &Command{ // Lookup returns the subcommand with the given name, if any. // Otherwise it returns nil. // -// Lookup ignores subcommands that have len(c.Commands) == 0 and c.Run == nil. +// Lookup ignores any subcommand `sub` that has len(sub.Commands) == 0 and sub.Run == nil. // Such subcommands are only for use as arguments to "help". func (c *Command) Lookup(name string) *Command { for _, sub := range c.Commands { - if sub.Name() == name && (len(c.Commands) > 0 || c.Runnable()) { + if sub.Name() == name && (len(sub.Commands) > 0 || sub.Runnable()) { return sub } } diff --git a/src/cmd/go/internal/clean/clean.go b/src/cmd/go/internal/clean/clean.go index 63e2dfdbc7..c6f311e026 100644 --- a/src/cmd/go/internal/clean/clean.go +++ b/src/cmd/go/internal/clean/clean.go @@ -120,6 +120,7 @@ func init() { } func runClean(ctx context.Context, cmd *base.Command, args []string) { + modload.InitWorkfile() if len(args) > 0 { cacheFlag := "" switch { diff --git a/src/cmd/internal/doc/dirs.go b/src/cmd/go/internal/doc/dirs.go index 8b1670f61c..8b1670f61c 100644 --- a/src/cmd/internal/doc/dirs.go +++ b/src/cmd/go/internal/doc/dirs.go diff --git a/src/cmd/go/internal/doc/doc.go b/src/cmd/go/internal/doc/doc.go index 74c70e2c7a..37501065fe 100644 --- a/src/cmd/go/internal/doc/doc.go +++ b/src/cmd/go/internal/doc/doc.go @@ -2,15 +2,26 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build !cmd_go_bootstrap - // Package doc implements the “go doc” command. package doc import ( - "cmd/go/internal/base" - "cmd/internal/doc" + "bytes" "context" + "flag" + "fmt" + "go/build" + "go/token" + "io" + "log" + "os" + "os/exec" + "path" + "path/filepath" + "strings" + + "cmd/go/internal/base" + "cmd/internal/telemetry/counter" ) var CmdDoc = &base.Command{ @@ -136,5 +147,431 @@ Flags: } func runDoc(ctx context.Context, cmd *base.Command, args []string) { - doc.Main(args) + log.SetFlags(0) + log.SetPrefix("doc: ") + dirsInit() + var flagSet flag.FlagSet + err := do(os.Stdout, &flagSet, args) + if err != nil { + log.Fatal(err) + } +} + +var ( + unexported bool // -u flag + matchCase bool // -c flag + chdir string // -C flag + showAll bool // -all flag + showCmd bool // -cmd flag + showSrc bool // -src flag + short bool // -short flag + serveHTTP bool // -http flag +) + +// usage is a replacement usage function for the flags package. +func usage(flagSet *flag.FlagSet) { + fmt.Fprintf(os.Stderr, "Usage of [go] doc:\n") + fmt.Fprintf(os.Stderr, "\tgo doc\n") + fmt.Fprintf(os.Stderr, "\tgo doc <pkg>\n") + fmt.Fprintf(os.Stderr, "\tgo doc <sym>[.<methodOrField>]\n") + fmt.Fprintf(os.Stderr, "\tgo doc [<pkg>.]<sym>[.<methodOrField>]\n") + fmt.Fprintf(os.Stderr, "\tgo doc [<pkg>.][<sym>.]<methodOrField>\n") + fmt.Fprintf(os.Stderr, "\tgo doc <pkg> <sym>[.<methodOrField>]\n") + fmt.Fprintf(os.Stderr, "For more information run\n") + fmt.Fprintf(os.Stderr, "\tgo help doc\n\n") + fmt.Fprintf(os.Stderr, "Flags:\n") + flagSet.PrintDefaults() + os.Exit(2) +} + +// do is the workhorse, broken out of runDoc to make testing easier. +func do(writer io.Writer, flagSet *flag.FlagSet, args []string) (err error) { + flagSet.Usage = func() { usage(flagSet) } + unexported = false + matchCase = false + flagSet.StringVar(&chdir, "C", "", "change to `dir` before running command") + flagSet.BoolVar(&unexported, "u", false, "show unexported symbols as well as exported") + flagSet.BoolVar(&matchCase, "c", false, "symbol matching honors case (paths not affected)") + flagSet.BoolVar(&showAll, "all", false, "show all documentation for package") + flagSet.BoolVar(&showCmd, "cmd", false, "show symbols with package docs even if package is a command") + flagSet.BoolVar(&showSrc, "src", false, "show source code for symbol") + flagSet.BoolVar(&short, "short", false, "one-line representation for each symbol") + flagSet.BoolVar(&serveHTTP, "http", false, "serve HTML docs over HTTP") + flagSet.Parse(args) + counter.CountFlags("doc/flag:", *flag.CommandLine) + if chdir != "" { + if err := os.Chdir(chdir); err != nil { + return err + } + } + if serveHTTP { + // Special case: if there are no arguments, try to go to an appropriate page + // depending on whether we're in a module or workspace. The pkgsite homepage + // is often not the most useful page. + if len(flagSet.Args()) == 0 { + mod, err := runCmd(append(os.Environ(), "GOWORK=off"), "go", "list", "-m") + if err == nil && mod != "" && mod != "command-line-arguments" { + // If there's a module, go to the module's doc page. + return doPkgsite(mod) + } + gowork, err := runCmd(nil, "go", "env", "GOWORK") + if err == nil && gowork != "" { + // Outside a module, but in a workspace, go to the home page + // with links to each of the modules' pages. + return doPkgsite("") + } + // Outside a module or workspace, go to the documentation for the standard library. + return doPkgsite("std") + } + + // If args are provided, we need to figure out which page to open on the pkgsite + // instance. Run the logic below to determine a match for a symbol, method, + // or field, but don't actually print the documentation to the output. + writer = io.Discard + } + var paths []string + var symbol, method string + // Loop until something is printed. + dirs.Reset() + for i := 0; ; i++ { + buildPackage, userPath, sym, more := parseArgs(flagSet, flagSet.Args()) + if i > 0 && !more { // Ignore the "more" bit on the first iteration. + return failMessage(paths, symbol, method) + } + if buildPackage == nil { + return fmt.Errorf("no such package: %s", userPath) + } + + // The builtin package needs special treatment: its symbols are lower + // case but we want to see them, always. + if buildPackage.ImportPath == "builtin" { + unexported = true + } + + symbol, method = parseSymbol(flagSet, sym) + pkg := parsePackage(writer, buildPackage, userPath) + paths = append(paths, pkg.prettyPath()) + + defer func() { + pkg.flush() + e := recover() + if e == nil { + return + } + pkgError, ok := e.(PackageError) + if ok { + err = pkgError + return + } + panic(e) + }() + + var found bool + switch { + case symbol == "": + pkg.packageDoc() // The package exists, so we got some output. + found = true + case method == "": + if pkg.symbolDoc(symbol) { + found = true + } + case pkg.printMethodDoc(symbol, method): + found = true + case pkg.printFieldDoc(symbol, method): + found = true + } + if found { + if serveHTTP { + path, err := objectPath(userPath, pkg, symbol, method) + if err != nil { + return err + } + return doPkgsite(path) + } + return nil + } + } +} + +func runCmd(env []string, cmdline ...string) (string, error) { + var stdout, stderr strings.Builder + cmd := exec.Command(cmdline[0], cmdline[1:]...) + cmd.Env = env + cmd.Stdout = &stdout + cmd.Stderr = &stderr + if err := cmd.Run(); err != nil { + return "", fmt.Errorf("go doc: %s: %v\n%s\n", strings.Join(cmdline, " "), err, stderr.String()) + } + return strings.TrimSpace(stdout.String()), nil +} + +func objectPath(userPath string, pkg *Package, symbol, method string) (string, error) { + var err error + path := pkg.build.ImportPath + if path == "." { + // go/build couldn't determine the import path, probably + // because this was a relative path into a module. Use + // go list to get the import path. + path, err = runCmd(nil, "go", "list", userPath) + if err != nil { + return "", err + } + } + + object := symbol + if symbol != "" && method != "" { + object = symbol + "." + method + } + if object != "" { + path = path + "#" + object + } + return path, nil +} + +// failMessage creates a nicely formatted error message when there is no result to show. +func failMessage(paths []string, symbol, method string) error { + var b bytes.Buffer + if len(paths) > 1 { + b.WriteString("s") + } + b.WriteString(" ") + for i, path := range paths { + if i > 0 { + b.WriteString(", ") + } + b.WriteString(path) + } + if method == "" { + return fmt.Errorf("no symbol %s in package%s", symbol, &b) + } + return fmt.Errorf("no method or field %s.%s in package%s", symbol, method, &b) +} + +// parseArgs analyzes the arguments (if any) and returns the package +// it represents, the part of the argument the user used to identify +// the path (or "" if it's the current package) and the symbol +// (possibly with a .method) within that package. +// parseSymbol is used to analyze the symbol itself. +// The boolean final argument reports whether it is possible that +// there may be more directories worth looking at. It will only +// be true if the package path is a partial match for some directory +// and there may be more matches. For example, if the argument +// is rand.Float64, we must scan both crypto/rand and math/rand +// to find the symbol, and the first call will return crypto/rand, true. +func parseArgs(flagSet *flag.FlagSet, args []string) (pkg *build.Package, path, symbol string, more bool) { + wd, err := os.Getwd() + if err != nil { + log.Fatal(err) + } + if len(args) == 0 { + // Easy: current directory. + return importDir(wd), "", "", false + } + arg := args[0] + // We have an argument. If it is a directory name beginning with . or .., + // use the absolute path name. This discriminates "./errors" from "errors" + // if the current directory contains a non-standard errors package. + if isDotSlash(arg) { + arg = filepath.Join(wd, arg) + } + switch len(args) { + default: + usage(flagSet) + case 1: + // Done below. + case 2: + // Package must be findable and importable. + pkg, err := build.Import(args[0], wd, build.ImportComment) + if err == nil { + return pkg, args[0], args[1], false + } + for { + packagePath, ok := findNextPackage(arg) + if !ok { + break + } + if pkg, err := build.ImportDir(packagePath, build.ImportComment); err == nil { + return pkg, arg, args[1], true + } + } + return nil, args[0], args[1], false + } + // Usual case: one argument. + // If it contains slashes, it begins with either a package path + // or an absolute directory. + // First, is it a complete package path as it is? If so, we are done. + // This avoids confusion over package paths that have other + // package paths as their prefix. + var importErr error + if filepath.IsAbs(arg) { + pkg, importErr = build.ImportDir(arg, build.ImportComment) + if importErr == nil { + return pkg, arg, "", false + } + } else { + pkg, importErr = build.Import(arg, wd, build.ImportComment) + if importErr == nil { + return pkg, arg, "", false + } + } + // Another disambiguator: If the argument starts with an upper + // case letter, it can only be a symbol in the current directory. + // Kills the problem caused by case-insensitive file systems + // matching an upper case name as a package name. + if !strings.ContainsAny(arg, `/\`) && token.IsExported(arg) { + pkg, err := build.ImportDir(".", build.ImportComment) + if err == nil { + return pkg, "", arg, false + } + } + // If it has a slash, it must be a package path but there is a symbol. + // It's the last package path we care about. + slash := strings.LastIndex(arg, "/") + // There may be periods in the package path before or after the slash + // and between a symbol and method. + // Split the string at various periods to see what we find. + // In general there may be ambiguities but this should almost always + // work. + var period int + // slash+1: if there's no slash, the value is -1 and start is 0; otherwise + // start is the byte after the slash. + for start := slash + 1; start < len(arg); start = period + 1 { + period = strings.Index(arg[start:], ".") + symbol := "" + if period < 0 { + period = len(arg) + } else { + period += start + symbol = arg[period+1:] + } + // Have we identified a package already? + pkg, err := build.Import(arg[0:period], wd, build.ImportComment) + if err == nil { + return pkg, arg[0:period], symbol, false + } + // See if we have the basename or tail of a package, as in json for encoding/json + // or ivy/value for robpike.io/ivy/value. + pkgName := arg[:period] + for { + path, ok := findNextPackage(pkgName) + if !ok { + break + } + if pkg, err = build.ImportDir(path, build.ImportComment); err == nil { + return pkg, arg[0:period], symbol, true + } + } + dirs.Reset() // Next iteration of for loop must scan all the directories again. + } + // If it has a slash, we've failed. + if slash >= 0 { + // build.Import should always include the path in its error message, + // and we should avoid repeating it. Unfortunately, build.Import doesn't + // return a structured error. That can't easily be fixed, since it + // invokes 'go list' and returns the error text from the loaded package. + // TODO(golang.org/issue/34750): load using golang.org/x/tools/go/packages + // instead of go/build. + importErrStr := importErr.Error() + if strings.Contains(importErrStr, arg[:period]) { + log.Fatal(importErrStr) + } else { + log.Fatalf("no such package %s: %s", arg[:period], importErrStr) + } + } + // Guess it's a symbol in the current directory. + return importDir(wd), "", arg, false +} + +// dotPaths lists all the dotted paths legal on Unix-like and +// Windows-like file systems. We check them all, as the chance +// of error is minute and even on Windows people will use ./ +// sometimes. +var dotPaths = []string{ + `./`, + `../`, + `.\`, + `..\`, +} + +// isDotSlash reports whether the path begins with a reference +// to the local . or .. directory. +func isDotSlash(arg string) bool { + if arg == "." || arg == ".." { + return true + } + for _, dotPath := range dotPaths { + if strings.HasPrefix(arg, dotPath) { + return true + } + } + return false +} + +// importDir is just an error-catching wrapper for build.ImportDir. +func importDir(dir string) *build.Package { + pkg, err := build.ImportDir(dir, build.ImportComment) + if err != nil { + log.Fatal(err) + } + return pkg +} + +// parseSymbol breaks str apart into a symbol and method. +// Both may be missing or the method may be missing. +// If present, each must be a valid Go identifier. +func parseSymbol(flagSet *flag.FlagSet, str string) (symbol, method string) { + if str == "" { + return + } + elem := strings.Split(str, ".") + switch len(elem) { + case 1: + case 2: + method = elem[1] + default: + log.Printf("too many periods in symbol specification") + usage(flagSet) + } + symbol = elem[0] + return +} + +// isExported reports whether the name is an exported identifier. +// If the unexported flag (-u) is true, isExported returns true because +// it means that we treat the name as if it is exported. +func isExported(name string) bool { + return unexported || token.IsExported(name) +} + +// findNextPackage returns the next full file name path that matches the +// (perhaps partial) package path pkg. The boolean reports if any match was found. +func findNextPackage(pkg string) (string, bool) { + if filepath.IsAbs(pkg) { + if dirs.offset == 0 { + dirs.offset = -1 + return pkg, true + } + return "", false + } + if pkg == "" || token.IsExported(pkg) { // Upper case symbol cannot be a package name. + return "", false + } + pkg = path.Clean(pkg) + pkgSuffix := "/" + pkg + for { + d, ok := dirs.Next() + if !ok { + return "", false + } + if d.importPath == pkg || strings.HasSuffix(d.importPath, pkgSuffix) { + return d.dir, true + } + } +} + +var buildCtx = build.Default + +// splitGopath splits $GOPATH into a list of roots. +func splitGopath() []string { + return filepath.SplitList(buildCtx.GOPATH) } diff --git a/src/cmd/internal/doc/doc_test.go b/src/cmd/go/internal/doc/doc_test.go index bccace40c0..f91dcd658f 100644 --- a/src/cmd/internal/doc/doc_test.go +++ b/src/cmd/go/internal/doc/doc_test.go @@ -29,7 +29,7 @@ func TestMain(m *testing.M) { buildCtx.GOROOT = testenv.GOROOT(nil) build.Default.GOROOT = testenv.GOROOT(nil) - // Add $GOROOT/src/cmd/doc/testdata explicitly so we can access its contents in the test. + // Add $GOROOT/src/cmd/go/internal/doc/testdata explicitly so we can access its contents in the test. // Normally testdata directories are ignored, but sending it to dirs.scan directly is // a hack that works around the check. testdataDir, err := filepath.Abs("testdata") @@ -90,7 +90,7 @@ type test struct { no []string // Regular expressions that should not match. } -const p = "cmd/internal/doc/testdata" +const p = "cmd/go/internal/doc/testdata" var tests = []test{ // Sanity check. @@ -105,7 +105,7 @@ var tests = []test{ { "package clause", []string{p}, - []string{`package pkg.*cmd/internal/doc/testdata`}, + []string{`package pkg.*cmd/go/internal/doc/testdata`}, nil, }, diff --git a/src/cmd/internal/doc/pkg.go b/src/cmd/go/internal/doc/pkg.go index 953b0d9a28..953b0d9a28 100644 --- a/src/cmd/internal/doc/pkg.go +++ b/src/cmd/go/internal/doc/pkg.go diff --git a/src/cmd/go/internal/doc/pkgsite.go b/src/cmd/go/internal/doc/pkgsite.go new file mode 100644 index 0000000000..6769536ca5 --- /dev/null +++ b/src/cmd/go/internal/doc/pkgsite.go @@ -0,0 +1,93 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !cmd_go_bootstrap + +package doc + +import ( + "errors" + "fmt" + "net" + "net/url" + "os" + "os/exec" + "os/signal" + "path/filepath" + "strings" +) + +// pickUnusedPort finds an unused port by trying to listen on port 0 +// and letting the OS pick a port, then closing that connection and +// returning that port number. +// This is inherently racy. +func pickUnusedPort() (int, error) { + l, err := net.Listen("tcp", "localhost:0") + if err != nil { + return 0, err + } + port := l.Addr().(*net.TCPAddr).Port + if err := l.Close(); err != nil { + return 0, err + } + return port, nil +} + +func doPkgsite(urlPath string) error { + port, err := pickUnusedPort() + if err != nil { + return fmt.Errorf("failed to find port for documentation server: %v", err) + } + addr := fmt.Sprintf("localhost:%d", port) + path, err := url.JoinPath("http://"+addr, urlPath) + if err != nil { + return fmt.Errorf("internal error: failed to construct url: %v", err) + } + + // Turn off the default signal handler for SIGINT (and SIGQUIT on Unix) + // and instead wait for the child process to handle the signal and + // exit before exiting ourselves. + signal.Ignore(signalsToIgnore...) + + // Prepend the local download cache to GOPROXY to get around deprecation checks. + env := os.Environ() + vars, err := runCmd(env, goCmd(), "env", "GOPROXY", "GOMODCACHE") + fields := strings.Fields(vars) + if err == nil && len(fields) == 2 { + goproxy, gomodcache := fields[0], fields[1] + gomodcache = filepath.Join(gomodcache, "cache", "download") + // Convert absolute path to file URL. pkgsite will not accept + // Windows absolute paths because they look like a host:path remote. + // TODO(golang.org/issue/32456): use url.FromFilePath when implemented. + if strings.HasPrefix(gomodcache, "/") { + gomodcache = "file://" + gomodcache + } else { + gomodcache = "file:///" + filepath.ToSlash(gomodcache) + } + env = append(env, "GOPROXY="+gomodcache+","+goproxy) + } + + const version = "v0.0.0-20250714212547-01b046e81fe7" + cmd := exec.Command(goCmd(), "run", "golang.org/x/pkgsite/cmd/internal/doc@"+version, + "-gorepo", buildCtx.GOROOT, + "-http", addr, + "-open", path) + cmd.Env = env + cmd.Stdout = os.Stderr + cmd.Stderr = os.Stderr + + if err := cmd.Run(); err != nil { + var ee *exec.ExitError + if errors.As(err, &ee) { + // Exit with the same exit status as pkgsite to avoid + // printing of "exit status" error messages. + // Any relevant messages have already been printed + // to stdout or stderr. + os.Exit(ee.ExitCode()) + } + return err + } + + return nil +} diff --git a/src/cmd/go/internal/doc/doc_bootstrap.go b/src/cmd/go/internal/doc/pkgsite_bootstrap.go index 8be95dc9a6..c909d6184a 100644 --- a/src/cmd/go/internal/doc/doc_bootstrap.go +++ b/src/cmd/go/internal/doc/pkgsite_bootstrap.go @@ -4,10 +4,8 @@ //go:build cmd_go_bootstrap -// Don't build cmd/doc into go_bootstrap because it depends on net. +// Don't build the pkgsite code into go_bootstrap because it depends on net. package doc -import "cmd/go/internal/base" - -var CmdDoc = &base.Command{} +func doPkgsite(string) error { return nil } diff --git a/src/cmd/internal/doc/signal_notunix.go b/src/cmd/go/internal/doc/signal_notunix.go index b91a67eb5f..b91a67eb5f 100644 --- a/src/cmd/internal/doc/signal_notunix.go +++ b/src/cmd/go/internal/doc/signal_notunix.go diff --git a/src/cmd/internal/doc/signal_unix.go b/src/cmd/go/internal/doc/signal_unix.go index f30612ce9d..f30612ce9d 100644 --- a/src/cmd/internal/doc/signal_unix.go +++ b/src/cmd/go/internal/doc/signal_unix.go diff --git a/src/cmd/internal/doc/testdata/merge/aa.go b/src/cmd/go/internal/doc/testdata/merge/aa.go index f8ab92dfd0..f8ab92dfd0 100644 --- a/src/cmd/internal/doc/testdata/merge/aa.go +++ b/src/cmd/go/internal/doc/testdata/merge/aa.go diff --git a/src/cmd/internal/doc/testdata/merge/bb.go b/src/cmd/go/internal/doc/testdata/merge/bb.go index fd8cf3c446..fd8cf3c446 100644 --- a/src/cmd/internal/doc/testdata/merge/bb.go +++ b/src/cmd/go/internal/doc/testdata/merge/bb.go diff --git a/src/cmd/internal/doc/testdata/nested/empty/empty.go b/src/cmd/go/internal/doc/testdata/nested/empty/empty.go index 609cf0e0a0..609cf0e0a0 100644 --- a/src/cmd/internal/doc/testdata/nested/empty/empty.go +++ b/src/cmd/go/internal/doc/testdata/nested/empty/empty.go diff --git a/src/cmd/internal/doc/testdata/nested/ignore.go b/src/cmd/go/internal/doc/testdata/nested/ignore.go index 5fa811d0a8..5fa811d0a8 100644 --- a/src/cmd/internal/doc/testdata/nested/ignore.go +++ b/src/cmd/go/internal/doc/testdata/nested/ignore.go diff --git a/src/cmd/internal/doc/testdata/nested/nested/real.go b/src/cmd/go/internal/doc/testdata/nested/nested/real.go index 1e5546081c..1e5546081c 100644 --- a/src/cmd/internal/doc/testdata/nested/nested/real.go +++ b/src/cmd/go/internal/doc/testdata/nested/nested/real.go diff --git a/src/cmd/internal/doc/testdata/pkg.go b/src/cmd/go/internal/doc/testdata/pkg.go index 4d269ff0a2..4d269ff0a2 100644 --- a/src/cmd/internal/doc/testdata/pkg.go +++ b/src/cmd/go/internal/doc/testdata/pkg.go diff --git a/src/cmd/go/internal/gover/mod.go b/src/cmd/go/internal/gover/mod.go index d3cc17068d..3ac5ae8824 100644 --- a/src/cmd/go/internal/gover/mod.go +++ b/src/cmd/go/internal/gover/mod.go @@ -109,6 +109,9 @@ func ModIsPrefix(path, vers string) bool { // The caller is assumed to have checked that ModIsValid(path, vers) is true. func ModIsPrerelease(path, vers string) bool { if IsToolchain(path) { + if path == "toolchain" { + return IsPrerelease(FromToolchain(vers)) + } return IsPrerelease(vers) } return semver.Prerelease(vers) != "" diff --git a/src/cmd/go/internal/modcmd/edit.go b/src/cmd/go/internal/modcmd/edit.go index f73269378a..aafd9752a8 100644 --- a/src/cmd/go/internal/modcmd/edit.go +++ b/src/cmd/go/internal/modcmd/edit.go @@ -234,7 +234,11 @@ func runEdit(ctx context.Context, cmd *base.Command, args []string) { } if *editModule != "" { - if err := module.CheckImportPath(*editModule); err != nil { + err := module.CheckImportPath(*editModule) + if err == nil { + err = modload.CheckReservedModulePath(*editModule) + } + if err != nil { base.Fatalf("go: invalid -module: %v", err) } } diff --git a/src/cmd/go/internal/modload/init.go b/src/cmd/go/internal/modload/init.go index 3cf447e648..cb9d74df68 100644 --- a/src/cmd/go/internal/modload/init.go +++ b/src/cmd/go/internal/modload/init.go @@ -149,7 +149,7 @@ type MainModuleSet struct { // highest replaced version of each module path; empty string for wildcard-only replacements highestReplaced map[string]string - indexMu sync.Mutex + indexMu sync.RWMutex indices map[module.Version]*modFileIndex } @@ -228,8 +228,8 @@ func (mms *MainModuleSet) GetSingleIndexOrNil() *modFileIndex { } func (mms *MainModuleSet) Index(m module.Version) *modFileIndex { - mms.indexMu.Lock() - defer mms.indexMu.Unlock() + mms.indexMu.RLock() + defer mms.indexMu.RUnlock() return mms.indices[m] } @@ -1122,6 +1122,16 @@ func errWorkTooOld(gomod string, wf *modfile.WorkFile, goVers string) error { base.ShortPath(filepath.Dir(gomod)), goVers, verb, gover.FromGoWork(wf)) } +// CheckReservedModulePath checks whether the module path is a reserved module path +// that can't be used for a user's module. +func CheckReservedModulePath(path string) error { + if gover.IsToolchain(path) { + return errors.New("module path is reserved") + } + + return nil +} + // CreateModFile initializes a new module by creating a go.mod file. // // If modPath is empty, CreateModFile will attempt to infer the path from the @@ -1156,6 +1166,8 @@ func CreateModFile(ctx context.Context, modPath string) { } } base.Fatal(err) + } else if err := CheckReservedModulePath(modPath); err != nil { + base.Fatalf(`go: invalid module path %q: `, modPath) } else if _, _, ok := module.SplitPathVersion(modPath); !ok { if strings.HasPrefix(modPath, "gopkg.in/") { invalidMajorVersionMsg := fmt.Errorf("module paths beginning with gopkg.in/ must always have a major version suffix in the form of .vN:\n\tgo mod init %s", suggestGopkgIn(modPath)) diff --git a/src/cmd/go/internal/modload/modfile.go b/src/cmd/go/internal/modload/modfile.go index cb385c3505..04e204cc98 100644 --- a/src/cmd/go/internal/modload/modfile.go +++ b/src/cmd/go/internal/modload/modfile.go @@ -68,6 +68,8 @@ func ReadModFile(gomod string, fix modfile.VersionFixer) (data []byte, f *modfil if f.Module == nil { // No module declaration. Must add module path. return nil, nil, fmt.Errorf("error reading %s: missing module declaration. To specify the module path:\n\tgo mod edit -module=example.com/mod", base.ShortPath(gomod)) + } else if err := CheckReservedModulePath(f.Module.Mod.Path); err != nil { + return nil, nil, fmt.Errorf("error reading %s: invalid module path: %q", base.ShortPath(gomod), f.Module.Mod.Path) } return data, f, err diff --git a/src/cmd/go/internal/telemetrystats/telemetrystats.go b/src/cmd/go/internal/telemetrystats/telemetrystats.go index 950453fa95..d5b642240f 100644 --- a/src/cmd/go/internal/telemetrystats/telemetrystats.go +++ b/src/cmd/go/internal/telemetrystats/telemetrystats.go @@ -11,6 +11,7 @@ import ( "cmd/go/internal/cfg" "cmd/go/internal/modload" "cmd/internal/telemetry/counter" + "strings" ) func Increment() { @@ -48,4 +49,16 @@ func incrementConfig() { case "wasm": counter.Inc("go/platform/target/gowasm:" + cfg.GOWASM) } + + // Use cfg.Experiment.String instead of cfg.Experiment.Enabled + // because we only want to count the experiments that differ + // from the baseline. + if cfg.Experiment != nil { + for exp := range strings.SplitSeq(cfg.Experiment.String(), ",") { + if exp == "" { + continue + } + counter.Inc("go/goexperiment:" + exp) + } + } } diff --git a/src/cmd/go/internal/tool/tool.go b/src/cmd/go/internal/tool/tool.go index 16e1a4f47f..120ef5339b 100644 --- a/src/cmd/go/internal/tool/tool.go +++ b/src/cmd/go/internal/tool/tool.go @@ -277,6 +277,29 @@ func loadModTool(ctx context.Context, name string) string { return "" } +func builtTool(runAction *work.Action) string { + linkAction := runAction.Deps[0] + if toolN { + // #72824: If -n is set, use the cached path if we can. + // This is only necessary if the binary wasn't cached + // before this invocation of the go command: if the binary + // was cached, BuiltTarget() will be the cached executable. + // It's only in the "first run", where we actually do the build + // and save the result to the cache that BuiltTarget is not + // the cached binary. Ideally, we would set BuiltTarget + // to the cached path even in the first run, but if we + // copy the binary to the cached path, and try to run it + // in the same process, we'll run into the dreaded #22315 + // resulting in occasional ETXTBSYs. Instead of getting the + // ETXTBSY and then retrying just don't use the cached path + // on the first run if we're going to actually run the binary. + if cached := linkAction.CachedExecutable(); cached != "" { + return cached + } + } + return linkAction.BuiltTarget() +} + func buildAndRunBuiltinTool(ctx context.Context, toolName, tool string, args []string) { // Override GOOS and GOARCH for the build to build the tool using // the same GOOS and GOARCH as this go command. @@ -288,7 +311,7 @@ func buildAndRunBuiltinTool(ctx context.Context, toolName, tool string, args []s modload.RootMode = modload.NoRoot runFunc := func(b *work.Builder, ctx context.Context, a *work.Action) error { - cmdline := str.StringList(a.Deps[0].BuiltTarget(), a.Args) + cmdline := str.StringList(builtTool(a), a.Args) return runBuiltTool(toolName, nil, cmdline) } @@ -300,7 +323,7 @@ func buildAndRunModtool(ctx context.Context, toolName, tool string, args []strin // Use the ExecCmd to run the binary, as go run does. ExecCmd allows users // to provide a runner to run the binary, for example a simulator for binaries // that are cross-compiled to a different platform. - cmdline := str.StringList(work.FindExecCmd(), a.Deps[0].BuiltTarget(), a.Args) + cmdline := str.StringList(work.FindExecCmd(), builtTool(a), a.Args) // Use same environment go run uses to start the executable: // the original environment with cfg.GOROOTbin added to the path. env := slices.Clip(cfg.OrigEnv) diff --git a/src/cmd/go/internal/work/action.go b/src/cmd/go/internal/work/action.go index 2426720021..ecc3337131 100644 --- a/src/cmd/go/internal/work/action.go +++ b/src/cmd/go/internal/work/action.go @@ -97,11 +97,12 @@ type Action struct { CacheExecutable bool // Whether to cache executables produced by link steps // Generated files, directories. - Objdir string // directory for intermediate objects - Target string // goal of the action: the created package or executable - built string // the actual created package or executable - actionID cache.ActionID // cache ID of action input - buildID string // build ID of action output + Objdir string // directory for intermediate objects + Target string // goal of the action: the created package or executable + built string // the actual created package or executable + cachedExecutable string // the cached executable, if CacheExecutable was set + actionID cache.ActionID // cache ID of action input + buildID string // build ID of action output VetxOnly bool // Mode=="vet": only being called to supply info about dependencies needVet bool // Mode=="build": need to fill in vet config @@ -133,6 +134,10 @@ func (a *Action) BuildID() string { return a.buildID } // from Target when the result was cached. func (a *Action) BuiltTarget() string { return a.built } +// CachedExecutable returns the cached executable, if CacheExecutable +// was set and the executable could be cached, and "" otherwise. +func (a *Action) CachedExecutable() string { return a.cachedExecutable } + // An actionQueue is a priority queue of actions. type actionQueue []*Action diff --git a/src/cmd/go/internal/work/buildid.go b/src/cmd/go/internal/work/buildid.go index 0bf9ba1781..c272131c77 100644 --- a/src/cmd/go/internal/work/buildid.go +++ b/src/cmd/go/internal/work/buildid.go @@ -745,8 +745,9 @@ func (b *Builder) updateBuildID(a *Action, target string) error { } outputID, _, err := c.PutExecutable(a.actionID, name+cfg.ExeSuffix, r) r.Close() + a.cachedExecutable = c.OutputFile(outputID) if err == nil && cfg.BuildX { - sh.ShowCmd("", "%s # internal", joinUnambiguously(str.StringList("cp", target, c.OutputFile(outputID)))) + sh.ShowCmd("", "%s # internal", joinUnambiguously(str.StringList("cp", target, a.cachedExecutable))) } } } diff --git a/src/cmd/go/internal/work/shell.go b/src/cmd/go/internal/work/shell.go index 284ed26f22..e75b1c33fc 100644 --- a/src/cmd/go/internal/work/shell.go +++ b/src/cmd/go/internal/work/shell.go @@ -132,47 +132,11 @@ func (sh *Shell) moveOrCopyFile(dst, src string, perm fs.FileMode, force bool) e return sh.CopyFile(dst, src, perm, force) } - // On Windows, always copy the file, so that we respect the NTFS - // permissions of the parent folder. https://golang.org/issue/22343. - // What matters here is not cfg.Goos (the system we are building - // for) but runtime.GOOS (the system we are building on). - if runtime.GOOS == "windows" { - return sh.CopyFile(dst, src, perm, force) - } - - // If the destination directory has the group sticky bit set, - // we have to copy the file to retain the correct permissions. - // https://golang.org/issue/18878 - if fi, err := os.Stat(filepath.Dir(dst)); err == nil { - if fi.IsDir() && (fi.Mode()&fs.ModeSetgid) != 0 { - return sh.CopyFile(dst, src, perm, force) - } - } - - // The perm argument is meant to be adjusted according to umask, - // but we don't know what the umask is. - // Create a dummy file to find out. - // This avoids build tags and works even on systems like Plan 9 - // where the file mask computation incorporates other information. - mode := perm - f, err := os.OpenFile(filepath.Clean(dst)+"-go-tmp-umask", os.O_WRONLY|os.O_CREATE|os.O_EXCL, perm) - if err == nil { - fi, err := f.Stat() - if err == nil { - mode = fi.Mode() & 0777 - } - name := f.Name() - f.Close() - os.Remove(name) - } - - if err := os.Chmod(src, mode); err == nil { - if err := os.Rename(src, dst); err == nil { - if cfg.BuildX { - sh.ShowCmd("", "mv %s %s", src, dst) - } - return nil + if err := sh.move(src, dst, perm); err == nil { + if cfg.BuildX { + sh.ShowCmd("", "mv %s %s", src, dst) } + return nil } return sh.CopyFile(dst, src, perm, force) diff --git a/src/cmd/go/internal/work/shell_nonwindows.go b/src/cmd/go/internal/work/shell_nonwindows.go new file mode 100644 index 0000000000..c517fbe196 --- /dev/null +++ b/src/cmd/go/internal/work/shell_nonwindows.go @@ -0,0 +1,49 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !windows + +package work + +import ( + "errors" + "io/fs" + "os" + "path/filepath" +) + +// move moves a file from src to dst setting the permissions +// on the destination file to inherit the permissions from the +// destination parent directory. +func (sh *Shell) move(src, dst string, perm fs.FileMode) error { + // If the destination directory has the group sticky bit set, + // we have to copy the file to retain the correct permissions. + // https://golang.org/issue/18878 + if fi, err := os.Stat(filepath.Dir(dst)); err == nil { + if fi.IsDir() && (fi.Mode()&fs.ModeSetgid) != 0 { + return errors.ErrUnsupported + } + } + // The perm argument is meant to be adjusted according to umask, + // but we don't know what the umask is. + // Create a dummy file to find out. + // This works even on systems like Plan 9 where the + // file mask computation incorporates other information. + mode := perm + f, err := os.OpenFile(filepath.Clean(dst)+"-go-tmp-umask", os.O_WRONLY|os.O_CREATE|os.O_EXCL, perm) + if err == nil { + fi, err := f.Stat() + if err == nil { + mode = fi.Mode() & 0777 + } + name := f.Name() + f.Close() + os.Remove(name) + } + + if err := os.Chmod(src, mode); err != nil { + return err + } + return os.Rename(src, dst) +} diff --git a/src/cmd/go/internal/work/shell_windows.go b/src/cmd/go/internal/work/shell_windows.go new file mode 100644 index 0000000000..9b80eab07f --- /dev/null +++ b/src/cmd/go/internal/work/shell_windows.go @@ -0,0 +1,37 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package work + +import ( + "internal/syscall/windows" + "io/fs" + "os" + "unsafe" +) + +// move moves a file from src to dst, setting the security information +// on the destination file to inherit the permissions from the +// destination parent directory. +func (sh *Shell) move(src, dst string, perm fs.FileMode) (err error) { + if err := os.Rename(src, dst); err != nil { + return err + } + defer func() { + if err != nil { + os.Remove(dst) // clean up if we failed to set the mode or security info + } + }() + if err := os.Chmod(dst, perm); err != nil { + return err + } + // We need to respect the ACL permissions of the destination parent folder. + // https://go.dev/issue/22343. + var acl windows.ACL + if err := windows.InitializeAcl(&acl, uint32(unsafe.Sizeof(acl)), windows.ACL_REVISION); err != nil { + return err + } + secInfo := windows.DACL_SECURITY_INFORMATION | windows.UNPROTECTED_DACL_SECURITY_INFORMATION + return windows.SetNamedSecurityInfo(dst, windows.SE_FILE_OBJECT, secInfo, nil, nil, &acl, nil) +} diff --git a/src/cmd/go/testdata/script/mod_get_toolchain.txt b/src/cmd/go/testdata/script/mod_get_toolchain.txt index 87e84ae15e..83cef4a0fd 100644 --- a/src/cmd/go/testdata/script/mod_get_toolchain.txt +++ b/src/cmd/go/testdata/script/mod_get_toolchain.txt @@ -94,12 +94,14 @@ stderr '^go: added toolchain go1.24rc1$' grep 'go 1.22.9' go.mod # no longer implied grep 'toolchain go1.24rc1' go.mod -# go get toolchain@latest finds go1.999testmod. +# go get toolchain@latest finds go1.23.9. cp go.mod.orig go.mod go get toolchain@latest -stderr '^go: added toolchain go1.999testmod$' +stderr '^go: added toolchain go1.23.9$' grep 'go 1.21' go.mod -grep 'toolchain go1.999testmod' go.mod +grep 'toolchain go1.23.9' go.mod + + # Bug fixes. @@ -115,7 +117,7 @@ stderr '^go: upgraded go 1.19 => 1.21.0' # go get toolchain@1.24rc1 is OK too. go get toolchain@1.24rc1 -stderr '^go: downgraded toolchain go1.999testmod => go1.24rc1$' +stderr '^go: upgraded toolchain go1.23.9 => go1.24rc1$' # go get go@1.21 should work if we are the Go 1.21 language version, # even though there's no toolchain for it. diff --git a/src/cmd/go/testdata/script/mod_init_issue74784.txt b/src/cmd/go/testdata/script/mod_init_issue74784.txt new file mode 100644 index 0000000000..f7863636e5 --- /dev/null +++ b/src/cmd/go/testdata/script/mod_init_issue74784.txt @@ -0,0 +1,26 @@ +# Don't allow the creation of modules with special "go" or "toolchain" paths. +! go mod init go +! stderr 'panic' +stderr 'invalid module path' + +! go mod init toolchain +! stderr 'panic' +stderr 'invalid module path' + +# A module that contains the path element "go" is okay. +go mod init example.com/go +stderr 'creating new go.mod' + +# go mod edit won't allow a reserved module path either +! go mod edit -module=go +stderr 'invalid -module' + +# The go command should check for work modules for bad +# names to return a proper error and avoid a panic. +cp badmod.txt go.mod +! go list +! stderr panic +stderr 'invalid module path' + +-- badmod.txt -- +module go diff --git a/src/cmd/go/testdata/script/tool_n_issue72824.txt b/src/cmd/go/testdata/script/tool_n_issue72824.txt new file mode 100644 index 0000000000..0c90fce290 --- /dev/null +++ b/src/cmd/go/testdata/script/tool_n_issue72824.txt @@ -0,0 +1,27 @@ +[short] skip 'does a build in using an empty cache' + +# Start with a fresh cache because we want to verify the behavior +# when the tool hasn't been cached previously. +env GOCACHE=$WORK${/}cache + +# Even when the tool hasn't been previously cached but was built and +# saved to the cache in the invocation of 'go tool -n' we should return +# its cached location. +go tool -n foo +stdout $GOCACHE + +# And of course we should also return the cached location on subsequent +# runs. +go tool -n foo +stdout $GOCACHE + +-- go.mod -- +module example.com/foo + +go 1.25 + +tool example.com/foo +-- main.go -- +package main + +func main() {}
\ No newline at end of file diff --git a/src/cmd/internal/doc/main.go b/src/cmd/internal/doc/main.go deleted file mode 100644 index 5032000cda..0000000000 --- a/src/cmd/internal/doc/main.go +++ /dev/null @@ -1,532 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package doc provides the implementation of the "go doc" subcommand and cmd/doc. -package doc - -import ( - "bytes" - "errors" - "flag" - "fmt" - "go/build" - "go/token" - "io" - "log" - "net" - "net/url" - "os" - "os/exec" - "os/signal" - "path" - "path/filepath" - "strings" - - "cmd/internal/telemetry/counter" -) - -var ( - unexported bool // -u flag - matchCase bool // -c flag - chdir string // -C flag - showAll bool // -all flag - showCmd bool // -cmd flag - showSrc bool // -src flag - short bool // -short flag - serveHTTP bool // -http flag -) - -// usage is a replacement usage function for the flags package. -func usage(flagSet *flag.FlagSet) { - fmt.Fprintf(os.Stderr, "Usage of [go] doc:\n") - fmt.Fprintf(os.Stderr, "\tgo doc\n") - fmt.Fprintf(os.Stderr, "\tgo doc <pkg>\n") - fmt.Fprintf(os.Stderr, "\tgo doc <sym>[.<methodOrField>]\n") - fmt.Fprintf(os.Stderr, "\tgo doc [<pkg>.]<sym>[.<methodOrField>]\n") - fmt.Fprintf(os.Stderr, "\tgo doc [<pkg>.][<sym>.]<methodOrField>\n") - fmt.Fprintf(os.Stderr, "\tgo doc <pkg> <sym>[.<methodOrField>]\n") - fmt.Fprintf(os.Stderr, "For more information run\n") - fmt.Fprintf(os.Stderr, "\tgo help doc\n\n") - fmt.Fprintf(os.Stderr, "Flags:\n") - flagSet.PrintDefaults() - os.Exit(2) -} - -// Main is the entry point, invoked both by go doc and cmd/doc. -func Main(args []string) { - log.SetFlags(0) - log.SetPrefix("doc: ") - dirsInit() - var flagSet flag.FlagSet - err := do(os.Stdout, &flagSet, args) - if err != nil { - log.Fatal(err) - } -} - -// do is the workhorse, broken out of main to make testing easier. -func do(writer io.Writer, flagSet *flag.FlagSet, args []string) (err error) { - flagSet.Usage = func() { usage(flagSet) } - unexported = false - matchCase = false - flagSet.StringVar(&chdir, "C", "", "change to `dir` before running command") - flagSet.BoolVar(&unexported, "u", false, "show unexported symbols as well as exported") - flagSet.BoolVar(&matchCase, "c", false, "symbol matching honors case (paths not affected)") - flagSet.BoolVar(&showAll, "all", false, "show all documentation for package") - flagSet.BoolVar(&showCmd, "cmd", false, "show symbols with package docs even if package is a command") - flagSet.BoolVar(&showSrc, "src", false, "show source code for symbol") - flagSet.BoolVar(&short, "short", false, "one-line representation for each symbol") - flagSet.BoolVar(&serveHTTP, "http", false, "serve HTML docs over HTTP") - flagSet.Parse(args) - counter.CountFlags("doc/flag:", *flag.CommandLine) - if chdir != "" { - if err := os.Chdir(chdir); err != nil { - return err - } - } - if serveHTTP { - // Special case: if there are no arguments, try to go to an appropriate page - // depending on whether we're in a module or workspace. The pkgsite homepage - // is often not the most useful page. - if len(flagSet.Args()) == 0 { - mod, err := runCmd(append(os.Environ(), "GOWORK=off"), "go", "list", "-m") - if err == nil && mod != "" && mod != "command-line-arguments" { - // If there's a module, go to the module's doc page. - return doPkgsite(mod) - } - gowork, err := runCmd(nil, "go", "env", "GOWORK") - if err == nil && gowork != "" { - // Outside a module, but in a workspace, go to the home page - // with links to each of the modules' pages. - return doPkgsite("") - } - // Outside a module or workspace, go to the documentation for the standard library. - return doPkgsite("std") - } - - // If args are provided, we need to figure out which page to open on the pkgsite - // instance. Run the logic below to determine a match for a symbol, method, - // or field, but don't actually print the documentation to the output. - writer = io.Discard - } - var paths []string - var symbol, method string - // Loop until something is printed. - dirs.Reset() - for i := 0; ; i++ { - buildPackage, userPath, sym, more := parseArgs(flagSet, flagSet.Args()) - if i > 0 && !more { // Ignore the "more" bit on the first iteration. - return failMessage(paths, symbol, method) - } - if buildPackage == nil { - return fmt.Errorf("no such package: %s", userPath) - } - - // The builtin package needs special treatment: its symbols are lower - // case but we want to see them, always. - if buildPackage.ImportPath == "builtin" { - unexported = true - } - - symbol, method = parseSymbol(flagSet, sym) - pkg := parsePackage(writer, buildPackage, userPath) - paths = append(paths, pkg.prettyPath()) - - defer func() { - pkg.flush() - e := recover() - if e == nil { - return - } - pkgError, ok := e.(PackageError) - if ok { - err = pkgError - return - } - panic(e) - }() - - var found bool - switch { - case symbol == "": - pkg.packageDoc() // The package exists, so we got some output. - found = true - case method == "": - if pkg.symbolDoc(symbol) { - found = true - } - case pkg.printMethodDoc(symbol, method): - found = true - case pkg.printFieldDoc(symbol, method): - found = true - } - if found { - if serveHTTP { - path, err := objectPath(userPath, pkg, symbol, method) - if err != nil { - return err - } - return doPkgsite(path) - } - return nil - } - } -} - -func runCmd(env []string, cmdline ...string) (string, error) { - var stdout, stderr strings.Builder - cmd := exec.Command(cmdline[0], cmdline[1:]...) - cmd.Env = env - cmd.Stdout = &stdout - cmd.Stderr = &stderr - if err := cmd.Run(); err != nil { - return "", fmt.Errorf("go doc: %s: %v\n%s\n", strings.Join(cmdline, " "), err, stderr.String()) - } - return strings.TrimSpace(stdout.String()), nil -} - -func objectPath(userPath string, pkg *Package, symbol, method string) (string, error) { - var err error - path := pkg.build.ImportPath - if path == "." { - // go/build couldn't determine the import path, probably - // because this was a relative path into a module. Use - // go list to get the import path. - path, err = runCmd(nil, "go", "list", userPath) - if err != nil { - return "", err - } - } - - object := symbol - if symbol != "" && method != "" { - object = symbol + "." + method - } - if object != "" { - path = path + "#" + object - } - return path, nil -} - -func doPkgsite(urlPath string) error { - port, err := pickUnusedPort() - if err != nil { - return fmt.Errorf("failed to find port for documentation server: %v", err) - } - addr := fmt.Sprintf("localhost:%d", port) - path, err := url.JoinPath("http://"+addr, urlPath) - if err != nil { - return fmt.Errorf("internal error: failed to construct url: %v", err) - } - - // Turn off the default signal handler for SIGINT (and SIGQUIT on Unix) - // and instead wait for the child process to handle the signal and - // exit before exiting ourselves. - signal.Ignore(signalsToIgnore...) - - // Prepend the local download cache to GOPROXY to get around deprecation checks. - env := os.Environ() - vars, err := runCmd(env, goCmd(), "env", "GOPROXY", "GOMODCACHE") - fields := strings.Fields(vars) - if err == nil && len(fields) == 2 { - goproxy, gomodcache := fields[0], fields[1] - gomodcache = filepath.Join(gomodcache, "cache", "download") - // Convert absolute path to file URL. pkgsite will not accept - // Windows absolute paths because they look like a host:path remote. - // TODO(golang.org/issue/32456): use url.FromFilePath when implemented. - if strings.HasPrefix(gomodcache, "/") { - gomodcache = "file://" + gomodcache - } else { - gomodcache = "file:///" + filepath.ToSlash(gomodcache) - } - env = append(env, "GOPROXY="+gomodcache+","+goproxy) - } - - const version = "v0.0.0-20250608123103-82c52f1754cd" - cmd := exec.Command(goCmd(), "run", "golang.org/x/pkgsite/cmd/internal/doc@"+version, - "-gorepo", buildCtx.GOROOT, - "-http", addr, - "-open", path) - cmd.Env = env - cmd.Stdout = os.Stderr - cmd.Stderr = os.Stderr - - if err := cmd.Run(); err != nil { - var ee *exec.ExitError - if errors.As(err, &ee) { - // Exit with the same exit status as pkgsite to avoid - // printing of "exit status" error messages. - // Any relevant messages have already been printed - // to stdout or stderr. - os.Exit(ee.ExitCode()) - } - return err - } - - return nil -} - -// pickUnusedPort finds an unused port by trying to listen on port 0 -// and letting the OS pick a port, then closing that connection and -// returning that port number. -// This is inherently racy. -func pickUnusedPort() (int, error) { - l, err := net.Listen("tcp", "localhost:0") - if err != nil { - return 0, err - } - port := l.Addr().(*net.TCPAddr).Port - if err := l.Close(); err != nil { - return 0, err - } - return port, nil -} - -// failMessage creates a nicely formatted error message when there is no result to show. -func failMessage(paths []string, symbol, method string) error { - var b bytes.Buffer - if len(paths) > 1 { - b.WriteString("s") - } - b.WriteString(" ") - for i, path := range paths { - if i > 0 { - b.WriteString(", ") - } - b.WriteString(path) - } - if method == "" { - return fmt.Errorf("no symbol %s in package%s", symbol, &b) - } - return fmt.Errorf("no method or field %s.%s in package%s", symbol, method, &b) -} - -// parseArgs analyzes the arguments (if any) and returns the package -// it represents, the part of the argument the user used to identify -// the path (or "" if it's the current package) and the symbol -// (possibly with a .method) within that package. -// parseSymbol is used to analyze the symbol itself. -// The boolean final argument reports whether it is possible that -// there may be more directories worth looking at. It will only -// be true if the package path is a partial match for some directory -// and there may be more matches. For example, if the argument -// is rand.Float64, we must scan both crypto/rand and math/rand -// to find the symbol, and the first call will return crypto/rand, true. -func parseArgs(flagSet *flag.FlagSet, args []string) (pkg *build.Package, path, symbol string, more bool) { - wd, err := os.Getwd() - if err != nil { - log.Fatal(err) - } - if len(args) == 0 { - // Easy: current directory. - return importDir(wd), "", "", false - } - arg := args[0] - // We have an argument. If it is a directory name beginning with . or .., - // use the absolute path name. This discriminates "./errors" from "errors" - // if the current directory contains a non-standard errors package. - if isDotSlash(arg) { - arg = filepath.Join(wd, arg) - } - switch len(args) { - default: - usage(flagSet) - case 1: - // Done below. - case 2: - // Package must be findable and importable. - pkg, err := build.Import(args[0], wd, build.ImportComment) - if err == nil { - return pkg, args[0], args[1], false - } - for { - packagePath, ok := findNextPackage(arg) - if !ok { - break - } - if pkg, err := build.ImportDir(packagePath, build.ImportComment); err == nil { - return pkg, arg, args[1], true - } - } - return nil, args[0], args[1], false - } - // Usual case: one argument. - // If it contains slashes, it begins with either a package path - // or an absolute directory. - // First, is it a complete package path as it is? If so, we are done. - // This avoids confusion over package paths that have other - // package paths as their prefix. - var importErr error - if filepath.IsAbs(arg) { - pkg, importErr = build.ImportDir(arg, build.ImportComment) - if importErr == nil { - return pkg, arg, "", false - } - } else { - pkg, importErr = build.Import(arg, wd, build.ImportComment) - if importErr == nil { - return pkg, arg, "", false - } - } - // Another disambiguator: If the argument starts with an upper - // case letter, it can only be a symbol in the current directory. - // Kills the problem caused by case-insensitive file systems - // matching an upper case name as a package name. - if !strings.ContainsAny(arg, `/\`) && token.IsExported(arg) { - pkg, err := build.ImportDir(".", build.ImportComment) - if err == nil { - return pkg, "", arg, false - } - } - // If it has a slash, it must be a package path but there is a symbol. - // It's the last package path we care about. - slash := strings.LastIndex(arg, "/") - // There may be periods in the package path before or after the slash - // and between a symbol and method. - // Split the string at various periods to see what we find. - // In general there may be ambiguities but this should almost always - // work. - var period int - // slash+1: if there's no slash, the value is -1 and start is 0; otherwise - // start is the byte after the slash. - for start := slash + 1; start < len(arg); start = period + 1 { - period = strings.Index(arg[start:], ".") - symbol := "" - if period < 0 { - period = len(arg) - } else { - period += start - symbol = arg[period+1:] - } - // Have we identified a package already? - pkg, err := build.Import(arg[0:period], wd, build.ImportComment) - if err == nil { - return pkg, arg[0:period], symbol, false - } - // See if we have the basename or tail of a package, as in json for encoding/json - // or ivy/value for robpike.io/ivy/value. - pkgName := arg[:period] - for { - path, ok := findNextPackage(pkgName) - if !ok { - break - } - if pkg, err = build.ImportDir(path, build.ImportComment); err == nil { - return pkg, arg[0:period], symbol, true - } - } - dirs.Reset() // Next iteration of for loop must scan all the directories again. - } - // If it has a slash, we've failed. - if slash >= 0 { - // build.Import should always include the path in its error message, - // and we should avoid repeating it. Unfortunately, build.Import doesn't - // return a structured error. That can't easily be fixed, since it - // invokes 'go list' and returns the error text from the loaded package. - // TODO(golang.org/issue/34750): load using golang.org/x/tools/go/packages - // instead of go/build. - importErrStr := importErr.Error() - if strings.Contains(importErrStr, arg[:period]) { - log.Fatal(importErrStr) - } else { - log.Fatalf("no such package %s: %s", arg[:period], importErrStr) - } - } - // Guess it's a symbol in the current directory. - return importDir(wd), "", arg, false -} - -// dotPaths lists all the dotted paths legal on Unix-like and -// Windows-like file systems. We check them all, as the chance -// of error is minute and even on Windows people will use ./ -// sometimes. -var dotPaths = []string{ - `./`, - `../`, - `.\`, - `..\`, -} - -// isDotSlash reports whether the path begins with a reference -// to the local . or .. directory. -func isDotSlash(arg string) bool { - if arg == "." || arg == ".." { - return true - } - for _, dotPath := range dotPaths { - if strings.HasPrefix(arg, dotPath) { - return true - } - } - return false -} - -// importDir is just an error-catching wrapper for build.ImportDir. -func importDir(dir string) *build.Package { - pkg, err := build.ImportDir(dir, build.ImportComment) - if err != nil { - log.Fatal(err) - } - return pkg -} - -// parseSymbol breaks str apart into a symbol and method. -// Both may be missing or the method may be missing. -// If present, each must be a valid Go identifier. -func parseSymbol(flagSet *flag.FlagSet, str string) (symbol, method string) { - if str == "" { - return - } - elem := strings.Split(str, ".") - switch len(elem) { - case 1: - case 2: - method = elem[1] - default: - log.Printf("too many periods in symbol specification") - usage(flagSet) - } - symbol = elem[0] - return -} - -// isExported reports whether the name is an exported identifier. -// If the unexported flag (-u) is true, isExported returns true because -// it means that we treat the name as if it is exported. -func isExported(name string) bool { - return unexported || token.IsExported(name) -} - -// findNextPackage returns the next full file name path that matches the -// (perhaps partial) package path pkg. The boolean reports if any match was found. -func findNextPackage(pkg string) (string, bool) { - if filepath.IsAbs(pkg) { - if dirs.offset == 0 { - dirs.offset = -1 - return pkg, true - } - return "", false - } - if pkg == "" || token.IsExported(pkg) { // Upper case symbol cannot be a package name. - return "", false - } - pkg = path.Clean(pkg) - pkgSuffix := "/" + pkg - for { - d, ok := dirs.Next() - if !ok { - return "", false - } - if d.importPath == pkg || strings.HasSuffix(d.importPath, pkgSuffix) { - return d.dir, true - } - } -} - -var buildCtx = build.Default - -// splitGopath splits $GOPATH into a list of roots. -func splitGopath() []string { - return filepath.SplitList(buildCtx.GOPATH) -} diff --git a/src/cmd/internal/goobj/mkbuiltin.go b/src/cmd/internal/goobj/mkbuiltin.go index 9a6ad8c8c1..6d1e7bb429 100644 --- a/src/cmd/internal/goobj/mkbuiltin.go +++ b/src/cmd/internal/goobj/mkbuiltin.go @@ -78,7 +78,7 @@ func mkbuiltin(w io.Writer) { continue } if decl.Tok != token.VAR { - log.Fatal("unhandled declaration kind", decl.Tok) + log.Fatal("unhandled declaration kind: ", decl.Tok) } for _, spec := range decl.Specs { spec := spec.(*ast.ValueSpec) @@ -92,7 +92,7 @@ func mkbuiltin(w io.Writer) { } } default: - log.Fatal("unhandled decl type", decl) + log.Fatal("unhandled decl type: ", decl) } } diff --git a/src/cmd/internal/obj/arm/obj5.go b/src/cmd/internal/obj/arm/obj5.go index 2f04fd7316..79f08a41ea 100644 --- a/src/cmd/internal/obj/arm/obj5.go +++ b/src/cmd/internal/obj/arm/obj5.go @@ -350,117 +350,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { p.To.Reg = REGSP p.Spadj = autosize - if cursym.Func().Text.From.Sym.Wrapper() { - // if(g->panic != nil && g->panic->argp == FP) g->panic->argp = bottom-of-frame - // - // MOVW g_panic(g), R1 - // CMP $0, R1 - // B.NE checkargp - // end: - // NOP - // ... function ... - // checkargp: - // MOVW panic_argp(R1), R2 - // ADD $(autosize+4), R13, R3 - // CMP R2, R3 - // B.NE end - // ADD $4, R13, R4 - // MOVW R4, panic_argp(R1) - // B end - // - // The NOP is needed to give the jumps somewhere to land. - // It is a liblink NOP, not an ARM NOP: it encodes to 0 instruction bytes. - - p = obj.Appendp(p, newprog) - p.As = AMOVW - p.From.Type = obj.TYPE_MEM - p.From.Reg = REGG - p.From.Offset = 4 * int64(ctxt.Arch.PtrSize) // G.panic - p.To.Type = obj.TYPE_REG - p.To.Reg = REG_R1 - - p = obj.Appendp(p, newprog) - p.As = ACMP - p.From.Type = obj.TYPE_CONST - p.From.Offset = 0 - p.Reg = REG_R1 - - // B.NE checkargp - bne := obj.Appendp(p, newprog) - bne.As = ABNE - bne.To.Type = obj.TYPE_BRANCH - - // end: NOP - end := obj.Appendp(bne, newprog) - end.As = obj.ANOP - - // find end of function - var last *obj.Prog - for last = end; last.Link != nil; last = last.Link { - } - - // MOVW panic_argp(R1), R2 - mov := obj.Appendp(last, newprog) - mov.As = AMOVW - mov.From.Type = obj.TYPE_MEM - mov.From.Reg = REG_R1 - mov.From.Offset = 0 // Panic.argp - mov.To.Type = obj.TYPE_REG - mov.To.Reg = REG_R2 - - // B.NE branch target is MOVW above - bne.To.SetTarget(mov) - - // ADD $(autosize+4), R13, R3 - p = obj.Appendp(mov, newprog) - p.As = AADD - p.From.Type = obj.TYPE_CONST - p.From.Offset = int64(autosize) + 4 - p.Reg = REG_R13 - p.To.Type = obj.TYPE_REG - p.To.Reg = REG_R3 - - // CMP R2, R3 - p = obj.Appendp(p, newprog) - p.As = ACMP - p.From.Type = obj.TYPE_REG - p.From.Reg = REG_R2 - p.Reg = REG_R3 - - // B.NE end - p = obj.Appendp(p, newprog) - p.As = ABNE - p.To.Type = obj.TYPE_BRANCH - p.To.SetTarget(end) - - // ADD $4, R13, R4 - p = obj.Appendp(p, newprog) - p.As = AADD - p.From.Type = obj.TYPE_CONST - p.From.Offset = 4 - p.Reg = REG_R13 - p.To.Type = obj.TYPE_REG - p.To.Reg = REG_R4 - - // MOVW R4, panic_argp(R1) - p = obj.Appendp(p, newprog) - p.As = AMOVW - p.From.Type = obj.TYPE_REG - p.From.Reg = REG_R4 - p.To.Type = obj.TYPE_MEM - p.To.Reg = REG_R1 - p.To.Offset = 0 // Panic.argp - - // B end - p = obj.Appendp(p, newprog) - p.As = AB - p.To.Type = obj.TYPE_BRANCH - p.To.SetTarget(end) - - // reset for subsequent passes - p = end - } - case obj.ARET: nocache(p) if cursym.Func().Text.Mark&LEAF != 0 { diff --git a/src/cmd/internal/obj/arm64/obj7.go b/src/cmd/internal/obj/arm64/obj7.go index 368a631ff5..6cdb72359e 100644 --- a/src/cmd/internal/obj/arm64/obj7.go +++ b/src/cmd/internal/obj/arm64/obj7.go @@ -733,111 +733,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q1.To.Type = obj.TYPE_REG q1.To.Reg = REGFP - if c.cursym.Func().Text.From.Sym.Wrapper() { - // if(g->panic != nil && g->panic->argp == FP) g->panic->argp = bottom-of-frame - // - // MOV g_panic(g), RT1 - // CBNZ checkargp - // end: - // NOP - // ... function body ... - // checkargp: - // MOV panic_argp(RT1), RT2 - // ADD $(autosize+8), RSP, R20 - // CMP RT2, R20 - // BNE end - // ADD $8, RSP, R20 - // MOVD R20, panic_argp(RT1) - // B end - // - // The NOP is needed to give the jumps somewhere to land. - // It is a liblink NOP, not an ARM64 NOP: it encodes to 0 instruction bytes. - q = q1 - - // MOV g_panic(g), RT1 - q = obj.Appendp(q, c.newprog) - q.As = AMOVD - q.From.Type = obj.TYPE_MEM - q.From.Reg = REGG - q.From.Offset = 4 * int64(c.ctxt.Arch.PtrSize) // G.panic - q.To.Type = obj.TYPE_REG - q.To.Reg = REGRT1 - - // CBNZ RT1, checkargp - cbnz := obj.Appendp(q, c.newprog) - cbnz.As = ACBNZ - cbnz.From.Type = obj.TYPE_REG - cbnz.From.Reg = REGRT1 - cbnz.To.Type = obj.TYPE_BRANCH - - // Empty branch target at the top of the function body - end := obj.Appendp(cbnz, c.newprog) - end.As = obj.ANOP - - // find the end of the function - var last *obj.Prog - for last = end; last.Link != nil; last = last.Link { - } - - // MOV panic_argp(RT1), RT2 - mov := obj.Appendp(last, c.newprog) - mov.As = AMOVD - mov.From.Type = obj.TYPE_MEM - mov.From.Reg = REGRT1 - mov.From.Offset = 0 // Panic.argp - mov.To.Type = obj.TYPE_REG - mov.To.Reg = REGRT2 - - // CBNZ branches to the MOV above - cbnz.To.SetTarget(mov) - - // ADD $(autosize+8), SP, R20 - q = obj.Appendp(mov, c.newprog) - q.As = AADD - q.From.Type = obj.TYPE_CONST - q.From.Offset = int64(c.autosize) + 8 - q.Reg = REGSP - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R20 - - // CMP RT2, R20 - q = obj.Appendp(q, c.newprog) - q.As = ACMP - q.From.Type = obj.TYPE_REG - q.From.Reg = REGRT2 - q.Reg = REG_R20 - - // BNE end - q = obj.Appendp(q, c.newprog) - q.As = ABNE - q.To.Type = obj.TYPE_BRANCH - q.To.SetTarget(end) - - // ADD $8, SP, R20 - q = obj.Appendp(q, c.newprog) - q.As = AADD - q.From.Type = obj.TYPE_CONST - q.From.Offset = 8 - q.Reg = REGSP - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R20 - - // MOV R20, panic_argp(RT1) - q = obj.Appendp(q, c.newprog) - q.As = AMOVD - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R20 - q.To.Type = obj.TYPE_MEM - q.To.Reg = REGRT1 - q.To.Offset = 0 // Panic.argp - - // B end - q = obj.Appendp(q, c.newprog) - q.As = AB - q.To.Type = obj.TYPE_BRANCH - q.To.SetTarget(end) - } - case obj.ARET: nocache(p) if p.From.Type == obj.TYPE_CONST { @@ -907,18 +802,49 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { p.To.Reg = REGFP p.To.Offset = REGLINK - // ADD $aoffset, RSP, RSP - q = newprog() - q.As = AADD - q.From.Type = obj.TYPE_CONST - q.From.Offset = int64(aoffset) - q.To.Type = obj.TYPE_REG - q.To.Reg = REGSP - q.Spadj = -aoffset - q.Pos = p.Pos - q.Link = p.Link - p.Link = q - p = q + if aoffset < 1<<12 { + // ADD $aoffset, RSP, RSP + q = newprog() + q.As = AADD + q.From.Type = obj.TYPE_CONST + q.From.Offset = int64(aoffset) + q.To.Type = obj.TYPE_REG + q.To.Reg = REGSP + q.Spadj = -aoffset + q.Pos = p.Pos + q.Link = p.Link + p.Link = q + p = q + } else { + // Put frame size in a separate register and + // add it in with a single instruction, + // so we never have a partial frame during + // the epilog. See issue 73259. + + // MOVD $aoffset, REGTMP + q = newprog() + q.As = AMOVD + q.From.Type = obj.TYPE_CONST + q.From.Offset = int64(aoffset) + q.To.Type = obj.TYPE_REG + q.To.Reg = REGTMP + q.Pos = p.Pos + q.Link = p.Link + p.Link = q + p = q + // ADD REGTMP, RSP, RSP + q = newprog() + q.As = AADD + q.From.Type = obj.TYPE_REG + q.From.Reg = REGTMP + q.To.Type = obj.TYPE_REG + q.To.Reg = REGSP + q.Spadj = -aoffset + q.Pos = p.Pos + q.Link = p.Link + p.Link = q + p = q + } } // If enabled, this code emits 'MOV PC, R27' before every 'MOV LR, PC', diff --git a/src/cmd/internal/obj/fips140.go b/src/cmd/internal/obj/fips140.go index eb6ffff009..ea36849a21 100644 --- a/src/cmd/internal/obj/fips140.go +++ b/src/cmd/internal/obj/fips140.go @@ -384,6 +384,7 @@ func (s *LSym) checkFIPSReloc(ctxt *Link, rel Reloc) { objabi.R_RISCV_TLS_IE, objabi.R_RISCV_TLS_LE, objabi.R_RISCV_GOT_HI20, + objabi.R_RISCV_GOT_PCREL_ITYPE, objabi.R_RISCV_PCREL_HI20, objabi.R_RISCV_PCREL_LO12_I, objabi.R_RISCV_PCREL_LO12_S, diff --git a/src/cmd/internal/obj/loong64/a.out.go b/src/cmd/internal/obj/loong64/a.out.go index 193993ec4d..162e36be8c 100644 --- a/src/cmd/internal/obj/loong64/a.out.go +++ b/src/cmd/internal/obj/loong64/a.out.go @@ -816,6 +816,31 @@ const ( AXVPCNTW AXVPCNTV + AVBITCLRB + AVBITCLRH + AVBITCLRW + AVBITCLRV + AVBITSETB + AVBITSETH + AVBITSETW + AVBITSETV + AVBITREVB + AVBITREVH + AVBITREVW + AVBITREVV + AXVBITCLRB + AXVBITCLRH + AXVBITCLRW + AXVBITCLRV + AXVBITSETB + AXVBITSETH + AXVBITSETW + AXVBITSETV + AXVBITREVB + AXVBITREVH + AXVBITREVW + AXVBITREVV + // LSX and LASX integer comparison instruction AVSEQB AXVSEQB diff --git a/src/cmd/internal/obj/loong64/anames.go b/src/cmd/internal/obj/loong64/anames.go index bf9b0722cc..d9ff3b7bc9 100644 --- a/src/cmd/internal/obj/loong64/anames.go +++ b/src/cmd/internal/obj/loong64/anames.go @@ -327,6 +327,30 @@ var Anames = []string{ "XVPCNTH", "XVPCNTW", "XVPCNTV", + "VBITCLRB", + "VBITCLRH", + "VBITCLRW", + "VBITCLRV", + "VBITSETB", + "VBITSETH", + "VBITSETW", + "VBITSETV", + "VBITREVB", + "VBITREVH", + "VBITREVW", + "VBITREVV", + "XVBITCLRB", + "XVBITCLRH", + "XVBITCLRW", + "XVBITCLRV", + "XVBITSETB", + "XVBITSETH", + "XVBITSETW", + "XVBITSETV", + "XVBITREVB", + "XVBITREVH", + "XVBITREVW", + "XVBITREVV", "VSEQB", "XVSEQB", "VSEQH", diff --git a/src/cmd/internal/obj/loong64/asm.go b/src/cmd/internal/obj/loong64/asm.go index 6e09930183..2ed12698e6 100644 --- a/src/cmd/internal/obj/loong64/asm.go +++ b/src/cmd/internal/obj/loong64/asm.go @@ -416,8 +416,11 @@ var optab = []Optab{ {AVMOVQ, C_ELEM, C_NONE, C_NONE, C_ARNG, C_NONE, 45, 4, 0, 0}, - {APRELD, C_SOREG, C_U5CON, C_NONE, C_NONE, C_NONE, 46, 4, 0, 0}, - {APRELDX, C_SOREG, C_DCON, C_U5CON, C_NONE, C_NONE, 47, 20, 0, 0}, + {AVMOVQ, C_SOREG, C_NONE, C_NONE, C_ARNG, C_NONE, 46, 4, 0, 0}, + {AXVMOVQ, C_SOREG, C_NONE, C_NONE, C_ARNG, C_NONE, 46, 4, 0, 0}, + + {APRELD, C_SOREG, C_U5CON, C_NONE, C_NONE, C_NONE, 47, 4, 0, 0}, + {APRELDX, C_SOREG, C_DCON, C_U5CON, C_NONE, C_NONE, 48, 20, 0, 0}, {obj.APCALIGN, C_U12CON, C_NONE, C_NONE, C_NONE, C_NONE, 0, 0, 0, 0}, {obj.APCDATA, C_32CON, C_NONE, C_NONE, C_32CON, C_NONE, 0, 0, 0, 0}, @@ -1830,21 +1833,33 @@ func buildop(ctxt *obj.Link) { opset(AVSRLB, r0) opset(AVSRAB, r0) opset(AVROTRB, r0) + opset(AVBITCLRB, r0) + opset(AVBITSETB, r0) + opset(AVBITREVB, r0) case AXVSLLB: opset(AXVSRLB, r0) opset(AXVSRAB, r0) opset(AXVROTRB, r0) + opset(AXVBITCLRB, r0) + opset(AXVBITSETB, r0) + opset(AXVBITREVB, r0) case AVSLLH: opset(AVSRLH, r0) opset(AVSRAH, r0) opset(AVROTRH, r0) + opset(AVBITCLRH, r0) + opset(AVBITSETH, r0) + opset(AVBITREVH, r0) case AXVSLLH: opset(AXVSRLH, r0) opset(AXVSRAH, r0) opset(AXVROTRH, r0) + opset(AXVBITCLRH, r0) + opset(AXVBITSETH, r0) + opset(AXVBITREVH, r0) case AVSLLW: opset(AVSRLW, r0) @@ -1858,6 +1873,9 @@ func buildop(ctxt *obj.Link) { opset(AVSUBHU, r0) opset(AVSUBWU, r0) opset(AVSUBVU, r0) + opset(AVBITCLRW, r0) + opset(AVBITSETW, r0) + opset(AVBITREVW, r0) case AXVSLLW: opset(AXVSRLW, r0) @@ -1871,16 +1889,25 @@ func buildop(ctxt *obj.Link) { opset(AXVSUBHU, r0) opset(AXVSUBWU, r0) opset(AXVSUBVU, r0) + opset(AXVBITCLRW, r0) + opset(AXVBITSETW, r0) + opset(AXVBITREVW, r0) case AVSLLV: opset(AVSRLV, r0) opset(AVSRAV, r0) opset(AVROTRV, r0) + opset(AVBITCLRV, r0) + opset(AVBITSETV, r0) + opset(AVBITREVV, r0) case AXVSLLV: opset(AXVSRLV, r0) opset(AXVSRAV, r0) opset(AXVROTRV, r0) + opset(AXVBITCLRV, r0) + opset(AXVBITSETV, r0) + opset(AXVBITREVV, r0) case AVSETEQV: opset(AVSETNEV, r0) @@ -2395,7 +2422,7 @@ func (c *ctxt0) asmout(p *obj.Prog, o *Optab, out []uint32) { o1 = uint32(c.regoff(&p.From)) case 39: // vmov Rn, Vd.<T>[index] - v, m := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg) + v, m := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg, false) if v == 0 { c.ctxt.Diag("illegal arng type combination: %v\n", p) } @@ -2407,7 +2434,7 @@ func (c *ctxt0) asmout(p *obj.Prog, o *Optab, out []uint32) { o1 = v | (index << 10) | (Rj << 5) | Vd case 40: // vmov Vd.<T>[index], Rn - v, m := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg) + v, m := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg, false) if v == 0 { c.ctxt.Diag("illegal arng type combination: %v\n", p) } @@ -2419,7 +2446,7 @@ func (c *ctxt0) asmout(p *obj.Prog, o *Optab, out []uint32) { o1 = v | (index << 10) | (Vj << 5) | Rd case 41: // vmov Rn, Vd.<T> - v, _ := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg) + v, _ := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg, false) if v == 0 { c.ctxt.Diag("illegal arng type combination: %v\n", p) } @@ -2429,7 +2456,7 @@ func (c *ctxt0) asmout(p *obj.Prog, o *Optab, out []uint32) { o1 = v | (Rj << 5) | Vd case 42: // vmov xj, xd.<T> - v, _ := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg) + v, _ := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg, false) if v == 0 { c.ctxt.Diag("illegal arng type combination: %v\n", p) } @@ -2439,7 +2466,7 @@ func (c *ctxt0) asmout(p *obj.Prog, o *Optab, out []uint32) { o1 = v | (Xj << 5) | Xd case 43: // vmov xj, xd.<T>[index] - v, m := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg) + v, m := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg, false) if v == 0 { c.ctxt.Diag("illegal arng type combination: %v\n", p) } @@ -2451,7 +2478,7 @@ func (c *ctxt0) asmout(p *obj.Prog, o *Optab, out []uint32) { o1 = v | (index << 10) | (Xj << 5) | Xd case 44: // vmov xj.<T>[index], xd - v, m := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg) + v, m := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg, false) if v == 0 { c.ctxt.Diag("illegal arng type combination: %v\n", p) } @@ -2463,7 +2490,7 @@ func (c *ctxt0) asmout(p *obj.Prog, o *Optab, out []uint32) { o1 = v | (index << 10) | (Xj << 5) | Xd case 45: // vmov vj.<T>[index], vd.<T> - v, m := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg) + v, m := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg, false) if v == 0 { c.ctxt.Diag("illegal arng type combination: %v\n", p) } @@ -2474,12 +2501,23 @@ func (c *ctxt0) asmout(p *obj.Prog, o *Optab, out []uint32) { c.checkindex(p, index, m) o1 = v | (index << 10) | (vj << 5) | vd - case 46: // preld offset(Rbase), $hint + case 46: // vmov offset(vj), vd.<T> + v, _ := c.specialLsxMovInst(p.As, p.From.Reg, p.To.Reg, true) + if v == 0 { + c.ctxt.Diag("illegal arng type combination: %v\n", p) + } + + si := c.regoff(&p.From) + Rj := uint32(p.From.Reg & EXT_REG_MASK) + Vd := uint32(p.To.Reg & EXT_REG_MASK) + o1 = v | uint32(si<<10) | (Rj << 5) | Vd + + case 47: // preld offset(Rbase), $hint offs := c.regoff(&p.From) hint := p.GetFrom3().Offset o1 = OP_12IR_5I(c.opiir(p.As), uint32(offs), uint32(p.From.Reg), uint32(hint)) - case 47: // preldx offset(Rbase), $n, $hint + case 48: // preldx offset(Rbase), $n, $hint offs := c.regoff(&p.From) hint := p.RestArgs[1].Offset n := uint64(p.GetFrom3().Offset) @@ -3504,6 +3542,54 @@ func (c *ctxt0) oprrr(a obj.As) uint32 { return 0xea75 << 15 // xvfdiv.s case AXVDIVD: return 0xea76 << 15 // xvfdiv.d + case AVBITCLRB: + return 0xe218 << 15 // vbitclr.b + case AVBITCLRH: + return 0xe219 << 15 // vbitclr.h + case AVBITCLRW: + return 0xe21a << 15 // vbitclr.w + case AVBITCLRV: + return 0xe21b << 15 // vbitclr.d + case AVBITSETB: + return 0xe21c << 15 // vbitset.b + case AVBITSETH: + return 0xe21d << 15 // vbitset.h + case AVBITSETW: + return 0xe21e << 15 // vbitset.w + case AVBITSETV: + return 0xe21f << 15 // vbitset.d + case AVBITREVB: + return 0xe220 << 15 // vbitrev.b + case AVBITREVH: + return 0xe221 << 15 // vbitrev.h + case AVBITREVW: + return 0xe222 << 15 // vbitrev.w + case AVBITREVV: + return 0xe223 << 15 // vbitrev.d + case AXVBITCLRB: + return 0xea18 << 15 // xvbitclr.b + case AXVBITCLRH: + return 0xea19 << 15 // xvbitclr.h + case AXVBITCLRW: + return 0xea1a << 15 // xvbitclr.w + case AXVBITCLRV: + return 0xea1b << 15 // xvbitclr.d + case AXVBITSETB: + return 0xea1c << 15 // xvbitset.b + case AXVBITSETH: + return 0xea1d << 15 // xvbitset.h + case AXVBITSETW: + return 0xea1e << 15 // xvbitset.w + case AXVBITSETV: + return 0xea1f << 15 // xvbitset.d + case AXVBITREVB: + return 0xea20 << 15 // xvbitrev.b + case AXVBITREVH: + return 0xea21 << 15 // xvbitrev.h + case AXVBITREVW: + return 0xea22 << 15 // xvbitrev.w + case AXVBITREVV: + return 0xea23 << 15 // xvbitrev.d } if a < 0 { @@ -4104,6 +4190,54 @@ func (c *ctxt0) opirr(a obj.As) uint32 { return 0x1de6 << 18 // xvshuf4i.w case AXVSHUF4IV: return 0x1de7 << 18 // xvshuf4i.d + case AVBITCLRB: + return 0x1CC4<<18 | 0x1<<13 // vbitclri.b + case AVBITCLRH: + return 0x1CC4<<18 | 0x1<<14 // vbitclri.h + case AVBITCLRW: + return 0x1CC4<<18 | 0x1<<15 // vbitclri.w + case AVBITCLRV: + return 0x1CC4<<18 | 0x1<<16 // vbitclri.d + case AVBITSETB: + return 0x1CC5<<18 | 0x1<<13 // vbitseti.b + case AVBITSETH: + return 0x1CC5<<18 | 0x1<<14 // vbitseti.h + case AVBITSETW: + return 0x1CC5<<18 | 0x1<<15 // vbitseti.w + case AVBITSETV: + return 0x1CC5<<18 | 0x1<<16 // vbitseti.d + case AVBITREVB: + return 0x1CC6<<18 | 0x1<<13 // vbitrevi.b + case AVBITREVH: + return 0x1CC6<<18 | 0x1<<14 // vbitrevi.h + case AVBITREVW: + return 0x1CC6<<18 | 0x1<<15 // vbitrevi.w + case AVBITREVV: + return 0x1CC6<<18 | 0x1<<16 // vbitrevi.d + case AXVBITCLRB: + return 0x1DC4<<18 | 0x1<<13 // xvbitclri.b + case AXVBITCLRH: + return 0x1DC4<<18 | 0x1<<14 // xvbitclri.h + case AXVBITCLRW: + return 0x1DC4<<18 | 0x1<<15 // xvbitclri.w + case AXVBITCLRV: + return 0x1DC4<<18 | 0x1<<16 // xvbitclri.d + case AXVBITSETB: + return 0x1DC5<<18 | 0x1<<13 // xvbitseti.b + case AXVBITSETH: + return 0x1DC5<<18 | 0x1<<14 // xvbitseti.h + case AXVBITSETW: + return 0x1DC5<<18 | 0x1<<15 // xvbitseti.w + case AXVBITSETV: + return 0x1DC5<<18 | 0x1<<16 // xvbitseti.d + case AXVBITREVB: + return 0x1DC6<<18 | 0x1<<13 // xvbitrevi.b + case AXVBITREVH: + return 0x1DC6<<18 | 0x1<<14 // xvbitrevi.h + case AXVBITREVW: + return 0x1DC6<<18 | 0x1<<15 // xvbitrevi.w + case AXVBITREVV: + return 0x1DC6<<18 | 0x1<<16 // xvbitrevi.d } if a < 0 { @@ -4192,7 +4326,7 @@ func (c *ctxt0) specialFpMovInst(a obj.As, fclass int, tclass int) uint32 { return 0 } -func (c *ctxt0) specialLsxMovInst(a obj.As, fReg, tReg int16) (op_code, index_mask uint32) { +func (c *ctxt0) specialLsxMovInst(a obj.As, fReg, tReg int16, offset_flag bool) (op_code, index_mask uint32) { farng := (fReg >> EXT_TYPE_SHIFT) & EXT_TYPE_MASK tarng := (tReg >> EXT_TYPE_SHIFT) & EXT_TYPE_MASK fclass := c.rclass(fReg) @@ -4258,29 +4392,58 @@ func (c *ctxt0) specialLsxMovInst(a obj.As, fReg, tReg int16) (op_code, index_ma } case C_REG | (C_ARNG << 16): - // vmov Rn, Vd.<T> - switch a { - case AVMOVQ: - switch tarng { - case ARNG_16B: - return (0x1CA7C0 << 10), 0x0 // vreplgr2vr.b - case ARNG_8H: - return (0x1CA7C1 << 10), 0x0 // vreplgr2vr.h - case ARNG_4W: - return (0x1CA7C2 << 10), 0x0 // vreplgr2vr.w - case ARNG_2V: - return (0x1CA7C3 << 10), 0x0 // vreplgr2vr.d + switch { + case offset_flag: + // vmov offset(vj), vd.<T> + switch a { + case AVMOVQ: + switch tarng { + case ARNG_16B: + return (0xC2 << 22), 0x0 // vldrepl.b + case ARNG_8H: + return (0x182 << 21), 0x0 // vldrepl.h + case ARNG_4W: + return (0x302 << 20), 0x0 // vldrepl.w + case ARNG_2V: + return (0x602 << 19), 0x0 // vldrepl.d + } + case AXVMOVQ: + switch tarng { + case ARNG_32B: + return (0xCA << 22), 0x0 // xvldrepl.b + case ARNG_16H: + return (0x192 << 21), 0x0 // xvldrepl.h + case ARNG_8W: + return (0x322 << 20), 0x0 // xvldrepl.w + case ARNG_4V: + return (0x642 << 19), 0x0 // xvldrepl.d + } } - case AXVMOVQ: - switch tarng { - case ARNG_32B: - return (0x1DA7C0 << 10), 0x0 // xvreplgr2vr.b - case ARNG_16H: - return (0x1DA7C1 << 10), 0x0 // xvreplgr2vr.h - case ARNG_8W: - return (0x1DA7C2 << 10), 0x0 // xvreplgr2vr.w - case ARNG_4V: - return (0x1DA7C3 << 10), 0x0 // xvreplgr2vr.d + default: + // vmov Rn, Vd.<T> + switch a { + case AVMOVQ: + switch tarng { + case ARNG_16B: + return (0x1CA7C0 << 10), 0x0 // vreplgr2vr.b + case ARNG_8H: + return (0x1CA7C1 << 10), 0x0 // vreplgr2vr.h + case ARNG_4W: + return (0x1CA7C2 << 10), 0x0 // vreplgr2vr.w + case ARNG_2V: + return (0x1CA7C3 << 10), 0x0 // vreplgr2vr.d + } + case AXVMOVQ: + switch tarng { + case ARNG_32B: + return (0x1DA7C0 << 10), 0x0 // xvreplgr2vr.b + case ARNG_16H: + return (0x1DA7C1 << 10), 0x0 // xvreplgr2vr.h + case ARNG_8W: + return (0x1DA7C2 << 10), 0x0 // xvreplgr2vr.w + case ARNG_4V: + return (0x1DA7C3 << 10), 0x0 // xvreplgr2vr.d + } } } diff --git a/src/cmd/internal/obj/loong64/doc.go b/src/cmd/internal/obj/loong64/doc.go index 0818389c8d..a990b23089 100644 --- a/src/cmd/internal/obj/loong64/doc.go +++ b/src/cmd/internal/obj/loong64/doc.go @@ -203,6 +203,23 @@ Note: In the following sections 3.1 to 3.6, "ui4" (4-bit unsigned int immediate) VMOVQ Vj.W[index], Vd.W4 | vreplvei.w vd, vj, ui2 | for i in range(4) : VR[vd].w[i] = VR[vj].w[ui2] VMOVQ Vj.V[index], Vd.V2 | vreplvei.d vd, vj, ui1 | for i in range(2) : VR[vd].d[i] = VR[vj].d[ui1] +3.7 Load data from memory and broadcast to each element of a vector register. + + Instruction format: + VMOVQ offset(Rj), <Vd>.<T> + + Mapping between Go and platform assembly: + Go assembly | platform assembly | semantics + ------------------------------------------------------------------------------------------------------------------------------------------------------- + VMOVQ offset(Rj), Vd.B16 | vldrepl.b Vd, Rj, si12 | for i in range(16): VR[vd].b[i] = load 8 bit memory data from (GR[rj]+SignExtend(si12)) + VMOVQ offset(Rj), Vd.H8 | vldrepl.h Vd, Rj, si11 | for i in range(8) : VR[vd].h[i] = load 16 bit memory data from (GR[rj]+SignExtend(si11<<1)) + VMOVQ offset(Rj), Vd.W4 | vldrepl.w Vd, Rj, si10 | for i in range(4) : VR[vd].w[i] = load 32 bit memory data from (GR[rj]+SignExtend(si10<<2)) + VMOVQ offset(Rj), Vd.V2 | vldrepl.d Vd, Rj, si9 | for i in range(2) : VR[vd].d[i] = load 64 bit memory data from (GR[rj]+SignExtend(si9<<3)) + XVMOVQ offset(Rj), Xd.B32 | xvldrepl.b Xd, Rj, si12 | for i in range(32): XR[xd].b[i] = load 8 bit memory data from (GR[rj]+SignExtend(si12)) + XVMOVQ offset(Rj), Xd.H16 | xvldrepl.h Xd, Rj, si11 | for i in range(16): XR[xd].h[i] = load 16 bit memory data from (GR[rj]+SignExtend(si11<<1)) + XVMOVQ offset(Rj), Xd.W8 | xvldrepl.w Xd, Rj, si10 | for i in range(8) : XR[xd].w[i] = load 32 bit memory data from (GR[rj]+SignExtend(si10<<2)) + XVMOVQ offset(Rj), Xd.V4 | xvldrepl.d Xd, Rj, si9 | for i in range(4) : XR[xd].d[i] = load 64 bit memory data from (GR[rj]+SignExtend(si9<<3)) + # Special instruction encoding definition and description on LoongArch 1. DBAR hint encoding for LA664(Loongson 3A6000) and later micro-architectures, paraphrased diff --git a/src/cmd/internal/obj/loong64/obj.go b/src/cmd/internal/obj/loong64/obj.go index f75e2d8716..79fbb23fef 100644 --- a/src/cmd/internal/obj/loong64/obj.go +++ b/src/cmd/internal/obj/loong64/obj.go @@ -301,8 +301,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { var q *obj.Prog var q1 *obj.Prog autosize := int32(0) - var p1 *obj.Prog - var p2 *obj.Prog for p := c.cursym.Func().Text; p != nil; p = p.Link { o := p.As switch o { @@ -401,90 +399,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q.To.Reg = REGSP } - if c.cursym.Func().Text.From.Sym.Wrapper() && c.cursym.Func().Text.Mark&LEAF == 0 { - // if(g->panic != nil && g->panic->argp == FP) g->panic->argp = bottom-of-frame - // - // MOV g_panic(g), R20 - // BEQ R20, end - // MOV panic_argp(R20), R24 - // ADD $(autosize+FIXED_FRAME), R3, R30 - // BNE R24, R30, end - // ADD $FIXED_FRAME, R3, R24 - // MOV R24, panic_argp(R20) - // end: - // NOP - // - // The NOP is needed to give the jumps somewhere to land. - // It is a liblink NOP, not a hardware NOP: it encodes to 0 instruction bytes. - // - // We don't generate this for leaves because that means the wrapped - // function was inlined into the wrapper. - - q = obj.Appendp(q, newprog) - - q.As = mov - q.From.Type = obj.TYPE_MEM - q.From.Reg = REGG - q.From.Offset = 4 * int64(c.ctxt.Arch.PtrSize) // G.panic - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R20 - - q = obj.Appendp(q, newprog) - q.As = ABEQ - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R20 - q.To.Type = obj.TYPE_BRANCH - q.Mark |= BRANCH - p1 = q - - q = obj.Appendp(q, newprog) - q.As = mov - q.From.Type = obj.TYPE_MEM - q.From.Reg = REG_R20 - q.From.Offset = 0 // Panic.argp - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R24 - - q = obj.Appendp(q, newprog) - q.As = add - q.From.Type = obj.TYPE_CONST - q.From.Offset = int64(autosize) + ctxt.Arch.FixedFrameSize - q.Reg = REGSP - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R30 - - q = obj.Appendp(q, newprog) - q.As = ABNE - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R24 - q.Reg = REG_R30 - q.To.Type = obj.TYPE_BRANCH - q.Mark |= BRANCH - p2 = q - - q = obj.Appendp(q, newprog) - q.As = add - q.From.Type = obj.TYPE_CONST - q.From.Offset = ctxt.Arch.FixedFrameSize - q.Reg = REGSP - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R24 - - q = obj.Appendp(q, newprog) - q.As = mov - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R24 - q.To.Type = obj.TYPE_MEM - q.To.Reg = REG_R20 - q.To.Offset = 0 // Panic.argp - - q = obj.Appendp(q, newprog) - - q.As = obj.ANOP - p1.To.SetTarget(q) - p2.To.SetTarget(q) - } - case ARET: if p.From.Type == obj.TYPE_CONST { ctxt.Diag("using BECOME (%v) is not supported!", p) diff --git a/src/cmd/internal/obj/mips/obj0.go b/src/cmd/internal/obj/mips/obj0.go index b9152fe57e..bbed88e9d6 100644 --- a/src/cmd/internal/obj/mips/obj0.go +++ b/src/cmd/internal/obj/mips/obj0.go @@ -267,7 +267,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { var q1 *obj.Prog autosize := int32(0) var p1 *obj.Prog - var p2 *obj.Prog for p := c.cursym.Func().Text; p != nil; p = p.Link { o := p.As switch o { @@ -359,90 +358,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q.To.Reg = REGSP } - if c.cursym.Func().Text.From.Sym.Wrapper() && c.cursym.Func().Text.Mark&LEAF == 0 { - // if(g->panic != nil && g->panic->argp == FP) g->panic->argp = bottom-of-frame - // - // MOV g_panic(g), R1 - // BEQ R1, end - // MOV panic_argp(R1), R2 - // ADD $(autosize+FIXED_FRAME), R29, R3 - // BNE R2, R3, end - // ADD $FIXED_FRAME, R29, R2 - // MOV R2, panic_argp(R1) - // end: - // NOP - // - // The NOP is needed to give the jumps somewhere to land. - // It is a liblink NOP, not an mips NOP: it encodes to 0 instruction bytes. - // - // We don't generate this for leafs because that means the wrapped - // function was inlined into the wrapper. - - q = obj.Appendp(q, newprog) - - q.As = mov - q.From.Type = obj.TYPE_MEM - q.From.Reg = REGG - q.From.Offset = 4 * int64(c.ctxt.Arch.PtrSize) // G.panic - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R1 - - q = obj.Appendp(q, newprog) - q.As = ABEQ - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R1 - q.To.Type = obj.TYPE_BRANCH - q.Mark |= BRANCH - p1 = q - - q = obj.Appendp(q, newprog) - q.As = mov - q.From.Type = obj.TYPE_MEM - q.From.Reg = REG_R1 - q.From.Offset = 0 // Panic.argp - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R2 - - q = obj.Appendp(q, newprog) - q.As = add - q.From.Type = obj.TYPE_CONST - q.From.Offset = int64(autosize) + ctxt.Arch.FixedFrameSize - q.Reg = REGSP - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R3 - - q = obj.Appendp(q, newprog) - q.As = ABNE - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R2 - q.Reg = REG_R3 - q.To.Type = obj.TYPE_BRANCH - q.Mark |= BRANCH - p2 = q - - q = obj.Appendp(q, newprog) - q.As = add - q.From.Type = obj.TYPE_CONST - q.From.Offset = ctxt.Arch.FixedFrameSize - q.Reg = REGSP - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R2 - - q = obj.Appendp(q, newprog) - q.As = mov - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R2 - q.To.Type = obj.TYPE_MEM - q.To.Reg = REG_R1 - q.To.Offset = 0 // Panic.argp - - q = obj.Appendp(q, newprog) - - q.As = obj.ANOP - p1.To.SetTarget(q) - p2.To.SetTarget(q) - } - case ARET: if p.From.Type == obj.TYPE_CONST { ctxt.Diag("using BECOME (%v) is not supported!", p) diff --git a/src/cmd/internal/obj/ppc64/obj9.go b/src/cmd/internal/obj/ppc64/obj9.go index 2d2c198ab9..5615b70aad 100644 --- a/src/cmd/internal/obj/ppc64/obj9.go +++ b/src/cmd/internal/obj/ppc64/obj9.go @@ -806,8 +806,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { } autosize := int32(0) - var p1 *obj.Prog - var p2 *obj.Prog for p := c.cursym.Func().Text; p != nil; p = p.Link { o := p.As switch o { @@ -967,96 +965,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { q.To.Offset = 24 } - if c.cursym.Func().Text.From.Sym.Wrapper() { - // if(g->panic != nil && g->panic->argp == FP) g->panic->argp = bottom-of-frame - // - // MOVD g_panic(g), R22 - // CMP R22, $0 - // BEQ end - // MOVD panic_argp(R22), R23 - // ADD $(autosize+8), R1, R24 - // CMP R23, R24 - // BNE end - // ADD $8, R1, R25 - // MOVD R25, panic_argp(R22) - // end: - // NOP - // - // The NOP is needed to give the jumps somewhere to land. - // It is a liblink NOP, not a ppc64 NOP: it encodes to 0 instruction bytes. - - q = obj.Appendp(q, c.newprog) - - q.As = AMOVD - q.From.Type = obj.TYPE_MEM - q.From.Reg = REGG - q.From.Offset = 4 * int64(c.ctxt.Arch.PtrSize) // G.panic - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R22 - - q = obj.Appendp(q, c.newprog) - q.As = ACMP - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R22 - q.To.Type = obj.TYPE_CONST - q.To.Offset = 0 - - q = obj.Appendp(q, c.newprog) - q.As = ABEQ - q.To.Type = obj.TYPE_BRANCH - p1 = q - - q = obj.Appendp(q, c.newprog) - q.As = AMOVD - q.From.Type = obj.TYPE_MEM - q.From.Reg = REG_R22 - q.From.Offset = 0 // Panic.argp - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R23 - - q = obj.Appendp(q, c.newprog) - q.As = AADD - q.From.Type = obj.TYPE_CONST - q.From.Offset = int64(autosize) + c.ctxt.Arch.FixedFrameSize - q.Reg = REGSP - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R24 - - q = obj.Appendp(q, c.newprog) - q.As = ACMP - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R23 - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R24 - - q = obj.Appendp(q, c.newprog) - q.As = ABNE - q.To.Type = obj.TYPE_BRANCH - p2 = q - - q = obj.Appendp(q, c.newprog) - q.As = AADD - q.From.Type = obj.TYPE_CONST - q.From.Offset = c.ctxt.Arch.FixedFrameSize - q.Reg = REGSP - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R25 - - q = obj.Appendp(q, c.newprog) - q.As = AMOVD - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R25 - q.To.Type = obj.TYPE_MEM - q.To.Reg = REG_R22 - q.To.Offset = 0 // Panic.argp - - q = obj.Appendp(q, c.newprog) - - q.As = obj.ANOP - p1.To.SetTarget(q) - p2.To.SetTarget(q) - } - case obj.ARET: if p.From.Type == obj.TYPE_CONST { c.ctxt.Diag("using BECOME (%v) is not supported!", p) diff --git a/src/cmd/internal/obj/riscv/obj.go b/src/cmd/internal/obj/riscv/obj.go index 5b598b5757..078e81a2f7 100644 --- a/src/cmd/internal/obj/riscv/obj.go +++ b/src/cmd/internal/obj/riscv/obj.go @@ -564,85 +564,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { prologue.To = obj.Addr{Type: obj.TYPE_MEM, Reg: REG_SP, Offset: 0} } - if cursym.Func().Text.From.Sym.Wrapper() { - // if(g->panic != nil && g->panic->argp == FP) g->panic->argp = bottom-of-frame - // - // MOV g_panic(g), X5 - // BNE X5, ZERO, adjust - // end: - // NOP - // ...rest of function.. - // adjust: - // MOV panic_argp(X5), X6 - // ADD $(autosize+FIXED_FRAME), SP, X7 - // BNE X6, X7, end - // ADD $FIXED_FRAME, SP, X6 - // MOV X6, panic_argp(X5) - // JMP end - // - // The NOP is needed to give the jumps somewhere to land. - - ldpanic := obj.Appendp(prologue, newprog) - - ldpanic.As = AMOV - ldpanic.From = obj.Addr{Type: obj.TYPE_MEM, Reg: REGG, Offset: 4 * int64(ctxt.Arch.PtrSize)} // G.panic - ldpanic.Reg = obj.REG_NONE - ldpanic.To = obj.Addr{Type: obj.TYPE_REG, Reg: REG_X5} - - bneadj := obj.Appendp(ldpanic, newprog) - bneadj.As = ABNE - bneadj.From = obj.Addr{Type: obj.TYPE_REG, Reg: REG_X5} - bneadj.Reg = REG_ZERO - bneadj.To.Type = obj.TYPE_BRANCH - - endadj := obj.Appendp(bneadj, newprog) - endadj.As = obj.ANOP - - last := endadj - for last.Link != nil { - last = last.Link - } - - getargp := obj.Appendp(last, newprog) - getargp.As = AMOV - getargp.From = obj.Addr{Type: obj.TYPE_MEM, Reg: REG_X5, Offset: 0} // Panic.argp - getargp.Reg = obj.REG_NONE - getargp.To = obj.Addr{Type: obj.TYPE_REG, Reg: REG_X6} - - bneadj.To.SetTarget(getargp) - - calcargp := obj.Appendp(getargp, newprog) - calcargp.As = AADDI - calcargp.From = obj.Addr{Type: obj.TYPE_CONST, Offset: stacksize + ctxt.Arch.FixedFrameSize} - calcargp.Reg = REG_SP - calcargp.To = obj.Addr{Type: obj.TYPE_REG, Reg: REG_X7} - - testargp := obj.Appendp(calcargp, newprog) - testargp.As = ABNE - testargp.From = obj.Addr{Type: obj.TYPE_REG, Reg: REG_X6} - testargp.Reg = REG_X7 - testargp.To.Type = obj.TYPE_BRANCH - testargp.To.SetTarget(endadj) - - adjargp := obj.Appendp(testargp, newprog) - adjargp.As = AADDI - adjargp.From = obj.Addr{Type: obj.TYPE_CONST, Offset: int64(ctxt.Arch.PtrSize)} - adjargp.Reg = REG_SP - adjargp.To = obj.Addr{Type: obj.TYPE_REG, Reg: REG_X6} - - setargp := obj.Appendp(adjargp, newprog) - setargp.As = AMOV - setargp.From = obj.Addr{Type: obj.TYPE_REG, Reg: REG_X6} - setargp.Reg = obj.REG_NONE - setargp.To = obj.Addr{Type: obj.TYPE_MEM, Reg: REG_X5, Offset: 0} // Panic.argp - - godone := obj.Appendp(setargp, newprog) - godone.As = AJAL - godone.From = obj.Addr{Type: obj.TYPE_REG, Reg: REG_ZERO} - godone.To.Type = obj.TYPE_BRANCH - godone.To.SetTarget(endadj) - } - // Update stack-based offsets. for p := cursym.Func().Text; p != nil; p = p.Link { stackOffset(&p.From, stacksize) diff --git a/src/cmd/internal/obj/s390x/a.out.go b/src/cmd/internal/obj/s390x/a.out.go index 3eed4624b1..dc715182f5 100644 --- a/src/cmd/internal/obj/s390x/a.out.go +++ b/src/cmd/internal/obj/s390x/a.out.go @@ -444,6 +444,7 @@ const ( // storage-and-storage AMVC AMVCIN + AMVCLE ACLC AXC AOC @@ -714,6 +715,14 @@ const ( AWFLNDB AVFLPDB AWFLPDB + AVFMAXDB + AWFMAXDB + AVFMAXSB + AWFMAXSB + AVFMINDB + AWFMINDB + AVFMINSB + AWFMINSB AVFSQ AVFSQDB AWFSQDB diff --git a/src/cmd/internal/obj/s390x/anames.go b/src/cmd/internal/obj/s390x/anames.go index ae86d2092b..a6f2820f85 100644 --- a/src/cmd/internal/obj/s390x/anames.go +++ b/src/cmd/internal/obj/s390x/anames.go @@ -181,6 +181,7 @@ var Anames = []string{ "CMPUBNE", "MVC", "MVCIN", + "MVCLE", "CLC", "XC", "OC", @@ -437,6 +438,14 @@ var Anames = []string{ "WFLNDB", "VFLPDB", "WFLPDB", + "VFMAXDB", + "WFMAXDB", + "VFMAXSB", + "WFMAXSB", + "VFMINDB", + "WFMINDB", + "VFMINSB", + "WFMINSB", "VFSQ", "VFSQDB", "WFSQDB", diff --git a/src/cmd/internal/obj/s390x/asmz.go b/src/cmd/internal/obj/s390x/asmz.go index 6511549eeb..957222a155 100644 --- a/src/cmd/internal/obj/s390x/asmz.go +++ b/src/cmd/internal/obj/s390x/asmz.go @@ -441,6 +441,11 @@ var optab = []Optab{ {i: 119, as: AVERLLVG, a1: C_VREG, a2: C_VREG, a6: C_VREG}, {i: 119, as: AVERLLVG, a1: C_VREG, a6: C_VREG}, + // VRR-c floating point min/max + {i: 128, as: AVFMAXDB, a1: C_SCON, a2: C_VREG, a3: C_VREG, a6: C_VREG}, + {i: 128, as: AWFMAXDB, a1: C_SCON, a2: C_VREG, a3: C_VREG, a6: C_VREG}, + {i: 128, as: AWFMAXDB, a1: C_SCON, a2: C_FREG, a3: C_FREG, a6: C_FREG}, + // VRR-d {i: 120, as: AVACQ, a1: C_VREG, a2: C_VREG, a3: C_VREG, a6: C_VREG}, @@ -449,6 +454,10 @@ var optab = []Optab{ // VRR-f {i: 122, as: AVLVGP, a1: C_REG, a2: C_REG, a6: C_VREG}, + + // MVC storage and storage + {i: 127, as: AMVCLE, a1: C_LOREG, a2: C_REG, a6: C_REG}, + {i: 127, as: AMVCLE, a1: C_SCON, a2: C_REG, a6: C_REG}, } var oprange [ALAST & obj.AMask][]Optab @@ -1476,6 +1485,14 @@ func buildop(ctxt *obj.Link) { opset(AVFMSDB, r) opset(AWFMSDB, r) opset(AVPERM, r) + case AVFMAXDB: + opset(AVFMAXSB, r) + opset(AVFMINDB, r) + opset(AVFMINSB, r) + case AWFMAXDB: + opset(AWFMAXSB, r) + opset(AWFMINDB, r) + opset(AWFMINSB, r) case AKM: opset(AKMC, r) opset(AKLMD, r) @@ -2632,6 +2649,8 @@ const ( op_VUPLL uint32 = 0xE7D4 // VRR-a VECTOR UNPACK LOGICAL LOW op_VUPL uint32 = 0xE7D6 // VRR-a VECTOR UNPACK LOW op_VMSL uint32 = 0xE7B8 // VRR-d VECTOR MULTIPLY SUM LOGICAL + op_VFMAX uint32 = 0xE7EF // VRR-c VECTOR FP MAXIMUM + op_VFMIN uint32 = 0xE7EE // VRR-c VECTOR FP MINIMUM // added in z15 op_KDSA uint32 = 0xB93A // FORMAT_RRE COMPUTE DIGITAL SIGNATURE AUTHENTICATION (KDSA) @@ -4453,6 +4472,30 @@ func (c *ctxtz) asmout(p *obj.Prog, asm *[]byte) { } } zRRF(opcode, uint32(p.Reg), 0, uint32(p.From.Reg), uint32(p.To.Reg), asm) + + case 127: + // NOTE: Mapping MVCLE operands is as follows: + // Instruction Format: MVCLE R1,R3,D2(B2) + // R1 - prog.To (for Destination) + // R3 - prog.Reg (for Source) + // B2 - prog.From (for Padding Byte) + d2 := c.regoff(&p.From) + if p.To.Reg&1 != 0 { + c.ctxt.Diag("output argument must be even register in %v", p) + } + if p.Reg&1 != 0 { + c.ctxt.Diag("input argument must be an even register in %v", p) + } + if (p.From.Reg == p.To.Reg) || (p.From.Reg == p.Reg) { + c.ctxt.Diag("padding byte register cannot be same as input or output register %v", p) + } + zRS(op_MVCLE, uint32(p.To.Reg), uint32(p.Reg), uint32(p.From.Reg), uint32(d2), asm) + + case 128: // VRR-c floating point max/min + op, m4, _ := vop(p.As) + m5 := singleElementMask(p.As) + m6 := uint32(c.vregoff(&p.From)) + zVRRc(op, uint32(p.To.Reg), uint32(p.Reg), uint32(p.GetFrom3().Reg), m6, m5, m4, asm) } } diff --git a/src/cmd/internal/obj/s390x/objz.go b/src/cmd/internal/obj/s390x/objz.go index 80b233d832..44c1a7d586 100644 --- a/src/cmd/internal/obj/s390x/objz.go +++ b/src/cmd/internal/obj/s390x/objz.go @@ -384,96 +384,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { break } - if c.cursym.Func().Text.From.Sym.Wrapper() { - // if(g->panic != nil && g->panic->argp == FP) g->panic->argp = bottom-of-frame - // - // MOVD g_panic(g), R3 - // CMP R3, $0 - // BEQ end - // MOVD panic_argp(R3), R4 - // ADD $(autosize+8), R1, R5 - // CMP R4, R5 - // BNE end - // ADD $8, R1, R6 - // MOVD R6, panic_argp(R3) - // end: - // NOP - // - // The NOP is needed to give the jumps somewhere to land. - // It is a liblink NOP, not a s390x NOP: it encodes to 0 instruction bytes. - - q = obj.Appendp(q, c.newprog) - - q.As = AMOVD - q.From.Type = obj.TYPE_MEM - q.From.Reg = REGG - q.From.Offset = 4 * int64(c.ctxt.Arch.PtrSize) // G.panic - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R3 - - q = obj.Appendp(q, c.newprog) - q.As = ACMP - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R3 - q.To.Type = obj.TYPE_CONST - q.To.Offset = 0 - - q = obj.Appendp(q, c.newprog) - q.As = ABEQ - q.To.Type = obj.TYPE_BRANCH - p1 := q - - q = obj.Appendp(q, c.newprog) - q.As = AMOVD - q.From.Type = obj.TYPE_MEM - q.From.Reg = REG_R3 - q.From.Offset = 0 // Panic.argp - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R4 - - q = obj.Appendp(q, c.newprog) - q.As = AADD - q.From.Type = obj.TYPE_CONST - q.From.Offset = int64(autosize) + c.ctxt.Arch.FixedFrameSize - q.Reg = REGSP - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R5 - - q = obj.Appendp(q, c.newprog) - q.As = ACMP - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R4 - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R5 - - q = obj.Appendp(q, c.newprog) - q.As = ABNE - q.To.Type = obj.TYPE_BRANCH - p2 := q - - q = obj.Appendp(q, c.newprog) - q.As = AADD - q.From.Type = obj.TYPE_CONST - q.From.Offset = c.ctxt.Arch.FixedFrameSize - q.Reg = REGSP - q.To.Type = obj.TYPE_REG - q.To.Reg = REG_R6 - - q = obj.Appendp(q, c.newprog) - q.As = AMOVD - q.From.Type = obj.TYPE_REG - q.From.Reg = REG_R6 - q.To.Type = obj.TYPE_MEM - q.To.Reg = REG_R3 - q.To.Offset = 0 // Panic.argp - - q = obj.Appendp(q, c.newprog) - - q.As = obj.ANOP - p1.To.SetTarget(q) - p2.To.SetTarget(q) - } - case obj.ARET: retTarget := p.To.Sym diff --git a/src/cmd/internal/obj/s390x/vector.go b/src/cmd/internal/obj/s390x/vector.go index e7e36eaf15..966cd04c27 100644 --- a/src/cmd/internal/obj/s390x/vector.go +++ b/src/cmd/internal/obj/s390x/vector.go @@ -1027,6 +1027,22 @@ func vop(as obj.As) (opcode, es, cs uint32) { return op_VUPL, 1, 0 case AVUPLF: return op_VUPL, 2, 0 + case AVFMAXDB: + return op_VFMAX, 3, 0 + case AWFMAXDB: + return op_VFMAX, 3, 0 + case AVFMAXSB: + return op_VFMAX, 2, 0 + case AWFMAXSB: + return op_VFMAX, 2, 0 + case AVFMINDB: + return op_VFMIN, 3, 0 + case AWFMINDB: + return op_VFMIN, 3, 0 + case AVFMINSB: + return op_VFMIN, 2, 0 + case AWFMINSB: + return op_VFMIN, 2, 0 } } @@ -1062,7 +1078,11 @@ func singleElementMask(as obj.As) uint32 { AWFSQDB, AWFSDB, AWFTCIDB, - AWFIDB: + AWFIDB, + AWFMAXDB, + AWFMAXSB, + AWFMINDB, + AWFMINSB: return 8 } return 0 diff --git a/src/cmd/internal/obj/wasm/wasmobj.go b/src/cmd/internal/obj/wasm/wasmobj.go index 9a3520f319..011294597a 100644 --- a/src/cmd/internal/obj/wasm/wasmobj.go +++ b/src/cmd/internal/obj/wasm/wasmobj.go @@ -202,59 +202,6 @@ func preprocess(ctxt *obj.Link, s *obj.LSym, newprog obj.ProgAlloc) { framesize = 0 } else if s.Func().WasmExport != nil { genWasmExportWrapper(s, appendp) - } else if s.Func().Text.From.Sym.Wrapper() { - // if g._panic != nil && g._panic.argp == FP { - // g._panic.argp = bottom-of-frame - // } - // - // MOVD g_panic(g), R0 - // Get R0 - // I64Eqz - // Not - // If - // Get SP - // I64ExtendI32U - // I64Const $framesize+8 - // I64Add - // I64Load panic_argp(R0) - // I64Eq - // If - // MOVD SP, panic_argp(R0) - // End - // End - - gpanic := obj.Addr{ - Type: obj.TYPE_MEM, - Reg: REGG, - Offset: 4 * 8, // g_panic - } - - panicargp := obj.Addr{ - Type: obj.TYPE_MEM, - Reg: REG_R0, - Offset: 0, // panic.argp - } - - p := s.Func().Text - p = appendp(p, AMOVD, gpanic, regAddr(REG_R0)) - - p = appendp(p, AGet, regAddr(REG_R0)) - p = appendp(p, AI64Eqz) - p = appendp(p, ANot) - p = appendp(p, AIf) - - p = appendp(p, AGet, regAddr(REG_SP)) - p = appendp(p, AI64ExtendI32U) - p = appendp(p, AI64Const, constAddr(framesize+8)) - p = appendp(p, AI64Add) - p = appendp(p, AI64Load, panicargp) - - p = appendp(p, AI64Eq) - p = appendp(p, AIf) - p = appendp(p, AMOVD, regAddr(REG_SP), panicargp) - p = appendp(p, AEnd) - - p = appendp(p, AEnd) } if framesize > 0 && s.Func().WasmExport == nil { // genWasmExportWrapper has its own prologue generation @@ -372,6 +319,9 @@ func preprocess(ctxt *obj.Link, s *obj.LSym, newprog obj.ProgAlloc) { } tableIdxs = append(tableIdxs, uint64(numResumePoints)) s.Size = pc + 1 + if pc >= 1<<16 { + ctxt.Diag("function too big: %s exceeds 65536 blocks", s) + } if needMoreStack { p := pMorestack @@ -465,9 +415,9 @@ func preprocess(ctxt *obj.Link, s *obj.LSym, newprog obj.ProgAlloc) { case obj.TYPE_NONE: // (target PC is on stack) + p = appendp(p, AI64Const, constAddr(16)) // only needs PC_F bits (16-63), PC_B bits (0-15) are zero + p = appendp(p, AI64ShrU) p = appendp(p, AI32WrapI64) - p = appendp(p, AI32Const, constAddr(16)) // only needs PC_F bits (16-31), PC_B bits (0-15) are zero - p = appendp(p, AI32ShrU) // Set PC_B parameter to function entry. // We need to push this before pushing the target PC_F, @@ -521,9 +471,9 @@ func preprocess(ctxt *obj.Link, s *obj.LSym, newprog obj.ProgAlloc) { case obj.TYPE_NONE: // (target PC is on stack) + p = appendp(p, AI64Const, constAddr(16)) // only needs PC_F bits (16-63), PC_B bits (0-15) are zero + p = appendp(p, AI64ShrU) p = appendp(p, AI32WrapI64) - p = appendp(p, AI32Const, constAddr(16)) // only needs PC_F bits (16-31), PC_B bits (0-15) are zero - p = appendp(p, AI32ShrU) // Set PC_B parameter to function entry. // We need to push this before pushing the target PC_F, diff --git a/src/cmd/internal/obj/x86/obj6.go b/src/cmd/internal/obj/x86/obj6.go index 53c0918254..7f308686c1 100644 --- a/src/cmd/internal/obj/x86/obj6.go +++ b/src/cmd/internal/obj/x86/obj6.go @@ -653,6 +653,11 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { case obj.ACALL: // Treat common runtime calls that take no arguments // the same as duffcopy and duffzero. + + // Note that of these functions, panicBounds does + // use some stack, but its stack together with the + // < StackSmall used by this function is still + // less than stackNosplit. See issue 31219. if !isZeroArgRuntimeCall(q.To.Sym) { leaf = false break LeafSearch @@ -671,20 +676,9 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { } } - var regEntryTmp0, regEntryTmp1 int16 - if ctxt.Arch.Family == sys.AMD64 { - regEntryTmp0, regEntryTmp1 = REGENTRYTMP0, REGENTRYTMP1 - } else { - regEntryTmp0, regEntryTmp1 = REG_BX, REG_DI - } - - var regg int16 if !p.From.Sym.NoSplit() { - // Emit split check and load G register - p, regg = stacksplit(ctxt, cursym, p, newprog, autoffset, int32(textarg)) - } else if p.From.Sym.Wrapper() { - // Load G register for the wrapper code - p, regg = loadG(ctxt, cursym, p, newprog) + // Emit split check. + p = stacksplit(ctxt, cursym, p, newprog, autoffset, int32(textarg)) } if bpsize > 0 { @@ -726,123 +720,6 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) { p.Pos = p.Pos.WithXlogue(src.PosPrologueEnd) } - if cursym.Func().Text.From.Sym.Wrapper() { - // if g._panic != nil && g._panic.argp == FP { - // g._panic.argp = bottom-of-frame - // } - // - // MOVQ g_panic(g), regEntryTmp0 - // TESTQ regEntryTmp0, regEntryTmp0 - // JNE checkargp - // end: - // NOP - // ... rest of function ... - // checkargp: - // LEAQ (autoffset+8)(SP), regEntryTmp1 - // CMPQ panic_argp(regEntryTmp0), regEntryTmp1 - // JNE end - // MOVQ SP, panic_argp(regEntryTmp0) - // JMP end - // - // The NOP is needed to give the jumps somewhere to land. - // It is a liblink NOP, not an x86 NOP: it encodes to 0 instruction bytes. - // - // The layout is chosen to help static branch prediction: - // Both conditional jumps are unlikely, so they are arranged to be forward jumps. - - // MOVQ g_panic(g), regEntryTmp0 - p = obj.Appendp(p, newprog) - p.As = AMOVQ - p.From.Type = obj.TYPE_MEM - p.From.Reg = regg - p.From.Offset = 4 * int64(ctxt.Arch.PtrSize) // g_panic - p.To.Type = obj.TYPE_REG - p.To.Reg = regEntryTmp0 - if ctxt.Arch.Family == sys.I386 { - p.As = AMOVL - } - - // TESTQ regEntryTmp0, regEntryTmp0 - p = obj.Appendp(p, newprog) - p.As = ATESTQ - p.From.Type = obj.TYPE_REG - p.From.Reg = regEntryTmp0 - p.To.Type = obj.TYPE_REG - p.To.Reg = regEntryTmp0 - if ctxt.Arch.Family == sys.I386 { - p.As = ATESTL - } - - // JNE checkargp (checkargp to be resolved later) - jne := obj.Appendp(p, newprog) - jne.As = AJNE - jne.To.Type = obj.TYPE_BRANCH - - // end: - // NOP - end := obj.Appendp(jne, newprog) - end.As = obj.ANOP - - // Fast forward to end of function. - var last *obj.Prog - for last = end; last.Link != nil; last = last.Link { - } - - // LEAQ (autoffset+8)(SP), regEntryTmp1 - p = obj.Appendp(last, newprog) - p.As = ALEAQ - p.From.Type = obj.TYPE_MEM - p.From.Reg = REG_SP - p.From.Offset = int64(autoffset) + int64(ctxt.Arch.RegSize) - p.To.Type = obj.TYPE_REG - p.To.Reg = regEntryTmp1 - if ctxt.Arch.Family == sys.I386 { - p.As = ALEAL - } - - // Set jne branch target. - jne.To.SetTarget(p) - - // CMPQ panic_argp(regEntryTmp0), regEntryTmp1 - p = obj.Appendp(p, newprog) - p.As = ACMPQ - p.From.Type = obj.TYPE_MEM - p.From.Reg = regEntryTmp0 - p.From.Offset = 0 // Panic.argp - p.To.Type = obj.TYPE_REG - p.To.Reg = regEntryTmp1 - if ctxt.Arch.Family == sys.I386 { - p.As = ACMPL - } - - // JNE end - p = obj.Appendp(p, newprog) - p.As = AJNE - p.To.Type = obj.TYPE_BRANCH - p.To.SetTarget(end) - - // MOVQ SP, panic_argp(regEntryTmp0) - p = obj.Appendp(p, newprog) - p.As = AMOVQ - p.From.Type = obj.TYPE_REG - p.From.Reg = REG_SP - p.To.Type = obj.TYPE_MEM - p.To.Reg = regEntryTmp0 - p.To.Offset = 0 // Panic.argp - if ctxt.Arch.Family == sys.I386 { - p.As = AMOVL - } - - // JMP end - p = obj.Appendp(p, newprog) - p.As = obj.AJMP - p.To.Type = obj.TYPE_BRANCH - p.To.SetTarget(end) - - // Reset p for following code. - p = end - } - var deltasp int32 for p = cursym.Func().Text; p != nil; p = p.Link { pcsize := ctxt.Arch.RegSize @@ -969,13 +846,7 @@ func isZeroArgRuntimeCall(s *obj.LSym) bool { return false } switch s.Name { - case "runtime.panicdivide", "runtime.panicwrap", "runtime.panicshift": - return true - } - if strings.HasPrefix(s.Name, "runtime.panicIndex") || strings.HasPrefix(s.Name, "runtime.panicSlice") { - // These functions do take arguments (in registers), - // but use no stack before they do a stack check. We - // should include them. See issue 31219. + case "runtime.panicdivide", "runtime.panicwrap", "runtime.panicshift", "runtime.panicBounds", "runtime.panicExtend": return true } return false @@ -1029,8 +900,8 @@ func loadG(ctxt *obj.Link, cursym *obj.LSym, p *obj.Prog, newprog obj.ProgAlloc) // Append code to p to check for stack split. // Appends to (does not overwrite) p. // Assumes g is in rg. -// Returns last new instruction and G register. -func stacksplit(ctxt *obj.Link, cursym *obj.LSym, p *obj.Prog, newprog obj.ProgAlloc, framesize int32, textarg int32) (*obj.Prog, int16) { +// Returns last new instruction. +func stacksplit(ctxt *obj.Link, cursym *obj.LSym, p *obj.Prog, newprog obj.ProgAlloc, framesize int32, textarg int32) *obj.Prog { cmp := ACMPQ lea := ALEAQ mov := AMOVQ @@ -1244,7 +1115,7 @@ func stacksplit(ctxt *obj.Link, cursym *obj.LSym, p *obj.Prog, newprog obj.ProgA q1.To.SetTarget(spill) } - return end, rg + return end } func isR15(r int16) bool { diff --git a/src/cmd/internal/objabi/pkgspecial.go b/src/cmd/internal/objabi/pkgspecial.go index e09aeadbc2..fe510160b3 100644 --- a/src/cmd/internal/objabi/pkgspecial.go +++ b/src/cmd/internal/objabi/pkgspecial.go @@ -56,7 +56,8 @@ var runtimePkgs = []string{ "internal/runtime/math", "internal/runtime/strconv", "internal/runtime/sys", - "internal/runtime/syscall", + "internal/runtime/syscall/linux", + "internal/runtime/syscall/windows", "internal/abi", "internal/bytealg", @@ -94,7 +95,8 @@ var allowAsmABIPkgs = []string{ "syscall", "internal/bytealg", "internal/chacha8rand", - "internal/runtime/syscall", + "internal/runtime/syscall/linux", + "internal/runtime/syscall/windows", "internal/runtime/startlinetest", } diff --git a/src/cmd/internal/objabi/reloctype.go b/src/cmd/internal/objabi/reloctype.go index fbf6844b8d..9b9b4b7ee3 100644 --- a/src/cmd/internal/objabi/reloctype.go +++ b/src/cmd/internal/objabi/reloctype.go @@ -466,7 +466,7 @@ func (r RelocType) IsDwTxtAddr() bool { // FuncCountToDwTxtAddrFlavor returns the correct DWARF .debug_addr // section relocation to use when compiling a package with a total of // fncount functions, along with the size of the ULEB128-encoded blob -// needed to store the the eventual .debug_addr index. +// needed to store the eventual .debug_addr index. func FuncCountToDwTxtAddrFlavor(fncount int) (RelocType, int) { switch { case fncount <= 127: diff --git a/src/cmd/internal/testdir/testdir_test.go b/src/cmd/internal/testdir/testdir_test.go index 483a9ec33c..666645873b 100644 --- a/src/cmd/internal/testdir/testdir_test.go +++ b/src/cmd/internal/testdir/testdir_test.go @@ -1462,9 +1462,10 @@ func (t test) wantedErrors(file, short string) (errs []wantedError) { const ( // Regexp to match a single opcode check: optionally begin with "-" (to indicate - // a negative check), followed by a string literal enclosed in "" or ``. For "", + // a negative check) or a positive number (to specify the expected number of + // matches), followed by a string literal enclosed in "" or ``. For "", // backslashes must be handled. - reMatchCheck = `-?(?:\x60[^\x60]*\x60|"(?:[^"\\]|\\.)*")` + reMatchCheck = `(-|[1-9]\d*)?(?:\x60[^\x60]*\x60|"(?:[^"\\]|\\.)*")` ) var ( @@ -1516,6 +1517,8 @@ type wantedAsmOpcode struct { fileline string // original source file/line (eg: "/path/foo.go:45") line int // original source line opcode *regexp.Regexp // opcode check to be performed on assembly output + expected int // expected number of matches + actual int // actual number that matched negative bool // true if the check is supposed to fail rather than pass found bool // true if the opcode check matched at least one in the output } @@ -1622,9 +1625,16 @@ func (t test) wantedAsmOpcodes(fn string) asmChecks { for _, m := range rxAsmCheck.FindAllString(allchecks, -1) { negative := false + expected := 0 if m[0] == '-' { negative = true m = m[1:] + } else if '1' <= m[0] && m[0] <= '9' { + for '0' <= m[0] && m[0] <= '9' { + expected *= 10 + expected += int(m[0] - '0') + m = m[1:] + } } rxsrc, err := strconv.Unquote(m) @@ -1650,6 +1660,7 @@ func (t test) wantedAsmOpcodes(fn string) asmChecks { ops[env] = make(map[string][]wantedAsmOpcode) } ops[env][lnum] = append(ops[env][lnum], wantedAsmOpcode{ + expected: expected, negative: negative, fileline: lnum, line: i + 1, @@ -1698,7 +1709,8 @@ func (t test) asmCheck(outStr string, fn string, env buildEnv, fullops map[strin // run the checks. if ops, found := fullops[srcFileLine]; found { for i := range ops { - if !ops[i].found && ops[i].opcode.FindString(asm) != "" { + if (!ops[i].found || ops[i].expected > 0) && ops[i].opcode.FindString(asm) != "" { + ops[i].actual++ ops[i].found = true } } @@ -1714,6 +1726,9 @@ func (t test) asmCheck(outStr string, fn string, env buildEnv, fullops map[strin if o.negative == o.found { failed = append(failed, o) } + if o.expected > 0 && o.expected != o.actual { + failed = append(failed, o) + } } } if len(failed) == 0 { @@ -1737,6 +1752,8 @@ func (t test) asmCheck(outStr string, fn string, env buildEnv, fullops map[strin if o.negative { fmt.Fprintf(&errbuf, "%s:%d: %s: wrong opcode found: %q\n", t.goFileName(), o.line, env, o.opcode.String()) + } else if o.expected > 0 { + fmt.Fprintf(&errbuf, "%s:%d: %s: wrong number of opcodes: %q\n", t.goFileName(), o.line, env, o.opcode.String()) } else { fmt.Fprintf(&errbuf, "%s:%d: %s: opcode not found: %q\n", t.goFileName(), o.line, env, o.opcode.String()) } diff --git a/src/cmd/link/dwarf_test.go b/src/cmd/link/dwarf_test.go index 68849d7db9..d269aa70c6 100644 --- a/src/cmd/link/dwarf_test.go +++ b/src/cmd/link/dwarf_test.go @@ -256,3 +256,105 @@ func TestDWARFiOS(t *testing.T) { testDWARF(t, "c-archive", true, cc, "CGO_ENABLED=1", "GOOS=ios", "GOARCH=arm64") }) } + +// This test ensures that variables promoted to the heap, specifically +// function return parameters, have correct location lists generated. +// +// TODO(deparker): This test is intentionally limited to GOOS=="linux" +// and scoped to net.sendFile, which was the function reported originally in +// issue #65405. There is relevant discussion in https://go-review.googlesource.com/c/go/+/684377 +// pertaining to these limitations. There are other missing location lists which must be fixed +// particularly in functions where `linkname` is involved. +func TestDWARFLocationList(t *testing.T) { + if runtime.GOOS != "linux" { + t.Skip("skipping test on non-linux OS") + } + testenv.MustHaveCGO(t) + testenv.MustHaveGoBuild(t) + + if !platform.ExecutableHasDWARF(runtime.GOOS, runtime.GOARCH) { + t.Skipf("skipping on %s/%s: no DWARF symbol table in executables", runtime.GOOS, runtime.GOARCH) + } + + t.Parallel() + + tmpDir := t.TempDir() + exe := filepath.Join(tmpDir, "issue65405.exe") + dir := "./testdata/dwarf/issue65405" + + cmd := testenv.Command(t, testenv.GoToolPath(t), "build", "-toolexec", os.Args[0], "-gcflags=all=-N -l", "-o", exe, dir) + cmd.Env = append(os.Environ(), "CGO_CFLAGS=") + cmd.Env = append(cmd.Env, "LINK_TEST_TOOLEXEC=1") + out, err := cmd.CombinedOutput() + if err != nil { + t.Fatalf("go build -o %v %v: %v\n%s", exe, dir, err, out) + } + + f, err := objfile.Open(exe) + if err != nil { + t.Fatal(err) + } + defer f.Close() + + d, err := f.DWARF() + if err != nil { + t.Fatal(err) + } + + // Find the net.sendFile function and check its return parameter location list + reader := d.Reader() + + for { + entry, err := reader.Next() + if err != nil { + t.Fatal(err) + } + if entry == nil { + break + } + + // Look for the net.sendFile subprogram + if entry.Tag == dwarf.TagSubprogram { + fnName, ok := entry.Val(dwarf.AttrName).(string) + if !ok || fnName != "net.sendFile" { + reader.SkipChildren() + continue + } + + for { + paramEntry, err := reader.Next() + if err != nil { + t.Fatal(err) + } + if paramEntry == nil || paramEntry.Tag == 0 { + break + } + + if paramEntry.Tag == dwarf.TagFormalParameter { + paramName, _ := paramEntry.Val(dwarf.AttrName).(string) + + // Check if this parameter has a location attribute + if loc := paramEntry.Val(dwarf.AttrLocation); loc != nil { + switch locData := loc.(type) { + case []byte: + if len(locData) == 0 { + t.Errorf("%s return parameter %q has empty location list", fnName, paramName) + return + } + case int64: + // Location list offset - this means it has a location list + if locData == 0 { + t.Errorf("%s return parameter %q has zero location list offset", fnName, paramName) + return + } + default: + t.Errorf("%s return parameter %q has unexpected location type %T: %v", fnName, paramName, locData, locData) + } + } else { + t.Errorf("%s return parameter %q has no location attribute", fnName, paramName) + } + } + } + } + } +} diff --git a/src/cmd/link/internal/ld/data.go b/src/cmd/link/internal/ld/data.go index 42756e86bb..138547a3d3 100644 --- a/src/cmd/link/internal/ld/data.go +++ b/src/cmd/link/internal/ld/data.go @@ -496,6 +496,15 @@ func (st *relocSymState) relocsym(s loader.Sym, P []byte) { // to the start of the first text section, even if there are multiple. if sect.Name == ".text" { o = ldr.SymValue(rs) - int64(Segtext.Sections[0].Vaddr) + r.Add() + if target.IsWasm() { + // On Wasm, textoff (e.g. in the method table) is just the function index, + // whereas the "PC" (rs's Value) is function index << 16 + block index (see + // ../wasm/asm.go:assignAddress). + if o&(1<<16-1) != 0 { + st.err.Errorf(s, "textoff relocation %s does not target function entry: %s %#x", rt, ldr.SymName(rs), o) + } + o >>= 16 + } } else { o = ldr.SymValue(rs) - int64(ldr.SymSect(rs).Vaddr) + r.Add() } @@ -606,16 +615,16 @@ func (st *relocSymState) relocsym(s loader.Sym, P []byte) { P[off] = byte(int8(o)) case 2: if (rt == objabi.R_PCREL || rt == objabi.R_CALL) && o != int64(int16(o)) { - st.err.Errorf(s, "pc-relative relocation address for %s is too big: %#x", ldr.SymName(rs), o) + st.err.Errorf(s, "pc-relative relocation %s address for %s is too big: %#x", rt, ldr.SymName(rs), o) } else if o != int64(int16(o)) && o != int64(uint16(o)) { - st.err.Errorf(s, "non-pc-relative relocation address for %s is too big: %#x", ldr.SymName(rs), uint64(o)) + st.err.Errorf(s, "non-pc-relative relocation %s address for %s is too big: %#x", rt, ldr.SymName(rs), uint64(o)) } target.Arch.ByteOrder.PutUint16(P[off:], uint16(o)) case 4: if (rt == objabi.R_PCREL || rt == objabi.R_CALL) && o != int64(int32(o)) { - st.err.Errorf(s, "pc-relative relocation address for %s is too big: %#x", ldr.SymName(rs), o) + st.err.Errorf(s, "pc-relative relocation %s address for %s is too big: %#x", rt, ldr.SymName(rs), o) } else if o != int64(int32(o)) && o != int64(uint32(o)) { - st.err.Errorf(s, "non-pc-relative relocation address for %s is too big: %#x", ldr.SymName(rs), uint64(o)) + st.err.Errorf(s, "non-pc-relative relocation %s address for %s is too big: %#x", rt, ldr.SymName(rs), uint64(o)) } target.Arch.ByteOrder.PutUint32(P[off:], uint32(o)) case 8: diff --git a/src/cmd/link/internal/ld/deadcode.go b/src/cmd/link/internal/ld/deadcode.go index cdf7deb31b..055b4efe5d 100644 --- a/src/cmd/link/internal/ld/deadcode.go +++ b/src/cmd/link/internal/ld/deadcode.go @@ -560,13 +560,9 @@ func (d *deadcodePass) decodetypeMethods(ldr *loader.Loader, arch *sys.Arch, sym case abi.Chan: // reflect.chanType off += 2 * arch.PtrSize case abi.Map: - if buildcfg.Experiment.SwissMap { - off += 7*arch.PtrSize + 4 // internal/abi.SwissMapType - if arch.PtrSize == 8 { - off += 4 // padding for final uint32 field (Flags). - } - } else { - off += 4*arch.PtrSize + 8 // internal/abi.OldMapType + off += 7*arch.PtrSize + 4 // internal/abi.MapType + if arch.PtrSize == 8 { + off += 4 // padding for final uint32 field (Flags). } case abi.Interface: // reflect.interfaceType off += 3 * arch.PtrSize diff --git a/src/cmd/link/internal/ld/decodesym.go b/src/cmd/link/internal/ld/decodesym.go index 4d38ec1a77..8c9fa8efab 100644 --- a/src/cmd/link/internal/ld/decodesym.go +++ b/src/cmd/link/internal/ld/decodesym.go @@ -38,7 +38,7 @@ func uncommonSize(arch *sys.Arch) int { return int(abi.UncommonSize()) } // Type.commonType.kind func decodetypeKind(arch *sys.Arch, p []byte) abi.Kind { - return abi.Kind(p[2*arch.PtrSize+7]) & abi.KindMask // 0x13 / 0x1f + return abi.Kind(p[2*arch.PtrSize+7]) // 0x13 } // Type.commonType.size @@ -158,7 +158,7 @@ func decodetypeMapValue(ldr *loader.Loader, arch *sys.Arch, symIdx loader.Sym) l return decodeRelocSym(ldr, symIdx, &relocs, int32(commonsize(arch))+int32(arch.PtrSize)) // 0x20 / 0x38 } -func decodetypeMapSwissGroup(ldr *loader.Loader, arch *sys.Arch, symIdx loader.Sym) loader.Sym { +func decodetypeMapGroup(ldr *loader.Loader, arch *sys.Arch, symIdx loader.Sym) loader.Sym { relocs := ldr.Relocs(symIdx) return decodeRelocSym(ldr, symIdx, &relocs, int32(commonsize(arch))+2*int32(arch.PtrSize)) // 0x24 / 0x40 } diff --git a/src/cmd/link/internal/ld/dwarf.go b/src/cmd/link/internal/ld/dwarf.go index 602d70ddb9..0003938ef2 100644 --- a/src/cmd/link/internal/ld/dwarf.go +++ b/src/cmd/link/internal/ld/dwarf.go @@ -872,14 +872,6 @@ func (d *dwctxt) mkinternaltype(ctxt *Link, abbrev int, typename, keyname, valna } func (d *dwctxt) synthesizemaptypes(ctxt *Link, die *dwarf.DWDie) { - if buildcfg.Experiment.SwissMap { - d.synthesizemaptypesSwiss(ctxt, die) - } else { - d.synthesizemaptypesOld(ctxt, die) - } -} - -func (d *dwctxt) synthesizemaptypesSwiss(ctxt *Link, die *dwarf.DWDie) { mapType := walktypedef(d.findprotodie(ctxt, "type:internal/runtime/maps.Map")) tableType := walktypedef(d.findprotodie(ctxt, "type:internal/runtime/maps.table")) groupsReferenceType := walktypedef(d.findprotodie(ctxt, "type:internal/runtime/maps.groupsReference")) @@ -892,7 +884,7 @@ func (d *dwctxt) synthesizemaptypesSwiss(ctxt *Link, die *dwarf.DWDie) { keyType := decodetypeMapKey(d.ldr, d.arch, gotype) valType := decodetypeMapValue(d.ldr, d.arch, gotype) - groupType := decodetypeMapSwissGroup(d.ldr, d.arch, gotype) + groupType := decodetypeMapGroup(d.ldr, d.arch, gotype) keyType = d.walksymtypedef(d.defgotype(keyType)) valType = d.walksymtypedef(d.defgotype(valType)) @@ -941,102 +933,6 @@ func (d *dwctxt) synthesizemaptypesSwiss(ctxt *Link, die *dwarf.DWDie) { } } -func (d *dwctxt) synthesizemaptypesOld(ctxt *Link, die *dwarf.DWDie) { - hash := walktypedef(d.findprotodie(ctxt, "type:runtime.hmap")) - bucket := walktypedef(d.findprotodie(ctxt, "type:runtime.bmap")) - - if hash == nil { - return - } - - for ; die != nil; die = die.Link { - if die.Abbrev != dwarf.DW_ABRV_MAPTYPE { - continue - } - gotype := loader.Sym(getattr(die, dwarf.DW_AT_type).Data.(dwSym)) - keytype := decodetypeMapKey(d.ldr, d.arch, gotype) - valtype := decodetypeMapValue(d.ldr, d.arch, gotype) - keydata := d.ldr.Data(keytype) - valdata := d.ldr.Data(valtype) - keysize, valsize := decodetypeSize(d.arch, keydata), decodetypeSize(d.arch, valdata) - keytype, valtype = d.walksymtypedef(d.defgotype(keytype)), d.walksymtypedef(d.defgotype(valtype)) - - // compute size info like hashmap.c does. - indirectKey, indirectVal := false, false - if keysize > abi.OldMapMaxKeyBytes { - keysize = int64(d.arch.PtrSize) - indirectKey = true - } - if valsize > abi.OldMapMaxElemBytes { - valsize = int64(d.arch.PtrSize) - indirectVal = true - } - - // Construct type to represent an array of BucketSize keys - keyname := d.nameFromDIESym(keytype) - dwhks := d.mkinternaltype(ctxt, dwarf.DW_ABRV_ARRAYTYPE, "[]key", keyname, "", func(dwhk *dwarf.DWDie) { - newattr(dwhk, dwarf.DW_AT_byte_size, dwarf.DW_CLS_CONSTANT, abi.OldMapBucketCount*keysize, 0) - t := keytype - if indirectKey { - t = d.defptrto(keytype) - } - d.newrefattr(dwhk, dwarf.DW_AT_type, t) - fld := d.newdie(dwhk, dwarf.DW_ABRV_ARRAYRANGE, "size") - newattr(fld, dwarf.DW_AT_count, dwarf.DW_CLS_CONSTANT, abi.OldMapBucketCount, 0) - d.newrefattr(fld, dwarf.DW_AT_type, d.uintptrInfoSym) - }) - - // Construct type to represent an array of BucketSize values - valname := d.nameFromDIESym(valtype) - dwhvs := d.mkinternaltype(ctxt, dwarf.DW_ABRV_ARRAYTYPE, "[]val", valname, "", func(dwhv *dwarf.DWDie) { - newattr(dwhv, dwarf.DW_AT_byte_size, dwarf.DW_CLS_CONSTANT, abi.OldMapBucketCount*valsize, 0) - t := valtype - if indirectVal { - t = d.defptrto(valtype) - } - d.newrefattr(dwhv, dwarf.DW_AT_type, t) - fld := d.newdie(dwhv, dwarf.DW_ABRV_ARRAYRANGE, "size") - newattr(fld, dwarf.DW_AT_count, dwarf.DW_CLS_CONSTANT, abi.OldMapBucketCount, 0) - d.newrefattr(fld, dwarf.DW_AT_type, d.uintptrInfoSym) - }) - - // Construct bucket<K,V> - dwhbs := d.mkinternaltype(ctxt, dwarf.DW_ABRV_STRUCTTYPE, "bucket", keyname, valname, func(dwhb *dwarf.DWDie) { - // Copy over all fields except the field "data" from the generic - // bucket. "data" will be replaced with keys/values below. - d.copychildrenexcept(ctxt, dwhb, bucket, findchild(bucket, "data")) - - fld := d.newdie(dwhb, dwarf.DW_ABRV_STRUCTFIELD, "keys") - d.newrefattr(fld, dwarf.DW_AT_type, dwhks) - newmemberoffsetattr(fld, abi.OldMapBucketCount) - fld = d.newdie(dwhb, dwarf.DW_ABRV_STRUCTFIELD, "values") - d.newrefattr(fld, dwarf.DW_AT_type, dwhvs) - newmemberoffsetattr(fld, abi.OldMapBucketCount+abi.OldMapBucketCount*int32(keysize)) - fld = d.newdie(dwhb, dwarf.DW_ABRV_STRUCTFIELD, "overflow") - d.newrefattr(fld, dwarf.DW_AT_type, d.defptrto(d.dtolsym(dwhb.Sym))) - newmemberoffsetattr(fld, abi.OldMapBucketCount+abi.OldMapBucketCount*(int32(keysize)+int32(valsize))) - if d.arch.RegSize > d.arch.PtrSize { - fld = d.newdie(dwhb, dwarf.DW_ABRV_STRUCTFIELD, "pad") - d.newrefattr(fld, dwarf.DW_AT_type, d.uintptrInfoSym) - newmemberoffsetattr(fld, abi.OldMapBucketCount+abi.OldMapBucketCount*(int32(keysize)+int32(valsize))+int32(d.arch.PtrSize)) - } - - newattr(dwhb, dwarf.DW_AT_byte_size, dwarf.DW_CLS_CONSTANT, abi.OldMapBucketCount+abi.OldMapBucketCount*keysize+abi.OldMapBucketCount*valsize+int64(d.arch.RegSize), 0) - }) - - // Construct hash<K,V> - dwhs := d.mkinternaltype(ctxt, dwarf.DW_ABRV_STRUCTTYPE, "hash", keyname, valname, func(dwh *dwarf.DWDie) { - d.copychildren(ctxt, dwh, hash) - d.substitutetype(dwh, "buckets", d.defptrto(dwhbs)) - d.substitutetype(dwh, "oldbuckets", d.defptrto(dwhbs)) - newattr(dwh, dwarf.DW_AT_byte_size, dwarf.DW_CLS_CONSTANT, getattr(hash, dwarf.DW_AT_byte_size).Value, nil) - }) - - // make map type a pointer to hash<K,V> - d.newrefattr(die, dwarf.DW_AT_type, d.defptrto(dwhs)) - } -} - func (d *dwctxt) synthesizechantypes(ctxt *Link, die *dwarf.DWDie) { sudog := walktypedef(d.findprotodie(ctxt, "type:runtime.sudog")) waitq := walktypedef(d.findprotodie(ctxt, "type:runtime.waitq")) @@ -2010,19 +1906,14 @@ func dwarfGenerateDebugInfo(ctxt *Link) { // Prototypes needed for type synthesis. prototypedies = map[string]*dwarf.DWDie{ - "type:runtime.stringStructDWARF": nil, - "type:runtime.slice": nil, - "type:runtime.sudog": nil, - "type:runtime.waitq": nil, - "type:runtime.hchan": nil, - } - if buildcfg.Experiment.SwissMap { - prototypedies["type:internal/runtime/maps.Map"] = nil - prototypedies["type:internal/runtime/maps.table"] = nil - prototypedies["type:internal/runtime/maps.groupsReference"] = nil - } else { - prototypedies["type:runtime.hmap"] = nil - prototypedies["type:runtime.bmap"] = nil + "type:runtime.stringStructDWARF": nil, + "type:runtime.slice": nil, + "type:runtime.sudog": nil, + "type:runtime.waitq": nil, + "type:runtime.hchan": nil, + "type:internal/runtime/maps.Map": nil, + "type:internal/runtime/maps.table": nil, + "type:internal/runtime/maps.groupsReference": nil, } // Needed by the prettyprinter code for interface inspection. @@ -2031,6 +1922,7 @@ func dwarfGenerateDebugInfo(ctxt *Link) { "type:internal/abi.ArrayType", "type:internal/abi.ChanType", "type:internal/abi.FuncType", + "type:internal/abi.MapType", "type:internal/abi.PtrType", "type:internal/abi.SliceType", "type:internal/abi.StructType", @@ -2039,11 +1931,6 @@ func dwarfGenerateDebugInfo(ctxt *Link) { "type:internal/abi.Imethod"} { d.defgotype(d.lookupOrDiag(typ)) } - if buildcfg.Experiment.SwissMap { - d.defgotype(d.lookupOrDiag("type:internal/abi.SwissMapType")) - } else { - d.defgotype(d.lookupOrDiag("type:internal/abi.OldMapType")) - } // fake root DIE for compile unit DIEs var dwroot dwarf.DWDie diff --git a/src/cmd/link/internal/ld/dwarf_test.go b/src/cmd/link/internal/ld/dwarf_test.go index ab086c57f4..cc493f2c69 100644 --- a/src/cmd/link/internal/ld/dwarf_test.go +++ b/src/cmd/link/internal/ld/dwarf_test.go @@ -60,6 +60,7 @@ func TestRuntimeTypesPresent(t *testing.T) { "internal/abi.ArrayType": true, "internal/abi.ChanType": true, "internal/abi.FuncType": true, + "internal/abi.MapType": true, "internal/abi.PtrType": true, "internal/abi.SliceType": true, "internal/abi.StructType": true, @@ -71,16 +72,6 @@ func TestRuntimeTypesPresent(t *testing.T) { if len(found) != len(want) { t.Errorf("found %v, want %v", found, want) } - - // Must have one of OldMapType or SwissMapType. - want = map[string]bool{ - "internal/abi.OldMapType": true, - "internal/abi.SwissMapType": true, - } - found = findTypes(t, dwarf, want) - if len(found) != 1 { - t.Errorf("map type want one of %v found %v", want, found) - } } func findTypes(t *testing.T, dw *dwarf.Data, want map[string]bool) (found map[string]bool) { diff --git a/src/cmd/link/internal/ld/pcln.go b/src/cmd/link/internal/ld/pcln.go index a09d3acd5e..9532b33a9b 100644 --- a/src/cmd/link/internal/ld/pcln.go +++ b/src/cmd/link/internal/ld/pcln.go @@ -614,16 +614,36 @@ func (state pclntab) calculateFunctabSize(ctxt *Link, funcs []loader.Sym) (int64 return size, startLocations } +// textOff computes the offset of a text symbol, relative to textStart, +// similar to an R_ADDROFF relocation, for various runtime metadata and +// tables (see runtime/symtab.go:(*moduledata).textAddr). +func textOff(ctxt *Link, s loader.Sym, textStart int64) uint32 { + ldr := ctxt.loader + off := ldr.SymValue(s) - textStart + if off < 0 { + panic(fmt.Sprintf("expected func %s(%x) to be placed at or after textStart (%x)", ldr.SymName(s), ldr.SymValue(s), textStart)) + } + if ctxt.IsWasm() { + // On Wasm, the function table contains just the function index, whereas + // the "PC" (s's Value) is function index << 16 + block index (see + // ../wasm/asm.go:assignAddress). + if off&(1<<16-1) != 0 { + ctxt.Errorf(s, "nonzero PC_B at function entry: %#x", off) + } + off >>= 16 + } + if int64(uint32(off)) != off { + ctxt.Errorf(s, "textOff overflow: %#x", off) + } + return uint32(off) +} + // writePCToFunc writes the PC->func lookup table. func writePCToFunc(ctxt *Link, sb *loader.SymbolBuilder, funcs []loader.Sym, startLocations []uint32) { ldr := ctxt.loader textStart := ldr.SymValue(ldr.Lookup("runtime.text", 0)) pcOff := func(s loader.Sym) uint32 { - off := ldr.SymValue(s) - textStart - if off < 0 { - panic(fmt.Sprintf("expected func %s(%x) to be placed at or after textStart (%x)", ldr.SymName(s), ldr.SymValue(s), textStart)) - } - return uint32(off) + return textOff(ctxt, s, textStart) } for i, s := range funcs { sb.SetUint32(ctxt.Arch, int64(i*2*4), pcOff(s)) @@ -632,7 +652,11 @@ func writePCToFunc(ctxt *Link, sb *loader.SymbolBuilder, funcs []loader.Sym, sta // Final entry of table is just end pc offset. lastFunc := funcs[len(funcs)-1] - sb.SetUint32(ctxt.Arch, int64(len(funcs))*2*4, pcOff(lastFunc)+uint32(ldr.SymSize(lastFunc))) + lastPC := pcOff(lastFunc) + uint32(ldr.SymSize(lastFunc)) + if ctxt.IsWasm() { + lastPC = pcOff(lastFunc) + 1 // On Wasm it is function index (see above) + } + sb.SetUint32(ctxt.Arch, int64(len(funcs))*2*4, lastPC) } // writeFuncs writes the func structures and pcdata to runtime.functab. @@ -646,7 +670,7 @@ func writeFuncs(ctxt *Link, sb *loader.SymbolBuilder, funcs []loader.Sym, inlSym var pcsp, pcfile, pcline, pcinline loader.Sym var pcdata []loader.Sym - // Write the individual func objects. + // Write the individual func objects (runtime._func struct). for i, s := range funcs { startLine := int32(0) fi := ldr.FuncInfo(s) @@ -658,10 +682,7 @@ func writeFuncs(ctxt *Link, sb *loader.SymbolBuilder, funcs []loader.Sym, inlSym off := int64(startLocations[i]) // entryOff uint32 (offset of func entry PC from textStart) - entryOff := ldr.SymValue(s) - textStart - if entryOff < 0 { - panic(fmt.Sprintf("expected func %s(%x) to be placed before or at textStart (%x)", ldr.SymName(s), ldr.SymValue(s), textStart)) - } + entryOff := textOff(ctxt, s, textStart) off = sb.SetUint32(ctxt.Arch, off, uint32(entryOff)) // nameOff int32 diff --git a/src/cmd/link/testdata/dwarf/issue65405/main.go b/src/cmd/link/testdata/dwarf/issue65405/main.go new file mode 100644 index 0000000000..f76e464b23 --- /dev/null +++ b/src/cmd/link/testdata/dwarf/issue65405/main.go @@ -0,0 +1,8 @@ +package main + +import "net/http" + +func main() { + http.Handle("/", http.StripPrefix("/static/", http.FileServer(http.Dir("./output")))) + http.ListenAndServe(":8000", nil) +} diff --git a/src/crypto/elliptic/params.go b/src/crypto/elliptic/params.go index 0507d22b27..8cf9a6dc40 100644 --- a/src/crypto/elliptic/params.go +++ b/src/crypto/elliptic/params.go @@ -295,13 +295,13 @@ func (curve *CurveParams) ScalarMult(Bx, By *big.Int, k []byte) (*big.Int, *big. Bz := new(big.Int).SetInt64(1) x, y, z := new(big.Int), new(big.Int), new(big.Int) - for _, byte := range k { - for bitNum := 0; bitNum < 8; bitNum++ { + for _, b := range k { + for range 8 { x, y, z = curve.doubleJacobian(x, y, z) - if byte&0x80 == 0x80 { + if b&0x80 == 0x80 { x, y, z = curve.addJacobian(Bx, By, Bz, x, y, z) } - byte <<= 1 + b <<= 1 } } diff --git a/src/crypto/rsa/rsa.go b/src/crypto/rsa/rsa.go index 95bb4becd2..c557c3710a 100644 --- a/src/crypto/rsa/rsa.go +++ b/src/crypto/rsa/rsa.go @@ -30,14 +30,15 @@ // with a key smaller than 1024 bits. Such keys are insecure and should not be // used. // -// The `rsa1024min=0` GODEBUG setting suppresses this error, but we recommend -// doing so only in tests, if necessary. Tests can use [testing.T.Setenv] or -// include `//go:debug rsa1024min=0` in a `_test.go` source file to set it. +// The rsa1024min=0 GODEBUG setting suppresses this error, but we recommend +// doing so only in tests, if necessary. Tests can set this option using +// [testing.T.Setenv] or by including "//go:debug rsa1024min=0" in a *_test.go +// source file. // // Alternatively, see the [GenerateKey (TestKey)] example for a pregenerated // test-only 2048-bit key. // -// [GenerateKey (TestKey)]: #example-GenerateKey-TestKey +// [GenerateKey (TestKey)]: https://pkg.go.dev/crypto/rsa#example-GenerateKey-TestKey package rsa import ( @@ -62,9 +63,8 @@ var bigOne = big.NewInt(1) // A PublicKey represents the public part of an RSA key. // -// The value of the modulus N is considered secret by this library and protected -// from leaking through timing side-channels. However, neither the value of the -// exponent E nor the precise bit size of N are similarly protected. +// The values of N and E are not considered confidential, and may leak through +// side channels, or could be mathematically derived from other public values. type PublicKey struct { N *big.Int // modulus E int // public exponent @@ -226,7 +226,7 @@ type CRTValue struct { // Validate performs basic sanity checks on the key. // It returns nil if the key is valid, or else an error describing a problem. // -// It runs faster on valid keys if run after [Precompute]. +// It runs faster on valid keys if run after [PrivateKey.Precompute]. func (priv *PrivateKey) Validate() error { // We can operate on keys based on d alone, but it isn't possible to encode // with [crypto/x509.MarshalPKCS1PrivateKey], which unfortunately doesn't @@ -274,7 +274,7 @@ func checkPublicKeySize(k *PublicKey) error { // returned key does not depend deterministically on the bytes read from rand, // and may change between calls and/or between versions. // -// [Minimum key size]: #hdr-Minimum_key_size +// [Minimum key size]: https://pkg.go.dev/crypto/rsa#hdr-Minimum_key_size func GenerateKey(random io.Reader, bits int) (*PrivateKey, error) { if err := checkKeySize(bits); err != nil { return nil, err diff --git a/src/crypto/tls/cipher_suites.go b/src/crypto/tls/cipher_suites.go index 2a96fa6903..6ed63ccc2d 100644 --- a/src/crypto/tls/cipher_suites.go +++ b/src/crypto/tls/cipher_suites.go @@ -149,8 +149,8 @@ type cipherSuite struct { } var cipherSuites = []*cipherSuite{ // TODO: replace with a map, since the order doesn't matter. - {TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, 32, 0, 12, ecdheRSAKA, suiteECDHE | suiteTLS12, nil, nil, aeadChaCha20Poly1305}, - {TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305, 32, 0, 12, ecdheECDSAKA, suiteECDHE | suiteECSign | suiteTLS12, nil, nil, aeadChaCha20Poly1305}, + {TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, 32, 0, 12, ecdheRSAKA, suiteECDHE | suiteTLS12, nil, nil, aeadChaCha20Poly1305}, + {TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256, 32, 0, 12, ecdheECDSAKA, suiteECDHE | suiteECSign | suiteTLS12, nil, nil, aeadChaCha20Poly1305}, {TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, 16, 0, 4, ecdheRSAKA, suiteECDHE | suiteTLS12, nil, nil, aeadAESGCM}, {TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256, 16, 0, 4, ecdheECDSAKA, suiteECDHE | suiteECSign | suiteTLS12, nil, nil, aeadAESGCM}, {TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384, 32, 0, 4, ecdheRSAKA, suiteECDHE | suiteTLS12 | suiteSHA384, nil, nil, aeadAESGCM}, @@ -284,7 +284,7 @@ var cipherSuitesPreferenceOrder = []uint16{ // AEADs w/ ECDHE TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256, TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384, TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384, - TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305, TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256, TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, // CBC w/ ECDHE TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA, TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA, @@ -313,7 +313,7 @@ var cipherSuitesPreferenceOrder = []uint16{ var cipherSuitesPreferenceOrderNoAES = []uint16{ // ChaCha20Poly1305 - TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305, TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256, TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, // AES-GCM w/ ECDHE TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256, TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, diff --git a/src/crypto/tls/handshake_client_test.go b/src/crypto/tls/handshake_client_test.go index 6118711a0e..9c94016f13 100644 --- a/src/crypto/tls/handshake_client_test.go +++ b/src/crypto/tls/handshake_client_test.go @@ -638,7 +638,7 @@ func TestHandshakeClientHelloRetryRequest(t *testing.T) { func TestHandshakeClientECDHERSAChaCha20(t *testing.T) { config := testConfig.Clone() - config.CipherSuites = []uint16{TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305} + config.CipherSuites = []uint16{TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256} test := &clientTest{ name: "ECDHE-RSA-CHACHA20-POLY1305", @@ -651,7 +651,7 @@ func TestHandshakeClientECDHERSAChaCha20(t *testing.T) { func TestHandshakeClientECDHEECDSAChaCha20(t *testing.T) { config := testConfig.Clone() - config.CipherSuites = []uint16{TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305} + config.CipherSuites = []uint16{TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256} test := &clientTest{ name: "ECDHE-ECDSA-CHACHA20-POLY1305", diff --git a/src/crypto/tls/handshake_server_test.go b/src/crypto/tls/handshake_server_test.go index a6d64a506a..4df3f5a737 100644 --- a/src/crypto/tls/handshake_server_test.go +++ b/src/crypto/tls/handshake_server_test.go @@ -1379,31 +1379,31 @@ func BenchmarkHandshakeServer(b *testing.B) { }) b.Run("ECDHE-P256-RSA", func(b *testing.B) { b.Run("TLSv13", func(b *testing.B) { - benchmarkHandshakeServer(b, VersionTLS13, TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + benchmarkHandshakeServer(b, VersionTLS13, TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, CurveP256, testRSACertificate, testRSAPrivateKey) }) b.Run("TLSv12", func(b *testing.B) { - benchmarkHandshakeServer(b, VersionTLS12, TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + benchmarkHandshakeServer(b, VersionTLS12, TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, CurveP256, testRSACertificate, testRSAPrivateKey) }) }) b.Run("ECDHE-P256-ECDSA-P256", func(b *testing.B) { b.Run("TLSv13", func(b *testing.B) { - benchmarkHandshakeServer(b, VersionTLS13, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305, + benchmarkHandshakeServer(b, VersionTLS13, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256, CurveP256, testP256Certificate, testP256PrivateKey) }) b.Run("TLSv12", func(b *testing.B) { - benchmarkHandshakeServer(b, VersionTLS12, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305, + benchmarkHandshakeServer(b, VersionTLS12, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256, CurveP256, testP256Certificate, testP256PrivateKey) }) }) b.Run("ECDHE-X25519-ECDSA-P256", func(b *testing.B) { b.Run("TLSv13", func(b *testing.B) { - benchmarkHandshakeServer(b, VersionTLS13, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305, + benchmarkHandshakeServer(b, VersionTLS13, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256, X25519, testP256Certificate, testP256PrivateKey) }) b.Run("TLSv12", func(b *testing.B) { - benchmarkHandshakeServer(b, VersionTLS12, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305, + benchmarkHandshakeServer(b, VersionTLS12, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256, X25519, testP256Certificate, testP256PrivateKey) }) }) @@ -1412,11 +1412,11 @@ func BenchmarkHandshakeServer(b *testing.B) { b.Fatal("test ECDSA key doesn't use curve P-521") } b.Run("TLSv13", func(b *testing.B) { - benchmarkHandshakeServer(b, VersionTLS13, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305, + benchmarkHandshakeServer(b, VersionTLS13, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256, CurveP521, testECDSACertificate, testECDSAPrivateKey) }) b.Run("TLSv12", func(b *testing.B) { - benchmarkHandshakeServer(b, VersionTLS12, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305, + benchmarkHandshakeServer(b, VersionTLS12, TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256, CurveP521, testECDSACertificate, testECDSAPrivateKey) }) }) @@ -1792,28 +1792,28 @@ func TestAESCipherReordering(t *testing.T) { { name: "server has hardware AES, client doesn't (pick ChaCha)", clientCiphers: []uint16{ - TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, TLS_RSA_WITH_AES_128_CBC_SHA, }, serverHasAESGCM: true, - expectedCipher: TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + expectedCipher: TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, }, { name: "client prefers AES-GCM, server doesn't have hardware AES (pick ChaCha)", clientCiphers: []uint16{ TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, - TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, TLS_RSA_WITH_AES_128_CBC_SHA, }, serverHasAESGCM: false, - expectedCipher: TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + expectedCipher: TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, }, { name: "client prefers AES-GCM, server has hardware AES (pick AES-GCM)", clientCiphers: []uint16{ TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, - TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, TLS_RSA_WITH_AES_128_CBC_SHA, }, serverHasAESGCM: true, @@ -1824,7 +1824,7 @@ func TestAESCipherReordering(t *testing.T) { clientCiphers: []uint16{ 0x0A0A, // GREASE value TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, - TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, TLS_RSA_WITH_AES_128_CBC_SHA, }, serverHasAESGCM: true, @@ -1845,27 +1845,27 @@ func TestAESCipherReordering(t *testing.T) { clientCiphers: []uint16{ TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, TLS_RSA_WITH_AES_128_CBC_SHA, - TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, }, serverHasAESGCM: false, - expectedCipher: TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + expectedCipher: TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, }, { name: "client prefers AES-GCM over ChaCha and sends GREASE, server doesn't have hardware AES (pick ChaCha)", clientCiphers: []uint16{ 0x0A0A, // GREASE value TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, - TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, TLS_RSA_WITH_AES_128_CBC_SHA, }, serverHasAESGCM: false, - expectedCipher: TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + expectedCipher: TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, }, { name: "client supports multiple AES-GCM, server doesn't have hardware AES and doesn't support ChaCha (AES-GCM)", clientCiphers: []uint16{ TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384, - TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, }, serverHasAESGCM: false, @@ -1879,14 +1879,14 @@ func TestAESCipherReordering(t *testing.T) { name: "client prefers AES-GCM, server has hardware but doesn't support AES (pick ChaCha)", clientCiphers: []uint16{ TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256, - TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, TLS_RSA_WITH_AES_128_CBC_SHA, }, serverHasAESGCM: true, serverCiphers: []uint16{ - TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, }, - expectedCipher: TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305, + expectedCipher: TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256, }, } diff --git a/src/debug/dwarf/entry.go b/src/debug/dwarf/entry.go index 07b9259be5..8741479483 100644 --- a/src/debug/dwarf/entry.go +++ b/src/debug/dwarf/entry.go @@ -554,7 +554,7 @@ func (b *buf) entry(cu *Entry, u *unit) *Entry { case formData16: val = b.bytes(16) case formSdata: - val = int64(b.int()) + val = b.int() case formUdata: val = int64(b.uint()) case formImplicitConst: diff --git a/src/encoding/json/decode_test.go b/src/encoding/json/decode_test.go index 473fd02833..d12495f90b 100644 --- a/src/encoding/json/decode_test.go +++ b/src/encoding/json/decode_test.go @@ -12,6 +12,7 @@ import ( "errors" "fmt" "image" + "io" "maps" "math" "math/big" @@ -415,6 +416,8 @@ type DoublePtr struct { J **int } +type NestedUnamed struct{ F struct{ V int } } + var unmarshalTests = []struct { CaseName in string @@ -469,11 +472,13 @@ var unmarshalTests = []struct { {CaseName: Name(""), in: `{"alphabet": "xyz"}`, ptr: new(U), err: fmt.Errorf("json: unknown field \"alphabet\""), disallowUnknownFields: true}, // syntax errors + {CaseName: Name(""), in: ``, ptr: new(any), err: &SyntaxError{"unexpected end of JSON input", 0}}, + {CaseName: Name(""), in: " \n\r\t", ptr: new(any), err: &SyntaxError{"unexpected end of JSON input", 4}}, + {CaseName: Name(""), in: `[2, 3`, ptr: new(any), err: &SyntaxError{"unexpected end of JSON input", 5}}, {CaseName: Name(""), in: `{"X": "foo", "Y"}`, err: &SyntaxError{"invalid character '}' after object key", 17}}, {CaseName: Name(""), in: `[1, 2, 3+]`, err: &SyntaxError{"invalid character '+' after array element", 9}}, {CaseName: Name(""), in: `{"X":12x}`, err: &SyntaxError{"invalid character 'x' after object key:value pair", 8}, useNumber: true}, - {CaseName: Name(""), in: `[2, 3`, err: &SyntaxError{msg: "unexpected end of JSON input", Offset: 5}}, - {CaseName: Name(""), in: `{"F3": -}`, ptr: new(V), err: &SyntaxError{msg: "invalid character '}' in numeric literal", Offset: 9}}, + {CaseName: Name(""), in: `{"F3": -}`, ptr: new(V), err: &SyntaxError{"invalid character '}' in numeric literal", 9}}, // raw value errors {CaseName: Name(""), in: "\x01 42", err: &SyntaxError{"invalid character '\\x01' looking for beginning of value", 1}}, @@ -1210,6 +1215,28 @@ var unmarshalTests = []struct { F string `json:"-,omitempty"` }{"hello"}, }, + + { + CaseName: Name("ErrorForNestedUnamed"), + in: `{"F":{"V":"s"}}`, + ptr: new(NestedUnamed), + out: NestedUnamed{}, + err: &UnmarshalTypeError{Value: "string", Type: reflect.TypeFor[int](), Offset: 13, Field: "F.V"}, + }, + { + CaseName: Name("ErrorInterface"), + in: `1`, + ptr: new(error), + out: error(nil), + err: &UnmarshalTypeError{Value: "number", Type: reflect.TypeFor[error](), Offset: 1}, + }, + { + CaseName: Name("ErrorChan"), + in: `1`, + ptr: new(chan int), + out: (chan int)(nil), + err: &UnmarshalTypeError{Value: "number", Type: reflect.TypeFor[chan int](), Offset: 1}, + }, } func TestMarshal(t *testing.T) { @@ -1377,6 +1404,14 @@ func TestUnmarshal(t *testing.T) { if tt.disallowUnknownFields { dec.DisallowUnknownFields() } + if tt.err != nil && strings.Contains(tt.err.Error(), "unexpected end of JSON input") { + // In streaming mode, we expect EOF or ErrUnexpectedEOF instead. + if strings.TrimSpace(tt.in) == "" { + tt.err = io.EOF + } else { + tt.err = io.ErrUnexpectedEOF + } + } if err := dec.Decode(v.Interface()); !equalError(err, tt.err) { t.Fatalf("%s: Decode error:\n\tgot: %v\n\twant: %v\n\n\tgot: %#v\n\twant: %#v", tt.Where, err, tt.err, err, tt.err) } else if err != nil && tt.out == nil { diff --git a/src/encoding/json/internal/internal.go b/src/encoding/json/internal/internal.go index f587c7b32c..c95f83fe44 100644 --- a/src/encoding/json/internal/internal.go +++ b/src/encoding/json/internal/internal.go @@ -21,6 +21,7 @@ var AllowInternalUse NotForPublicUse var ( ErrCycle = errors.New("encountered a cycle") ErrNonNilReference = errors.New("value must be passed as a non-nil pointer reference") + ErrNilInterface = errors.New("cannot derive concrete type for nil interface with finite type set") ) var ( diff --git a/src/encoding/json/internal/jsonflags/flags.go b/src/encoding/json/internal/jsonflags/flags.go index 4496359c89..da13adff4d 100644 --- a/src/encoding/json/internal/jsonflags/flags.go +++ b/src/encoding/json/internal/jsonflags/flags.go @@ -52,18 +52,20 @@ const ( AllowInvalidUTF8 | EscapeForHTML | EscapeForJS | - EscapeInvalidUTF8 | PreserveRawStrings | Deterministic | FormatNilMapAsNull | FormatNilSliceAsNull | MatchCaseInsensitiveNames | CallMethodsWithLegacySemantics | + FormatByteArrayAsArray | FormatBytesWithLegacySemantics | - FormatTimeWithLegacySemantics | + FormatDurationAsNano | MatchCaseSensitiveDelimiter | MergeWithLegacySemantics | - OmitEmptyWithLegacyDefinition | + OmitEmptyWithLegacySemantics | + ParseBytesWithLooseRFC4648 | + ParseTimeWithLooseRFC3339 | ReportErrorsWithLegacySemantics | StringifyWithLegacySemantics | UnmarshalArrayFromAnyLength @@ -77,7 +79,7 @@ const ( WhitespaceFlags = AnyWhitespace | Indent | IndentPrefix // AnyEscape is the set of flags related to escaping in a JSON string. - AnyEscape = EscapeForHTML | EscapeForJS | EscapeInvalidUTF8 + AnyEscape = EscapeForHTML | EscapeForJS // CanonicalizeNumbers is the set of flags related to raw number canonicalization. CanonicalizeNumbers = CanonicalizeRawInts | CanonicalizeRawFloats @@ -97,7 +99,6 @@ const ( ReorderRawObjects // encode only EscapeForHTML // encode only EscapeForJS // encode only - EscapeInvalidUTF8 // encode only; only exposed in v1 Multiline // encode only SpaceAfterColon // encode only SpaceAfterComma // encode only @@ -132,11 +133,14 @@ const ( _ Bools = (maxArshalV2Flag >> 1) << iota CallMethodsWithLegacySemantics // marshal or unmarshal + FormatByteArrayAsArray // marshal or unmarshal FormatBytesWithLegacySemantics // marshal or unmarshal - FormatTimeWithLegacySemantics // marshal or unmarshal + FormatDurationAsNano // marshal or unmarshal MatchCaseSensitiveDelimiter // marshal or unmarshal MergeWithLegacySemantics // unmarshal - OmitEmptyWithLegacyDefinition // marshal + OmitEmptyWithLegacySemantics // marshal + ParseBytesWithLooseRFC4648 // unmarshal + ParseTimeWithLooseRFC3339 // unmarshal ReportErrorsWithLegacySemantics // marshal or unmarshal StringifyWithLegacySemantics // marshal or unmarshal StringifyBoolsAndStrings // marshal or unmarshal; for internal use by jsonv2.makeStructArshaler @@ -146,6 +150,12 @@ const ( maxArshalV1Flag ) +// bitsUsed is the number of bits used in the 64-bit boolean flags +const bitsUsed = 42 + +// Static compile check that bitsUsed and maxArshalV1Flag are in sync. +const _ = uint64((1<<bitsUsed)-maxArshalV1Flag) + uint64(maxArshalV1Flag-(1<<bitsUsed)) + // Flags is a set of boolean flags. // If the presence bit is zero, then the value bit must also be zero. // The least-significant bit of both fields is always zero. diff --git a/src/encoding/json/internal/jsonwire/encode.go b/src/encoding/json/internal/jsonwire/encode.go index 3901ff8bed..8f9b8ab09e 100644 --- a/src/encoding/json/internal/jsonwire/encode.go +++ b/src/encoding/json/internal/jsonwire/encode.go @@ -92,11 +92,7 @@ func AppendQuote[Bytes ~[]byte | ~string](dst []byte, src Bytes, flags *jsonflag case isInvalidUTF8(r, rn): hasInvalidUTF8 = true dst = append(dst, src[i:n-rn]...) - if flags.Get(jsonflags.EscapeInvalidUTF8) { - dst = append(dst, `\ufffd`...) - } else { - dst = append(dst, "\ufffd"...) - } + dst = append(dst, "\ufffd"...) i = n case (r == '\u2028' || r == '\u2029') && flags.Get(jsonflags.EscapeForJS): dst = append(dst, src[i:n-rn]...) diff --git a/src/encoding/json/jsontext/decode.go b/src/encoding/json/jsontext/decode.go index 784ae4709a..f505de4468 100644 --- a/src/encoding/json/jsontext/decode.go +++ b/src/encoding/json/jsontext/decode.go @@ -138,7 +138,12 @@ func (d *Decoder) Reset(r io.Reader, opts ...Options) { case d.s.Flags.Get(jsonflags.WithinArshalCall): panic("jsontext: cannot reset Decoder passed to json.UnmarshalerFrom") } - d.s.reset(nil, r, opts...) + // Reuse the buffer if it does not alias a previous [bytes.Buffer]. + b := d.s.buf[:0] + if _, ok := d.s.rd.(*bytes.Buffer); ok { + b = nil + } + d.s.reset(b, r, opts...) } func (d *decoderState) reset(b []byte, r io.Reader, opts ...Options) { @@ -769,7 +774,8 @@ func (d *decoderState) ReadValue(flags *jsonwire.ValueFlags) (Value, error) { // CheckNextValue checks whether the next value is syntactically valid, // but does not advance the read offset. -func (d *decoderState) CheckNextValue() error { +// If last, it verifies that the stream cleanly terminates with [io.EOF]. +func (d *decoderState) CheckNextValue(last bool) error { d.PeekKind() // populates d.peekPos and d.peekErr pos, err := d.peekPos, d.peekErr d.peekPos, d.peekErr = 0, nil @@ -780,13 +786,18 @@ func (d *decoderState) CheckNextValue() error { var flags jsonwire.ValueFlags if pos, err := d.consumeValue(&flags, pos, d.Tokens.Depth()); err != nil { return wrapSyntacticError(d, err, pos, +1) + } else if last { + return d.checkEOF(pos) } return nil } // CheckEOF verifies that the input has no more data. func (d *decoderState) CheckEOF() error { - switch pos, err := d.consumeWhitespace(d.prevEnd); err { + return d.checkEOF(d.prevEnd) +} +func (d *decoderState) checkEOF(pos int) error { + switch pos, err := d.consumeWhitespace(pos); err { case nil: err := jsonwire.NewInvalidCharacterError(d.buf[pos:], "after top-level value") return wrapSyntacticError(d, err, pos, 0) diff --git a/src/encoding/json/jsontext/decode_test.go b/src/encoding/json/jsontext/decode_test.go index 67580e6f4f..209ff65ec8 100644 --- a/src/encoding/json/jsontext/decode_test.go +++ b/src/encoding/json/jsontext/decode_test.go @@ -1265,3 +1265,86 @@ func TestPeekableDecoder(t *testing.T) { } } } + +// TestDecoderReset tests that the decoder preserves its internal +// buffer between Reset calls to avoid frequent allocations when reusing the decoder. +// It ensures that the buffer capacity is maintained while avoiding aliasing +// issues with [bytes.Buffer]. +func TestDecoderReset(t *testing.T) { + // Create a decoder with a reasonably large JSON input to ensure buffer growth. + largeJSON := `{"key1":"value1","key2":"value2","key3":"value3","key4":"value4","key5":"value5"}` + dec := NewDecoder(strings.NewReader(largeJSON)) + + t.Run("Test capacity preservation", func(t *testing.T) { + // Read the first JSON value to grow the internal buffer. + val1, err := dec.ReadValue() + if err != nil { + t.Fatalf("first ReadValue failed: %v", err) + } + if string(val1) != largeJSON { + t.Fatalf("first ReadValue = %q, want %q", val1, largeJSON) + } + + // Get the buffer capacity after first use. + initialCapacity := cap(dec.s.buf) + if initialCapacity == 0 { + t.Fatalf("expected non-zero buffer capacity after first use") + } + + // Reset with a new reader - this should preserve the buffer capacity. + dec.Reset(strings.NewReader(largeJSON)) + + // Verify the buffer capacity is preserved (or at least not smaller). + preservedCapacity := cap(dec.s.buf) + if preservedCapacity < initialCapacity { + t.Fatalf("buffer capacity reduced after Reset: got %d, want at least %d", preservedCapacity, initialCapacity) + } + + // Read the second JSON value to ensure the decoder still works correctly. + val2, err := dec.ReadValue() + if err != nil { + t.Fatalf("second ReadValue failed: %v", err) + } + if string(val2) != largeJSON { + t.Fatalf("second ReadValue = %q, want %q", val2, largeJSON) + } + }) + + var bbBuf []byte + t.Run("Test aliasing with bytes.Buffer", func(t *testing.T) { + // Test with bytes.Buffer to verify proper aliasing behavior. + bb := bytes.NewBufferString(largeJSON) + dec.Reset(bb) + bbBuf = bb.Bytes() + + // Read the third JSON value to ensure functionality with bytes.Buffer. + val3, err := dec.ReadValue() + if err != nil { + t.Fatalf("fourth ReadValue failed: %v", err) + } + if string(val3) != largeJSON { + t.Fatalf("fourth ReadValue = %q, want %q", val3, largeJSON) + } + // The decoder buffer should alias bytes.Buffer's internal buffer. + if len(dec.s.buf) == 0 || len(bbBuf) == 0 || &dec.s.buf[0] != &bbBuf[0] { + t.Fatalf("decoder buffer does not alias bytes.Buffer") + } + }) + + t.Run("Test aliasing removed after Reset", func(t *testing.T) { + // Reset with a new reader and verify the buffer is not aliased. + dec.Reset(strings.NewReader(largeJSON)) + val4, err := dec.ReadValue() + if err != nil { + t.Fatalf("fifth ReadValue failed: %v", err) + } + if string(val4) != largeJSON { + t.Fatalf("fourth ReadValue = %q, want %q", val4, largeJSON) + } + + // The decoder buffer should not alias the bytes.Buffer's internal buffer. + if len(dec.s.buf) == 0 || len(bbBuf) == 0 || &dec.s.buf[0] == &bbBuf[0] { + t.Fatalf("decoder buffer aliases bytes.Buffer") + } + }) +} diff --git a/src/encoding/json/jsontext/doc.go b/src/encoding/json/jsontext/doc.go index 8e4bced015..d890692686 100644 --- a/src/encoding/json/jsontext/doc.go +++ b/src/encoding/json/jsontext/doc.go @@ -103,6 +103,10 @@ // RFC 7493 is a stricter subset of RFC 8259 and fully compliant with it. // In particular, it makes specific choices about behavior that RFC 8259 // leaves as undefined in order to ensure greater interoperability. +// +// # Security Considerations +// +// See the "Security Considerations" section in [encoding/json/v2]. package jsontext // requireKeyedLiterals can be embedded in a struct to require keyed literals. diff --git a/src/encoding/json/jsontext/encode.go b/src/encoding/json/jsontext/encode.go index 562d217fef..e3b9c04ca6 100644 --- a/src/encoding/json/jsontext/encode.go +++ b/src/encoding/json/jsontext/encode.go @@ -107,12 +107,17 @@ func (e *Encoder) Reset(w io.Writer, opts ...Options) { case e.s.Flags.Get(jsonflags.WithinArshalCall): panic("jsontext: cannot reset Encoder passed to json.MarshalerTo") } - e.s.reset(nil, w, opts...) + // Reuse the buffer if it does not alias a previous [bytes.Buffer]. + b := e.s.Buf[:0] + if _, ok := e.s.wr.(*bytes.Buffer); ok { + b = nil + } + e.s.reset(b, w, opts...) } func (e *encoderState) reset(b []byte, w io.Writer, opts ...Options) { e.state.reset() - e.encodeBuffer = encodeBuffer{Buf: b, wr: w, bufStats: e.bufStats} + e.encodeBuffer = encodeBuffer{Buf: b, wr: w, availBuffer: e.availBuffer, bufStats: e.bufStats} if bb, ok := w.(*bytes.Buffer); ok && bb != nil { e.Buf = bb.AvailableBuffer() // alias the unused buffer of bb } diff --git a/src/encoding/json/jsontext/encode_test.go b/src/encoding/json/jsontext/encode_test.go index 206482263f..a9505f5258 100644 --- a/src/encoding/json/jsontext/encode_test.go +++ b/src/encoding/json/jsontext/encode_test.go @@ -735,3 +735,95 @@ func testEncoderErrors(t *testing.T, where jsontest.CasePos, opts []Options, cal t.Fatalf("%s: Encoder.OutputOffset = %v, want %v", where, gotOffset, wantOffset) } } + +// TestEncoderReset tests that the encoder preserves its internal +// buffer between Reset calls to avoid frequent allocations when reusing the encoder. +// It ensures that the buffer capacity is maintained while avoiding aliasing +// issues with [bytes.Buffer]. +func TestEncoderReset(t *testing.T) { + // Create an encoder with a reasonably large JSON input to ensure buffer growth. + largeJSON := `{"key1":"value1","key2":"value2","key3":"value3","key4":"value4","key5":"value5"}` + "\n" + bb := new(bytes.Buffer) + enc := NewEncoder(struct{ io.Writer }{bb}) // mask out underlying [bytes.Buffer] + + t.Run("Test capacity preservation", func(t *testing.T) { + // Write the first JSON value to grow the internal buffer. + err := enc.WriteValue(append(enc.AvailableBuffer(), largeJSON...)) + if err != nil { + t.Fatalf("first WriteValue failed: %v", err) + } + if bb.String() != largeJSON { + t.Fatalf("first WriteValue = %q, want %q", bb.String(), largeJSON) + } + + // Get the buffer capacity after first use. + initialCapacity := cap(enc.s.Buf) + initialCacheCapacity := cap(enc.s.availBuffer) + if initialCapacity == 0 { + t.Fatalf("expected non-zero buffer capacity after first use") + } + if initialCacheCapacity == 0 { + t.Fatalf("expected non-zero cache capacity after first use") + } + + // Reset with a new writer - this should preserve the buffer capacity. + bb.Reset() + enc.Reset(struct{ io.Writer }{bb}) + + // Verify the buffer capacity is preserved (or at least not smaller). + preservedCapacity := cap(enc.s.Buf) + if preservedCapacity < initialCapacity { + t.Fatalf("buffer capacity reduced after Reset: got %d, want at least %d", preservedCapacity, initialCapacity) + } + preservedCacheCapacity := cap(enc.s.availBuffer) + if preservedCacheCapacity < initialCacheCapacity { + t.Fatalf("cache capacity reduced after Reset: got %d, want at least %d", preservedCapacity, initialCapacity) + } + + // Write the second JSON value to ensure the encoder still works correctly. + err = enc.WriteValue(append(enc.AvailableBuffer(), largeJSON...)) + if err != nil { + t.Fatalf("second WriteValue failed: %v", err) + } + if bb.String() != largeJSON { + t.Fatalf("second WriteValue = %q, want %q", bb.String(), largeJSON) + } + }) + + t.Run("Test aliasing with bytes.Buffer", func(t *testing.T) { + // Test with bytes.Buffer to verify proper aliasing behavior. + bb.Reset() + enc.Reset(bb) + + // Write the third JSON value to ensure functionality with bytes.Buffer. + err := enc.WriteValue([]byte(largeJSON)) + if err != nil { + t.Fatalf("fourth WriteValue failed: %v", err) + } + if bb.String() != largeJSON { + t.Fatalf("fourth WriteValue = %q, want %q", bb.String(), largeJSON) + } + // The encoder buffer should alias bytes.Buffer's internal buffer. + if cap(enc.s.Buf) == 0 || cap(bb.AvailableBuffer()) == 0 || &enc.s.Buf[:1][0] != &bb.AvailableBuffer()[:1][0] { + t.Fatalf("encoder buffer does not alias bytes.Buffer") + } + }) + + t.Run("Test aliasing removed after Reset", func(t *testing.T) { + // Reset with a new reader and verify the buffer is not aliased. + bb.Reset() + enc.Reset(struct{ io.Writer }{bb}) + err := enc.WriteValue([]byte(largeJSON)) + if err != nil { + t.Fatalf("fifth WriteValue failed: %v", err) + } + if bb.String() != largeJSON { + t.Fatalf("fourth WriteValue = %q, want %q", bb.String(), largeJSON) + } + + // The encoder buffer should not alias the bytes.Buffer's internal buffer. + if cap(enc.s.Buf) == 0 || cap(bb.AvailableBuffer()) == 0 || &enc.s.Buf[:1][0] == &bb.AvailableBuffer()[:1][0] { + t.Fatalf("encoder buffer aliases bytes.Buffer") + } + }) +} diff --git a/src/encoding/json/jsontext/options.go b/src/encoding/json/jsontext/options.go index e07de21fcf..7eb4f9b9e0 100644 --- a/src/encoding/json/jsontext/options.go +++ b/src/encoding/json/jsontext/options.go @@ -271,6 +271,7 @@ func WithIndentPrefix(prefix string) Options { /* // TODO(https://go.dev/issue/56733): Implement WithByteLimit and WithDepthLimit. +// Remember to also update the "Security Considerations" section. // WithByteLimit sets a limit on the number of bytes of input or output bytes // that may be consumed or produced for each top-level JSON value. diff --git a/src/encoding/json/stream_test.go b/src/encoding/json/stream_test.go index 478ee18291..9e5d48d39d 100644 --- a/src/encoding/json/stream_test.go +++ b/src/encoding/json/stream_test.go @@ -522,3 +522,38 @@ func TestHTTPDecoding(t *testing.T) { t.Errorf("Decode error:\n\tgot: %v\n\twant: io.EOF", err) } } + +func TestTokenTruncation(t *testing.T) { + tests := []struct { + in string + err error + }{ + {in: ``, err: io.EOF}, + {in: `{`, err: io.EOF}, + {in: `{"`, err: io.ErrUnexpectedEOF}, + {in: `{"k"`, err: io.EOF}, + {in: `{"k":`, err: io.EOF}, + {in: `{"k",`, err: &SyntaxError{"invalid character ',' after object key", int64(len(`{"k"`))}}, + {in: `{"k"}`, err: &SyntaxError{"invalid character '}' after object key", int64(len(`{"k"`))}}, + {in: ` [0`, err: io.EOF}, + {in: `[0.`, err: io.ErrUnexpectedEOF}, + {in: `[0. `, err: &SyntaxError{"invalid character ' ' after decimal point in numeric literal", int64(len(`[0.`))}}, + {in: `[0,`, err: io.EOF}, + {in: `[0:`, err: &SyntaxError{"invalid character ':' after array element", int64(len(`[0`))}}, + {in: `n`, err: io.ErrUnexpectedEOF}, + {in: `nul`, err: io.ErrUnexpectedEOF}, + {in: `fal `, err: &SyntaxError{"invalid character ' ' in literal false (expecting 's')", int64(len(`fal `))}}, + {in: `false`, err: io.EOF}, + } + for _, tt := range tests { + d := NewDecoder(strings.NewReader(tt.in)) + for i := 0; true; i++ { + if _, err := d.Token(); err != nil { + if !reflect.DeepEqual(err, tt.err) { + t.Errorf("`%s`: %d.Token error = %#v, want %v", tt.in, i, err, tt.err) + } + break + } + } + } +} diff --git a/src/encoding/json/v2/arshal.go b/src/encoding/json/v2/arshal.go index 10b16efe4a..e2ce778d5a 100644 --- a/src/encoding/json/v2/arshal.go +++ b/src/encoding/json/v2/arshal.go @@ -409,7 +409,7 @@ func Unmarshal(in []byte, out any, opts ...Options) (err error) { dec := export.GetBufferedDecoder(in, opts...) defer export.PutBufferedDecoder(dec) xd := export.Decoder(dec) - err = unmarshalFull(dec, out, &xd.Struct) + err = unmarshalDecode(dec, out, &xd.Struct, true) if err != nil && xd.Flags.Get(jsonflags.ReportErrorsWithLegacySemantics) { return internal.TransformUnmarshalError(out, err) } @@ -426,24 +426,13 @@ func UnmarshalRead(in io.Reader, out any, opts ...Options) (err error) { dec := export.GetStreamingDecoder(in, opts...) defer export.PutStreamingDecoder(dec) xd := export.Decoder(dec) - err = unmarshalFull(dec, out, &xd.Struct) + err = unmarshalDecode(dec, out, &xd.Struct, true) if err != nil && xd.Flags.Get(jsonflags.ReportErrorsWithLegacySemantics) { return internal.TransformUnmarshalError(out, err) } return err } -func unmarshalFull(in *jsontext.Decoder, out any, uo *jsonopts.Struct) error { - switch err := unmarshalDecode(in, out, uo); err { - case nil: - return export.Decoder(in).CheckEOF() - case io.EOF: - return io.ErrUnexpectedEOF - default: - return err - } -} - // UnmarshalDecode deserializes a Go value from a [jsontext.Decoder] according to // the provided unmarshal options (while ignoring marshal, encode, or decode options). // Any unmarshal options already specified on the [jsontext.Decoder] @@ -462,14 +451,14 @@ func UnmarshalDecode(in *jsontext.Decoder, out any, opts ...Options) (err error) defer func() { xd.Struct = optsOriginal }() xd.Struct.JoinWithoutCoderOptions(opts...) } - err = unmarshalDecode(in, out, &xd.Struct) + err = unmarshalDecode(in, out, &xd.Struct, false) if err != nil && xd.Flags.Get(jsonflags.ReportErrorsWithLegacySemantics) { return internal.TransformUnmarshalError(out, err) } return err } -func unmarshalDecode(in *jsontext.Decoder, out any, uo *jsonopts.Struct) (err error) { +func unmarshalDecode(in *jsontext.Decoder, out any, uo *jsonopts.Struct, last bool) (err error) { v := reflect.ValueOf(out) if v.Kind() != reflect.Pointer || v.IsNil() { return &SemanticError{action: "unmarshal", GoType: reflect.TypeOf(out), Err: internal.ErrNonNilReference} @@ -480,7 +469,11 @@ func unmarshalDecode(in *jsontext.Decoder, out any, uo *jsonopts.Struct) (err er // In legacy semantics, the entirety of the next JSON value // was validated before attempting to unmarshal it. if uo.Flags.Get(jsonflags.ReportErrorsWithLegacySemantics) { - if err := export.Decoder(in).CheckNextValue(); err != nil { + if err := export.Decoder(in).CheckNextValue(last); err != nil { + if err == io.EOF { + offset := in.InputOffset() + int64(len(in.UnreadBuffer())) + return &jsontext.SyntacticError{ByteOffset: offset, Err: io.ErrUnexpectedEOF} + } return err } } @@ -494,8 +487,15 @@ func unmarshalDecode(in *jsontext.Decoder, out any, uo *jsonopts.Struct) (err er if !uo.Flags.Get(jsonflags.AllowDuplicateNames) { export.Decoder(in).Tokens.InvalidateDisabledNamespaces() } + if err == io.EOF { + offset := in.InputOffset() + int64(len(in.UnreadBuffer())) + return &jsontext.SyntacticError{ByteOffset: offset, Err: io.ErrUnexpectedEOF} + } return err } + if last { + return export.Decoder(in).CheckEOF() + } return nil } diff --git a/src/encoding/json/v2/arshal_default.go b/src/encoding/json/v2/arshal_default.go index 5ca51c6635..f3fc79beac 100644 --- a/src/encoding/json/v2/arshal_default.go +++ b/src/encoding/json/v2/arshal_default.go @@ -329,8 +329,9 @@ func makeBytesArshaler(t reflect.Type, fncs *arshaler) *arshaler { default: return newInvalidFormatError(enc, t, mo) } - } else if mo.Flags.Get(jsonflags.FormatBytesWithLegacySemantics) && - (va.Kind() == reflect.Array || hasMarshaler) { + } else if mo.Flags.Get(jsonflags.FormatByteArrayAsArray) && va.Kind() == reflect.Array { + return marshalArray(enc, va, mo) + } else if mo.Flags.Get(jsonflags.FormatBytesWithLegacySemantics) && hasMarshaler { return marshalArray(enc, va, mo) } if mo.Flags.Get(jsonflags.FormatNilSliceAsNull) && va.Kind() == reflect.Slice && va.IsNil() { @@ -366,8 +367,9 @@ func makeBytesArshaler(t reflect.Type, fncs *arshaler) *arshaler { default: return newInvalidFormatError(dec, t, uo) } - } else if uo.Flags.Get(jsonflags.FormatBytesWithLegacySemantics) && - (va.Kind() == reflect.Array || dec.PeekKind() == '[') { + } else if uo.Flags.Get(jsonflags.FormatByteArrayAsArray) && va.Kind() == reflect.Array { + return unmarshalArray(dec, va, uo) + } else if uo.Flags.Get(jsonflags.FormatBytesWithLegacySemantics) && dec.PeekKind() == '[' { return unmarshalArray(dec, va, uo) } var flags jsonwire.ValueFlags @@ -395,7 +397,7 @@ func makeBytesArshaler(t reflect.Type, fncs *arshaler) *arshaler { if err != nil { return newUnmarshalErrorAfter(dec, t, err) } - if len(val) != encodedLen(len(b)) && !uo.Flags.Get(jsonflags.FormatBytesWithLegacySemantics) { + if len(val) != encodedLen(len(b)) && !uo.Flags.Get(jsonflags.ParseBytesWithLooseRFC4648) { // TODO(https://go.dev/issue/53845): RFC 4648, section 3.3, // specifies that non-alphabet characters must be rejected. // Unfortunately, the "base32" and "base64" packages allow @@ -1065,7 +1067,7 @@ func makeStructArshaler(t reflect.Type) *arshaler { } // Check for the legacy definition of omitempty. - if f.omitempty && mo.Flags.Get(jsonflags.OmitEmptyWithLegacyDefinition) && isLegacyEmpty(v) { + if f.omitempty && mo.Flags.Get(jsonflags.OmitEmptyWithLegacySemantics) && isLegacyEmpty(v) { continue } @@ -1080,7 +1082,7 @@ func makeStructArshaler(t reflect.Type) *arshaler { // OmitEmpty skips the field if the marshaled JSON value is empty, // which we can know up front if there are no custom marshalers, // otherwise we must marshal the value and unwrite it if empty. - if f.omitempty && !mo.Flags.Get(jsonflags.OmitEmptyWithLegacyDefinition) && + if f.omitempty && !mo.Flags.Get(jsonflags.OmitEmptyWithLegacySemantics) && !nonDefault && f.isEmpty != nil && f.isEmpty(v) { continue // fast path for omitempty } @@ -1145,7 +1147,7 @@ func makeStructArshaler(t reflect.Type) *arshaler { } // Try unwriting the member if empty (slow path for omitempty). - if f.omitempty && !mo.Flags.Get(jsonflags.OmitEmptyWithLegacyDefinition) { + if f.omitempty && !mo.Flags.Get(jsonflags.OmitEmptyWithLegacySemantics) { var prevName *string if prevIdx >= 0 { prevName = &fields.flattened[prevIdx].name @@ -1688,8 +1690,6 @@ func makePointerArshaler(t reflect.Type) *arshaler { return &fncs } -var errNilInterface = errors.New("cannot derive concrete type for nil interface with finite type set") - func makeInterfaceArshaler(t reflect.Type) *arshaler { // NOTE: Values retrieved from an interface are not addressable, // so we shallow copy the values to make them addressable and @@ -1795,7 +1795,7 @@ func makeInterfaceArshaler(t reflect.Type) *arshaler { k := dec.PeekKind() if !isAnyType(t) { - return newUnmarshalErrorBeforeWithSkipping(dec, uo, t, errNilInterface) + return newUnmarshalErrorBeforeWithSkipping(dec, uo, t, internal.ErrNilInterface) } switch k { case 'f', 't': diff --git a/src/encoding/json/v2/arshal_test.go b/src/encoding/json/v2/arshal_test.go index 8494deed03..f1ee2e2e3a 100644 --- a/src/encoding/json/v2/arshal_test.go +++ b/src/encoding/json/v2/arshal_test.go @@ -1924,12 +1924,12 @@ func TestMarshal(t *testing.T) { }`, }, { name: jsontest.Name("Structs/OmitEmpty/Legacy/Zero"), - opts: []Options{jsonflags.OmitEmptyWithLegacyDefinition | 1}, + opts: []Options{jsonflags.OmitEmptyWithLegacySemantics | 1}, in: structOmitEmptyAll{}, want: `{}`, }, { name: jsontest.Name("Structs/OmitEmpty/Legacy/NonEmpty"), - opts: []Options{jsontext.Multiline(true), jsonflags.OmitEmptyWithLegacyDefinition | 1}, + opts: []Options{jsontext.Multiline(true), jsonflags.OmitEmptyWithLegacySemantics | 1}, in: structOmitEmptyAll{ Bool: true, PointerBool: addr(true), @@ -2144,7 +2144,7 @@ func TestMarshal(t *testing.T) { "Default": "AQIDBA==" }`}, { name: jsontest.Name("Structs/Format/ArrayBytes/Legacy"), - opts: []Options{jsontext.Multiline(true), jsonflags.FormatBytesWithLegacySemantics | 1}, + opts: []Options{jsontext.Multiline(true), jsonflags.FormatByteArrayAsArray | jsonflags.FormatBytesWithLegacySemantics | 1}, in: structFormatArrayBytes{ Base16: [4]byte{1, 2, 3, 4}, Base32: [4]byte{1, 2, 3, 4}, @@ -4394,7 +4394,7 @@ func TestMarshal(t *testing.T) { }, { /* TODO(https://go.dev/issue/71631): Re-enable this test case. name: jsontest.Name("Duration/Format/Legacy"), - opts: []Options{jsonflags.FormatTimeWithLegacySemantics | 1}, + opts: []Options{jsonflags.FormatDurationAsNano | 1}, in: structDurationFormat{ D1: 12*time.Hour + 34*time.Minute + 56*time.Second + 78*time.Millisecond + 90*time.Microsecond + 12*time.Nanosecond, D2: 12*time.Hour + 34*time.Minute + 56*time.Second + 78*time.Millisecond + 90*time.Microsecond + 12*time.Nanosecond, @@ -4407,7 +4407,7 @@ func TestMarshal(t *testing.T) { want: `{"1s":""}`, }, { */ name: jsontest.Name("Duration/MapKey/Legacy"), - opts: []Options{jsonflags.FormatTimeWithLegacySemantics | 1}, + opts: []Options{jsonflags.FormatDurationAsNano | 1}, in: map[time.Duration]string{time.Second: ""}, want: `{"1000000000":""}`, }, { @@ -6399,7 +6399,7 @@ func TestUnmarshal(t *testing.T) { wantErr: EU(errors.New("illegal character '\\r' at offset 3")).withPos(`{"Base64": `, "/Base64").withType('"', T[[]byte]()), }, { name: jsontest.Name("Structs/Format/Bytes/Base64/NonAlphabet/Ignored"), - opts: []Options{jsonflags.FormatBytesWithLegacySemantics | 1}, + opts: []Options{jsonflags.ParseBytesWithLooseRFC4648 | 1}, inBuf: `{"Base64": "aa=\r\n="}`, inVal: new(structFormatBytes), want: &structFormatBytes{Base64: []byte{105}}, @@ -7138,7 +7138,13 @@ func TestUnmarshal(t *testing.T) { inBuf: ``, inVal: addr(structAll{}), want: addr(structAll{}), - wantErr: io.ErrUnexpectedEOF, + wantErr: &jsontext.SyntacticError{Err: io.ErrUnexpectedEOF}, + }, { + name: jsontest.Name("Structs/Invalid/ErrUnexpectedEOF"), + inBuf: " \n\r\t", + inVal: addr(structAll{}), + want: addr(structAll{}), + wantErr: &jsontext.SyntacticError{Err: io.ErrUnexpectedEOF, ByteOffset: len64(" \n\r\t")}, }, { name: jsontest.Name("Structs/Invalid/NestedErrUnexpectedEOF"), inBuf: `{"Pointer":`, @@ -7490,7 +7496,7 @@ func TestUnmarshal(t *testing.T) { inBuf: `"hello"`, inVal: new(io.Reader), want: new(io.Reader), - wantErr: EU(errNilInterface).withType(0, T[io.Reader]()), + wantErr: EU(internal.ErrNilInterface).withType(0, T[io.Reader]()), }, { name: jsontest.Name("Interfaces/Empty/False"), inBuf: `false`, @@ -8338,7 +8344,7 @@ func TestUnmarshal(t *testing.T) { inBuf: `{"X":"hello"}`, inVal: addr(struct{ X fmt.Stringer }{nil}), want: addr(struct{ X fmt.Stringer }{nil}), - wantErr: EU(errNilInterface).withPos(`{"X":`, "/X").withType(0, T[fmt.Stringer]()), + wantErr: EU(internal.ErrNilInterface).withPos(`{"X":`, "/X").withType(0, T[fmt.Stringer]()), }, { name: jsontest.Name("Functions/Interface/NetIP"), opts: []Options{ @@ -8879,7 +8885,7 @@ func TestUnmarshal(t *testing.T) { /* TODO(https://go.dev/issue/71631): Re-enable this test case. name: jsontest.Name("Duration/Format/Legacy"), inBuf: `{"D1":45296078090012,"D2":"12h34m56.078090012s"}`, - opts: []Options{jsonflags.FormatTimeWithLegacySemantics | 1}, + opts: []Options{jsonflags.FormatDurationAsNano | 1}, inVal: new(structDurationFormat), want: addr(structDurationFormat{ D1: 12*time.Hour + 34*time.Minute + 56*time.Second + 78*time.Millisecond + 90*time.Microsecond + 12*time.Nanosecond, @@ -8893,7 +8899,7 @@ func TestUnmarshal(t *testing.T) { want: addr(map[time.Duration]string{time.Second: ""}), }, { */ name: jsontest.Name("Duration/MapKey/Legacy"), - opts: []Options{jsonflags.FormatTimeWithLegacySemantics | 1}, + opts: []Options{jsonflags.FormatDurationAsNano | 1}, inBuf: `{"1000000000":""}`, inVal: new(map[time.Duration]string), want: addr(map[time.Duration]string{time.Second: ""}), diff --git a/src/encoding/json/v2/arshal_time.go b/src/encoding/json/v2/arshal_time.go index fefa50ff5f..06fed03e05 100644 --- a/src/encoding/json/v2/arshal_time.go +++ b/src/encoding/json/v2/arshal_time.go @@ -50,7 +50,7 @@ func makeTimeArshaler(fncs *arshaler, t reflect.Type) *arshaler { if !m.initFormat(mo.Format) { return newInvalidFormatError(enc, t, mo) } - } else if mo.Flags.Get(jsonflags.FormatTimeWithLegacySemantics) { + } else if mo.Flags.Get(jsonflags.FormatDurationAsNano) { return marshalNano(enc, va, mo) } else { // TODO(https://go.dev/issue/71631): Decide on default duration representation. @@ -76,7 +76,7 @@ func makeTimeArshaler(fncs *arshaler, t reflect.Type) *arshaler { if !u.initFormat(uo.Format) { return newInvalidFormatError(dec, t, uo) } - } else if uo.Flags.Get(jsonflags.FormatTimeWithLegacySemantics) { + } else if uo.Flags.Get(jsonflags.FormatDurationAsNano) { return unmarshalNano(dec, va, uo) } else { // TODO(https://go.dev/issue/71631): Decide on default duration representation. @@ -150,7 +150,7 @@ func makeTimeArshaler(fncs *arshaler, t reflect.Type) *arshaler { if !u.initFormat(uo.Format) { return newInvalidFormatError(dec, t, uo) } - } else if uo.Flags.Get(jsonflags.FormatTimeWithLegacySemantics) { + } else if uo.Flags.Get(jsonflags.ParseTimeWithLooseRFC3339) { u.looseRFC3339 = true } diff --git a/src/encoding/json/v2/doc.go b/src/encoding/json/v2/doc.go index 203139754c..8179f8ab17 100644 --- a/src/encoding/json/v2/doc.go +++ b/src/encoding/json/v2/doc.go @@ -166,6 +166,100 @@ // Marshaling or unmarshaling a non-empty struct // without any JSON representable fields results in a [SemanticError]. // Unexported fields must not have any `json` tags except for `json:"-"`. +// +// # Security Considerations +// +// JSON is frequently used as a data interchange format to communicate +// between different systems, possibly implemented in different languages. +// For interoperability and security reasons, it is important that +// all implementations agree upon the semantic meaning of the data. +// +// [For example, suppose we have two micro-services.] +// The first service is responsible for authenticating a JSON request, +// while the second service is responsible for executing the request +// (having assumed that the prior service authenticated the request). +// If an attacker were able to maliciously craft a JSON request such that +// both services believe that the same request is from different users, +// it could bypass the authenticator with valid credentials for one user, +// but maliciously perform an action on behalf of a different user. +// +// According to RFC 8259, there unfortunately exist many JSON texts +// that are syntactically valid but semantically ambiguous. +// For example, the standard does not define how to interpret duplicate +// names within an object. +// +// The v1 [encoding/json] and [encoding/json/v2] packages +// interpret some inputs in different ways. In particular: +// +// - The standard specifies that JSON must be encoded using UTF-8. +// By default, v1 replaces invalid bytes of UTF-8 in JSON strings +// with the Unicode replacement character, +// while v2 rejects inputs with invalid UTF-8. +// To change the default, specify the [jsontext.AllowInvalidUTF8] option. +// The replacement of invalid UTF-8 is a form of data corruption +// that alters the precise meaning of strings. +// +// - The standard does not specify a particular behavior when +// duplicate names are encountered within a JSON object, +// which means that different implementations may behave differently. +// By default, v1 allows for the presence of duplicate names, +// while v2 rejects duplicate names. +// To change the default, specify the [jsontext.AllowDuplicateNames] option. +// If allowed, object members are processed in the order they are observed, +// meaning that later values will replace or be merged into prior values, +// depending on the Go value type. +// +// - The standard defines a JSON object as an unordered collection of name/value pairs. +// While ordering can be observed through the underlying [jsontext] API, +// both v1 and v2 generally avoid exposing the ordering. +// No application should semantically depend on the order of object members. +// Allowing duplicate names is a vector through which ordering of members +// can accidentally be observed and depended upon. +// +// - The standard suggests that JSON object names are typically compared +// based on equality of the sequence of Unicode code points, +// which implies that comparing names is often case-sensitive. +// When unmarshaling a JSON object into a Go struct, +// by default, v1 uses a (loose) case-insensitive match on the name, +// while v2 uses a (strict) case-sensitive match on the name. +// To change the default, specify the [MatchCaseInsensitiveNames] option. +// The use of case-insensitive matching provides another vector through +// which duplicate names can occur. Allowing case-insensitive matching +// means that v1 or v2 might interpret JSON objects differently from most +// other JSON implementations (which typically use a case-sensitive match). +// +// - The standard does not specify a particular behavior when +// an unknown name in a JSON object is encountered. +// When unmarshaling a JSON object into a Go struct, by default +// both v1 and v2 ignore unknown names and their corresponding values. +// To change the default, specify the [RejectUnknownMembers] option. +// +// - The standard suggests that implementations may use a float64 +// to represent a JSON number. Consequently, large JSON integers +// may lose precision when stored as a floating-point type. +// Both v1 and v2 correctly preserve precision when marshaling and +// unmarshaling a concrete integer type. However, even if v1 and v2 +// preserve precision for concrete types, other JSON implementations +// may not be able to preserve precision for outputs produced by v1 or v2. +// The `string` tag option can be used to specify that an integer type +// is to be quoted within a JSON string to avoid loss of precision. +// Furthermore, v1 and v2 may still lose precision when unmarshaling +// into an any interface value, where unmarshal uses a float64 +// by default to represent a JSON number. +// To change the default, specify the [WithUnmarshalers] option +// with a custom unmarshaler that pre-populates the interface value +// with a concrete Go type that can preserve precision. +// +// RFC 8785 specifies a canonical form for any JSON text, +// which explicitly defines specific behaviors that RFC 8259 leaves undefined. +// In theory, if a text can successfully [jsontext.Value.Canonicalize] +// without changing the semantic meaning of the data, then it provides a +// greater degree of confidence that the data is more secure and interoperable. +// +// The v2 API generally chooses more secure defaults than v1, +// but care should still be taken with large integers or unknown members. +// +// [For example, suppose we have two micro-services.]: https://www.youtube.com/watch?v=avilmOcHKHE&t=1057s package json // requireKeyedLiterals can be embedded in a struct to require keyed literals. diff --git a/src/encoding/json/v2/errors.go b/src/encoding/json/v2/errors.go index 48cdcc953b..1f31505869 100644 --- a/src/encoding/json/v2/errors.go +++ b/src/encoding/json/v2/errors.go @@ -120,10 +120,17 @@ func newMarshalErrorBefore(e *jsontext.Encoder, t reflect.Type, err error) error // is positioned right before the next token or value, which causes an error. // It does not record the next JSON kind as this error is used to indicate // the receiving Go value is invalid to unmarshal into (and not a JSON error). +// However, if [jsonflags.ReportErrorsWithLegacySemantics] is specified, +// then it does record the next JSON kind for historical reporting reasons. func newUnmarshalErrorBefore(d *jsontext.Decoder, t reflect.Type, err error) error { + var k jsontext.Kind + if export.Decoder(d).Flags.Get(jsonflags.ReportErrorsWithLegacySemantics) { + k = d.PeekKind() + } return &SemanticError{action: "unmarshal", GoType: t, Err: err, ByteOffset: d.InputOffset() + int64(export.Decoder(d).CountNextDelimWhitespace()), - JSONPointer: jsontext.Pointer(export.Decoder(d).AppendStackPointer(nil, +1))} + JSONPointer: jsontext.Pointer(export.Decoder(d).AppendStackPointer(nil, +1)), + JSONKind: k} } // newUnmarshalErrorBeforeWithSkipping is like [newUnmarshalErrorBefore], diff --git a/src/encoding/json/v2_decode.go b/src/encoding/json/v2_decode.go index c82ee903c3..1041ec7ee4 100644 --- a/src/encoding/json/v2_decode.go +++ b/src/encoding/json/v2_decode.go @@ -117,19 +117,11 @@ type UnmarshalTypeError struct { } func (e *UnmarshalTypeError) Error() string { - s := "json: cannot unmarshal" - if e.Value != "" { - s += " JSON " + e.Value - } - s += " into" - var preposition string - if e.Field != "" { - s += " " + e.Struct + "." + e.Field - preposition = " of" - } - if e.Type != nil { - s += preposition - s += " Go type " + e.Type.String() + var s string + if e.Struct != "" || e.Field != "" { + s = "json: cannot unmarshal " + e.Value + " into Go struct field " + e.Struct + "." + e.Field + " of type " + e.Type.String() + } else { + s = "json: cannot unmarshal " + e.Value + " into Go value of type " + e.Type.String() } if e.Err != nil { s += ": " + e.Err.Error() diff --git a/src/encoding/json/v2_decode_test.go b/src/encoding/json/v2_decode_test.go index 3ab20e2b5d..f9b0a60f47 100644 --- a/src/encoding/json/v2_decode_test.go +++ b/src/encoding/json/v2_decode_test.go @@ -12,6 +12,7 @@ import ( "errors" "fmt" "image" + "io" "maps" "math" "math/big" @@ -419,6 +420,8 @@ type DoublePtr struct { J **int } +type NestedUnamed struct{ F struct{ V int } } + var unmarshalTests = []struct { CaseName in string @@ -473,11 +476,13 @@ var unmarshalTests = []struct { {CaseName: Name(""), in: `{"alphabet": "xyz"}`, ptr: new(U), err: fmt.Errorf("json: unknown field \"alphabet\""), disallowUnknownFields: true}, // syntax errors + {CaseName: Name(""), in: ``, ptr: new(any), err: &SyntaxError{errUnexpectedEnd.Error(), 0}}, + {CaseName: Name(""), in: " \n\r\t", ptr: new(any), err: &SyntaxError{errUnexpectedEnd.Error(), len64(" \n\r\t")}}, + {CaseName: Name(""), in: `[2, 3`, ptr: new(any), err: &SyntaxError{errUnexpectedEnd.Error(), len64(`[2, 3`)}}, {CaseName: Name(""), in: `{"X": "foo", "Y"}`, err: &SyntaxError{"invalid character '}' after object key", len64(`{"X": "foo", "Y"`)}}, {CaseName: Name(""), in: `[1, 2, 3+]`, err: &SyntaxError{"invalid character '+' after array element", len64(`[1, 2, 3`)}}, {CaseName: Name(""), in: `{"X":12x}`, err: &SyntaxError{"invalid character 'x' after object key:value pair", len64(`{"X":12`)}, useNumber: true}, - {CaseName: Name(""), in: `[2, 3`, err: &SyntaxError{msg: "unexpected end of JSON input", Offset: len64(`[2, 3`)}}, - {CaseName: Name(""), in: `{"F3": -}`, ptr: new(V), err: &SyntaxError{msg: "invalid character '}' in numeric literal", Offset: len64(`{"F3": -`)}}, + {CaseName: Name(""), in: `{"F3": -}`, ptr: new(V), err: &SyntaxError{"invalid character '}' in numeric literal", len64(`{"F3": -`)}}, // raw value errors {CaseName: Name(""), in: "\x01 42", err: &SyntaxError{"invalid character '\\x01' looking for beginning of value", len64(``)}}, @@ -1216,6 +1221,28 @@ var unmarshalTests = []struct { F string `json:"-,omitempty"` }{"hello"}, }, + + { + CaseName: Name("ErrorForNestedUnamed"), + in: `{"F":{"V":"s"}}`, + ptr: new(NestedUnamed), + out: NestedUnamed{}, + err: &UnmarshalTypeError{Value: "string", Type: reflect.TypeFor[int](), Offset: 10, Struct: "NestedUnamed", Field: "F.V"}, + }, + { + CaseName: Name("ErrorInterface"), + in: `1`, + ptr: new(error), + out: error(nil), + err: &UnmarshalTypeError{Value: "number", Type: reflect.TypeFor[error]()}, + }, + { + CaseName: Name("ErrorChan"), + in: `1`, + ptr: new(chan int), + out: (chan int)(nil), + err: &UnmarshalTypeError{Value: "number", Type: reflect.TypeFor[chan int]()}, + }, } func TestMarshal(t *testing.T) { @@ -1246,12 +1273,12 @@ func TestMarshalInvalidUTF8(t *testing.T) { in string want string }{ - {Name(""), "hello\xffworld", `"hello\ufffdworld"`}, + {Name(""), "hello\xffworld", "\"hello\ufffdworld\""}, {Name(""), "", `""`}, - {Name(""), "\xff", `"\ufffd"`}, - {Name(""), "\xff\xff", `"\ufffd\ufffd"`}, - {Name(""), "a\xffb", `"a\ufffdb"`}, - {Name(""), "\xe6\x97\xa5\xe6\x9c\xac\xff\xaa\x9e", `"日本\ufffd\ufffd\ufffd"`}, + {Name(""), "\xff", "\"\ufffd\""}, + {Name(""), "\xff\xff", "\"\ufffd\ufffd\""}, + {Name(""), "a\xffb", "\"a\ufffdb\""}, + {Name(""), "\xe6\x97\xa5\xe6\x9c\xac\xff\xaa\x9e", "\"日本\ufffd\ufffd\ufffd\""}, } for _, tt := range tests { t.Run(tt.Name, func(t *testing.T) { @@ -1382,6 +1409,14 @@ func TestUnmarshal(t *testing.T) { if tt.disallowUnknownFields { dec.DisallowUnknownFields() } + if tt.err != nil && strings.Contains(tt.err.Error(), errUnexpectedEnd.Error()) { + // In streaming mode, we expect EOF or ErrUnexpectedEOF instead. + if strings.TrimSpace(tt.in) == "" { + tt.err = io.EOF + } else { + tt.err = io.ErrUnexpectedEOF + } + } if err := dec.Decode(v.Interface()); !equalError(err, tt.err) { t.Fatalf("%s: Decode error:\n\tgot: %v\n\twant: %v\n\n\tgot: %#v\n\twant: %#v", tt.Where, err, tt.err, err, tt.err) } else if err != nil && tt.out == nil { @@ -1541,12 +1576,12 @@ func TestErrorMessageFromMisusedString(t *testing.T) { CaseName in, err string }{ - {Name(""), `{"result":"x"}`, `json: cannot unmarshal JSON string into WrongString.result of Go type string: invalid character 'x' looking for beginning of object key string`}, - {Name(""), `{"result":"foo"}`, `json: cannot unmarshal JSON string into WrongString.result of Go type string: invalid character 'f' looking for beginning of object key string`}, - {Name(""), `{"result":"123"}`, `json: cannot unmarshal JSON string into WrongString.result of Go type string: invalid character '1' looking for beginning of object key string`}, - {Name(""), `{"result":123}`, `json: cannot unmarshal JSON number into WrongString.result of Go type string`}, - {Name(""), `{"result":"\""}`, `json: cannot unmarshal JSON string into WrongString.result of Go type string: unexpected end of JSON input`}, - {Name(""), `{"result":"\"foo"}`, `json: cannot unmarshal JSON string into WrongString.result of Go type string: unexpected end of JSON input`}, + {Name(""), `{"result":"x"}`, `json: cannot unmarshal string into Go struct field WrongString.result of type string: invalid character 'x' looking for beginning of object key string`}, + {Name(""), `{"result":"foo"}`, `json: cannot unmarshal string into Go struct field WrongString.result of type string: invalid character 'f' looking for beginning of object key string`}, + {Name(""), `{"result":"123"}`, `json: cannot unmarshal string into Go struct field WrongString.result of type string: invalid character '1' looking for beginning of object key string`}, + {Name(""), `{"result":123}`, `json: cannot unmarshal number into Go struct field WrongString.result of type string`}, + {Name(""), `{"result":"\""}`, `json: cannot unmarshal string into Go struct field WrongString.result of type string: unexpected end of JSON input`}, + {Name(""), `{"result":"\"foo"}`, `json: cannot unmarshal string into Go struct field WrongString.result of type string: unexpected end of JSON input`}, } for _, tt := range tests { t.Run(tt.Name, func(t *testing.T) { @@ -2534,6 +2569,7 @@ func TestUnmarshalEmbeddedUnexported(t *testing.T) { ptr: new(S1), out: &S1{R: 2}, err: &UnmarshalTypeError{ + Value: "number", Type: reflect.TypeFor[S1](), Offset: len64(`{"R":2,"Q":`), Struct: "S1", @@ -2566,6 +2602,7 @@ func TestUnmarshalEmbeddedUnexported(t *testing.T) { ptr: new(S5), out: &S5{R: 2}, err: &UnmarshalTypeError{ + Value: "number", Type: reflect.TypeFor[S5](), Offset: len64(`{"R":2,"Q":`), Struct: "S5", diff --git a/src/encoding/json/v2_diff_test.go b/src/encoding/json/v2_diff_test.go index 7a561732f4..9d0798ed1d 100644 --- a/src/encoding/json/v2_diff_test.go +++ b/src/encoding/json/v2_diff_test.go @@ -786,8 +786,8 @@ func TestInvalidUTF8(t *testing.T) { switch { case json.Version == "v1" && err != nil: t.Fatalf("json.Marshal error: %v", err) - case json.Version == "v1" && string(got) != `"\ufffd"`: - t.Fatalf(`json.Marshal = %s, want "\ufffd"`, got) + case json.Version == "v1" && string(got) != "\"\ufffd\"": + t.Fatalf(`json.Marshal = %s, want %q`, got, "\ufffd") case json.Version == "v2" && err == nil: t.Fatal("json.Marshal error is nil, want non-nil") } diff --git a/src/encoding/json/v2_encode.go b/src/encoding/json/v2_encode.go index cbb167dbd0..c2d620bcbb 100644 --- a/src/encoding/json/v2_encode.go +++ b/src/encoding/json/v2_encode.go @@ -10,6 +10,14 @@ // // See "JSON and Go" for an introduction to this package: // https://golang.org/doc/articles/json_and_go.html +// +// # Security Considerations +// +// See the "Security Considerations" section in [encoding/json/v2]. +// +// For historical reasons, the default behavior of v1 [encoding/json] +// unfortunately operates with less secure defaults. +// New usages of JSON in Go are encouraged to use [encoding/json/v2] instead. package json import ( diff --git a/src/encoding/json/v2_inject.go b/src/encoding/json/v2_inject.go index f903588431..31cdb4d61a 100644 --- a/src/encoding/json/v2_inject.go +++ b/src/encoding/json/v2_inject.go @@ -73,6 +73,9 @@ func transformUnmarshalError(root any, err error) error { if err.Err == jsonv2.ErrUnknownName { return fmt.Errorf("json: unknown field %q", err.JSONPointer.LastToken()) } + if err.Err == internal.ErrNilInterface { + err.Err = nil // non-descriptive for historical reasons + } // Historically, UnmarshalTypeError has always been inconsistent // about how it reported position information. diff --git a/src/encoding/json/v2_options.go b/src/encoding/json/v2_options.go index 4006d764cc..4dea88ad7e 100644 --- a/src/encoding/json/v2_options.go +++ b/src/encoding/json/v2_options.go @@ -36,7 +36,7 @@ // any empty array, slice, map, or string. In contrast, v2 redefines // `omitempty` to omit a field if it encodes as an "empty" JSON value, // which is defined as a JSON null, or an empty JSON string, object, or array. -// The [OmitEmptyWithLegacyDefinition] option controls this behavior difference. +// The [OmitEmptyWithLegacySemantics] option controls this behavior difference. // Note that `omitempty` behaves identically in both v1 and v2 for a // Go array, slice, map, or string (assuming no user-defined MarshalJSON method // overrides the default representation). Existing usages of `omitempty` on a @@ -66,7 +66,7 @@ // // - In v1, a Go byte array is represented as a JSON array of JSON numbers. // In contrast, in v2 a Go byte array is represented as a Base64-encoded JSON string. -// The [FormatBytesWithLegacySemantics] option controls this behavior difference. +// The [FormatByteArrayAsArray] option controls this behavior difference. // To explicitly specify a Go struct field to use a particular representation, // either the `format:array` or `format:base64` field option can be specified. // Field-specified options take precedence over caller-specified options. @@ -118,9 +118,8 @@ // // - In v1, a [time.Duration] is represented as a JSON number containing // the decimal number of nanoseconds. In contrast, in v2 a [time.Duration] -// is represented as a JSON string containing the formatted duration -// (e.g., "1h2m3.456s") according to [time.Duration.String]. -// The [FormatTimeWithLegacySemantics] option controls this behavior difference. +// has no default representation and results in a runtime error. +// The [FormatDurationAsNano] option controls this behavior difference. // To explicitly specify a Go struct field to use a particular representation, // either the `format:nano` or `format:units` field option can be specified. // Field-specified options take precedence over caller-specified options. @@ -172,6 +171,9 @@ // but the v1 package will forever remain supported. package json +// TODO(https://go.dev/issue/71631): Update the "Migrating to v2" documentation +// with default v2 behavior for [time.Duration]. + import ( "encoding" @@ -204,12 +206,14 @@ type Options = jsonopts.Options // It is equivalent to the following boolean options being set to true: // // - [CallMethodsWithLegacySemantics] -// - [EscapeInvalidUTF8] +// - [FormatByteArrayAsArray] // - [FormatBytesWithLegacySemantics] -// - [FormatTimeWithLegacySemantics] +// - [FormatDurationAsNano] // - [MatchCaseSensitiveDelimiter] // - [MergeWithLegacySemantics] -// - [OmitEmptyWithLegacyDefinition] +// - [OmitEmptyWithLegacySemantics] +// - [ParseBytesWithLooseRFC4648] +// - [ParseTimeWithLooseRFC3339] // - [ReportErrorsWithLegacySemantics] // - [StringifyWithLegacySemantics] // - [UnmarshalArrayFromAnyLength] @@ -279,30 +283,25 @@ func CallMethodsWithLegacySemantics(v bool) Options { } } -// EscapeInvalidUTF8 specifies that when encoding a [jsontext.String] -// with bytes of invalid UTF-8, such bytes are escaped as -// a hexadecimal Unicode codepoint (i.e., \ufffd). -// In contrast, the v2 default is to use the minimal representation, -// which is to encode invalid UTF-8 as the Unicode replacement rune itself -// (without any form of escaping). +// FormatByteArrayAsArray specifies that a Go [N]byte is +// formatted as as a normal Go array in contrast to the v2 default of +// formatting [N]byte as using binary data encoding (RFC 4648). +// If a struct field has a `format` tag option, +// then the specified formatting takes precedence. // -// This only affects encoding and is ignored when decoding. +// This affects either marshaling or unmarshaling. // The v1 default is true. -func EscapeInvalidUTF8(v bool) Options { +func FormatByteArrayAsArray(v bool) Options { if v { - return jsonflags.EscapeInvalidUTF8 | 1 + return jsonflags.FormatByteArrayAsArray | 1 } else { - return jsonflags.EscapeInvalidUTF8 | 0 + return jsonflags.FormatByteArrayAsArray | 0 } } // FormatBytesWithLegacySemantics specifies that handling of // []~byte and [N]~byte types follow legacy semantics: // -// - A Go [N]~byte is always treated as as a normal Go array -// in contrast to the v2 default of treating [N]byte as -// using some form of binary data encoding (RFC 4648). -// // - A Go []~byte is to be treated as using some form of // binary data encoding (RFC 4648) in contrast to the v2 default // of only treating []byte as such. In particular, v2 does not @@ -317,12 +316,6 @@ func EscapeInvalidUTF8(v bool) Options { // In contrast, the v2 default is to report an error unmarshaling // a JSON array when expecting some form of binary data encoding. // -// - When unmarshaling, '\r' and '\n' characters are ignored -// within the encoded "base32" and "base64" data. -// In contrast, the v2 default is to report an error in order to be -// strictly compliant with RFC 4648, section 3.3, -// which specifies that non-alphabet characters must be rejected. -// // This affects either marshaling or unmarshaling. // The v1 default is true. func FormatBytesWithLegacySemantics(v bool) Options { @@ -333,29 +326,20 @@ func FormatBytesWithLegacySemantics(v bool) Options { } } -// FormatTimeWithLegacySemantics specifies that [time] types are formatted -// with legacy semantics: -// -// - When marshaling or unmarshaling, a [time.Duration] is formatted as -// a JSON number representing the number of nanoseconds. -// In contrast, the default v2 behavior uses a JSON string -// with the duration formatted with [time.Duration.String]. -// If a duration field has a `format` tag option, -// then the specified formatting takes precedence. -// -// - When unmarshaling, a [time.Time] follows loose adherence to RFC 3339. -// In particular, it permits historically incorrect representations, -// allowing for deviations in hour format, sub-second separator, -// and timezone representation. In contrast, the default v2 behavior -// is to strictly comply with the grammar specified in RFC 3339. +// FormatDurationAsNano specifies that a [time.Duration] is +// formatted as a JSON number representing the number of nanoseconds +// in contrast to the v2 default of reporting an error. +// If a duration field has a `format` tag option, +// then the specified formatting takes precedence. // // This affects either marshaling or unmarshaling. // The v1 default is true. -func FormatTimeWithLegacySemantics(v bool) Options { +func FormatDurationAsNano(v bool) Options { + // TODO(https://go.dev/issue/71631): Update documentation with v2 behavior. if v { - return jsonflags.FormatTimeWithLegacySemantics | 1 + return jsonflags.FormatDurationAsNano | 1 } else { - return jsonflags.FormatTimeWithLegacySemantics | 0 + return jsonflags.FormatDurationAsNano | 0 } } @@ -404,7 +388,7 @@ func MergeWithLegacySemantics(v bool) Options { } } -// OmitEmptyWithLegacyDefinition specifies that the `omitempty` tag option +// OmitEmptyWithLegacySemantics specifies that the `omitempty` tag option // follows a definition of empty where a field is omitted if the Go value is // false, 0, a nil pointer, a nil interface value, // or any empty array, slice, map, or string. @@ -418,11 +402,45 @@ func MergeWithLegacySemantics(v bool) Options { // // This only affects marshaling and is ignored when unmarshaling. // The v1 default is true. -func OmitEmptyWithLegacyDefinition(v bool) Options { +func OmitEmptyWithLegacySemantics(v bool) Options { + if v { + return jsonflags.OmitEmptyWithLegacySemantics | 1 + } else { + return jsonflags.OmitEmptyWithLegacySemantics | 0 + } +} + +// ParseBytesWithLooseRFC4648 specifies that when parsing +// binary data encoded as "base32" or "base64", +// to ignore the presence of '\r' and '\n' characters. +// In contrast, the v2 default is to report an error in order to be +// strictly compliant with RFC 4648, section 3.3, +// which specifies that non-alphabet characters must be rejected. +// +// This only affects unmarshaling and is ignored when marshaling. +// The v1 default is true. +func ParseBytesWithLooseRFC4648(v bool) Options { + if v { + return jsonflags.ParseBytesWithLooseRFC4648 | 1 + } else { + return jsonflags.ParseBytesWithLooseRFC4648 | 0 + } +} + +// ParseTimeWithLooseRFC3339 specifies that a [time.Time] +// parses according to loose adherence to RFC 3339. +// In particular, it permits historically incorrect representations, +// allowing for deviations in hour format, sub-second separator, +// and timezone representation. In contrast, the default v2 behavior +// is to strictly comply with the grammar specified in RFC 3339. +// +// This only affects unmarshaling and is ignored when marshaling. +// The v1 default is true. +func ParseTimeWithLooseRFC3339(v bool) Options { if v { - return jsonflags.OmitEmptyWithLegacyDefinition | 1 + return jsonflags.ParseTimeWithLooseRFC3339 | 1 } else { - return jsonflags.OmitEmptyWithLegacyDefinition | 0 + return jsonflags.ParseTimeWithLooseRFC3339 | 0 } } diff --git a/src/encoding/json/v2_scanner.go b/src/encoding/json/v2_scanner.go index 475bf58b20..aef045f466 100644 --- a/src/encoding/json/v2_scanner.go +++ b/src/encoding/json/v2_scanner.go @@ -30,6 +30,10 @@ func checkValid(data []byte) error { xd := export.Decoder(d) xd.Struct.Flags.Set(jsonflags.AllowDuplicateNames | jsonflags.AllowInvalidUTF8 | 1) if _, err := d.ReadValue(); err != nil { + if err == io.EOF { + offset := d.InputOffset() + int64(len(d.UnreadBuffer())) + err = &jsontext.SyntacticError{ByteOffset: offset, Err: io.ErrUnexpectedEOF} + } return transformSyntacticError(err) } if err := xd.CheckEOF(); err != nil { diff --git a/src/encoding/json/v2_stream.go b/src/encoding/json/v2_stream.go index d58bafbfd0..28e72c0a52 100644 --- a/src/encoding/json/v2_stream.go +++ b/src/encoding/json/v2_stream.go @@ -8,6 +8,7 @@ package json import ( "bytes" + "errors" "io" "encoding/json/jsontext" @@ -68,7 +69,7 @@ func (dec *Decoder) Decode(v any) error { b, err := dec.dec.ReadValue() if err != nil { dec.err = transformSyntacticError(err) - if dec.err == errUnexpectedEnd { + if dec.err.Error() == errUnexpectedEnd.Error() { // NOTE: Decode has always been inconsistent with Unmarshal // with regard to the exact error value for truncated input. dec.err = io.ErrUnexpectedEOF @@ -193,6 +194,16 @@ func (d Delim) String() string { func (dec *Decoder) Token() (Token, error) { tok, err := dec.dec.ReadToken() if err != nil { + // Historically, v1 would report just [io.EOF] if + // the stream is a prefix of a valid JSON value. + // It reports an unwrapped [io.ErrUnexpectedEOF] if + // truncated within a JSON token such as a literal, number, or string. + if errors.Is(err, io.ErrUnexpectedEOF) { + if len(bytes.Trim(dec.dec.UnreadBuffer(), " \r\n\t,:")) == 0 { + return nil, io.EOF + } + return nil, io.ErrUnexpectedEOF + } return nil, transformSyntacticError(err) } switch k := tok.Kind(); k { diff --git a/src/encoding/json/v2_stream_test.go b/src/encoding/json/v2_stream_test.go index 38eb6660a2..b8951f8205 100644 --- a/src/encoding/json/v2_stream_test.go +++ b/src/encoding/json/v2_stream_test.go @@ -502,3 +502,38 @@ func TestHTTPDecoding(t *testing.T) { t.Errorf("Decode error:\n\tgot: %v\n\twant: io.EOF", err) } } + +func TestTokenTruncation(t *testing.T) { + tests := []struct { + in string + err error + }{ + {in: ``, err: io.EOF}, + {in: `{`, err: io.EOF}, + {in: `{"`, err: io.ErrUnexpectedEOF}, + {in: `{"k"`, err: io.EOF}, + {in: `{"k":`, err: io.EOF}, + {in: `{"k",`, err: &SyntaxError{"invalid character ',' after object key", int64(len(`{"k"`))}}, + {in: `{"k"}`, err: &SyntaxError{"invalid character '}' after object key", int64(len(`{"k"`))}}, + {in: ` [0`, err: io.EOF}, + {in: `[0.`, err: io.ErrUnexpectedEOF}, + {in: `[0. `, err: &SyntaxError{"invalid character ' ' in numeric literal", int64(len(`[0.`))}}, + {in: `[0,`, err: io.EOF}, + {in: `[0:`, err: &SyntaxError{"invalid character ':' after array element", int64(len(`[0`))}}, + {in: `n`, err: io.ErrUnexpectedEOF}, + {in: `nul`, err: io.ErrUnexpectedEOF}, + {in: `fal `, err: &SyntaxError{"invalid character ' ' in literal false (expecting 's')", int64(len(`fal`))}}, + {in: `false`, err: io.EOF}, + } + for _, tt := range tests { + d := NewDecoder(strings.NewReader(tt.in)) + for i := 0; true; i++ { + if _, err := d.Token(); err != nil { + if !reflect.DeepEqual(err, tt.err) { + t.Errorf("`%s`: %d.Token error = %#v, want %v", tt.in, i, err, tt.err) + } + break + } + } + } +} diff --git a/src/errors/join.go b/src/errors/join.go index dd50089c29..d0a1bc298e 100644 --- a/src/errors/join.go +++ b/src/errors/join.go @@ -28,12 +28,10 @@ func Join(errs ...error) error { } if n == 1 { for _, err := range errs { - if err != nil { - if _, ok := err.(interface { - Unwrap() []error - }); ok { - return err - } + if _, ok := err.(interface { + Unwrap() []error + }); ok { + return err } } } diff --git a/src/go/build/deps_test.go b/src/go/build/deps_test.go index d62f177b1a..faa6a27ea6 100644 --- a/src/go/build/deps_test.go +++ b/src/go/build/deps_test.go @@ -93,7 +93,8 @@ var depsRules = ` < internal/msan < internal/asan < internal/runtime/sys - < internal/runtime/syscall + < internal/runtime/syscall/linux + < internal/runtime/syscall/windows < internal/runtime/atomic < internal/runtime/exithook < internal/runtime/gc @@ -797,6 +798,7 @@ var depsRules = ` FMT < math/big/internal/asmgen; FMT, testing < internal/cgrouptest; + C, CGO < internal/runtime/cgobench; ` // listStdPkgs returns the same list of packages as "go list std". diff --git a/src/go/parser/parser.go b/src/go/parser/parser.go index 8a2f95976f..9ee1576a99 100644 --- a/src/go/parser/parser.go +++ b/src/go/parser/parser.go @@ -455,25 +455,6 @@ var exprEnd = map[token.Token]bool{ token.RBRACE: true, } -// safePos returns a valid file position for a given position: If pos -// is valid to begin with, safePos returns pos. If pos is out-of-range, -// safePos returns the EOF position. -// -// This is hack to work around "artificial" end positions in the AST which -// are computed by adding 1 to (presumably valid) token positions. If the -// token positions are invalid due to parse errors, the resulting end position -// may be past the file's EOF position, which would lead to panics if used -// later on. -func (p *parser) safePos(pos token.Pos) (res token.Pos) { - defer func() { - if recover() != nil { - res = token.Pos(p.file.Base() + p.file.Size()) // EOF position - } - }() - _ = p.file.Offset(pos) // trigger a panic if position is out-of-range - return pos -} - // ---------------------------------------------------------------------------- // Identifiers @@ -2022,7 +2003,7 @@ func (p *parser) parseCallExpr(callType string) *ast.CallExpr { } if _, isBad := x.(*ast.BadExpr); !isBad { // only report error if it's a new one - p.error(p.safePos(x.End()), fmt.Sprintf("expression in %s must be function call", callType)) + p.error(x.End(), fmt.Sprintf("expression in %s must be function call", callType)) } return nil } @@ -2100,7 +2081,7 @@ func (p *parser) makeExpr(s ast.Stmt, want string) ast.Expr { found = "assignment" } p.error(s.Pos(), fmt.Sprintf("expected %s, found %s (missing parentheses around composite literal?)", want, found)) - return &ast.BadExpr{From: s.Pos(), To: p.safePos(s.End())} + return &ast.BadExpr{From: s.Pos(), To: s.End()} } // parseIfHeader is an adjusted version of parser.header @@ -2423,7 +2404,7 @@ func (p *parser) parseForStmt() ast.Stmt { key, value = as.Lhs[0], as.Lhs[1] default: p.errorExpected(as.Lhs[len(as.Lhs)-1].Pos(), "at most 2 expressions") - return &ast.BadStmt{From: pos, To: p.safePos(body.End())} + return &ast.BadStmt{From: pos, To: body.End()} } // parseSimpleStmt returned a right-hand side that // is a single unary expression of the form "range x" diff --git a/src/go/types/alias.go b/src/go/types/alias.go index 3836ce9bb9..f15ff57030 100644 --- a/src/go/types/alias.go +++ b/src/go/types/alias.go @@ -8,7 +8,6 @@ package types import ( - "fmt" "go/token" ) @@ -53,7 +52,7 @@ type Alias struct { } // NewAlias creates a new Alias type with the given type name and rhs. -// rhs must not be nil. +// If rhs is nil, the alias is incomplete. func NewAlias(obj *TypeName, rhs Type) *Alias { alias := (*Checker)(nil).newAlias(obj, rhs) // Ensure that alias.actual is set (#65455). @@ -101,6 +100,7 @@ func (a *Alias) Rhs() Type { return a.fromRHS } // otherwise it follows t's alias chain until it // reaches a non-alias type which is then returned. // Consequently, the result is never an alias type. +// Returns nil if the alias is incomplete. func Unalias(t Type) Type { if a0, _ := t.(*Alias); a0 != nil { return unalias(a0) @@ -116,19 +116,10 @@ func unalias(a0 *Alias) Type { for a := a0; a != nil; a, _ = t.(*Alias) { t = a.fromRHS } - if t == nil { - panic(fmt.Sprintf("non-terminated alias %s", a0.obj.name)) - } - - // Memoize the type only if valid. - // In the presence of unfinished cyclic declarations, Unalias - // would otherwise latch the invalid value (#66704). - // TODO(adonovan): rethink, along with checker.typeDecl's use - // of Invalid to mark unfinished aliases. - if t != Typ[Invalid] { - a0.actual = t - } + // It's fine to memoize nil types since it's the zero value for actual. + // It accomplishes nothing. + a0.actual = t return t } @@ -140,9 +131,8 @@ func asNamed(t Type) *Named { } // newAlias creates a new Alias type with the given type name and rhs. -// rhs must not be nil. +// If rhs is nil, the alias is incomplete. func (check *Checker) newAlias(obj *TypeName, rhs Type) *Alias { - assert(rhs != nil) a := new(Alias) a.obj = obj a.orig = a @@ -175,12 +165,6 @@ func (check *Checker) newAliasInstance(pos token.Pos, orig *Alias, targs []Type, func (a *Alias) cleanup() { // Ensure a.actual is set before types are published, - // so Unalias is a pure "getter", not a "setter". - actual := Unalias(a) - - if actual == Typ[Invalid] { - // We don't set a.actual to Typ[Invalid] during type checking, - // as it may indicate that the RHS is not fully set up. - a.actual = actual - } + // so unalias is a pure "getter", not a "setter". + unalias(a) } diff --git a/src/go/types/alias_test.go b/src/go/types/alias_test.go new file mode 100644 index 0000000000..aa12336e21 --- /dev/null +++ b/src/go/types/alias_test.go @@ -0,0 +1,85 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package types_test + +import ( + "go/ast" + "go/parser" + "go/token" + "go/types" + "testing" +) + +func TestIssue74181(t *testing.T) { + t.Setenv("GODEBUG", "gotypesalias=1") + + src := `package p + +type AB = A[B] + +type _ struct { + _ AB +} + +type B struct { + f *AB +} + +type A[T any] struct{}` + + fset := token.NewFileSet() + file, err := parser.ParseFile(fset, "p.go", src, parser.ParseComments) + if err != nil { + t.Fatalf("could not parse: %v", err) + } + + conf := types.Config{} + pkg, err := conf.Check(file.Name.Name, fset, []*ast.File{file}, &types.Info{}) + if err != nil { + t.Fatalf("could not type check: %v", err) + } + + b := pkg.Scope().Lookup("B").Type() + if n, ok := b.(*types.Named); ok { + if s, ok := n.Underlying().(*types.Struct); ok { + got := s.Field(0).Type() + want := types.NewPointer(pkg.Scope().Lookup("AB").Type()) + if !types.Identical(got, want) { + t.Errorf("wrong type for f: got %v, want %v", got, want) + } + return + } + } + t.Errorf("unexpected type for B: %v", b) +} + +func TestPartialTypeCheckUndeclaredAliasPanic(t *testing.T) { + t.Setenv("GODEBUG", "gotypesalias=1") + + src := `package p + +type A = B // undeclared` + + fset := token.NewFileSet() + file, err := parser.ParseFile(fset, "p.go", src, parser.ParseComments) + if err != nil { + t.Fatalf("could not parse: %v", err) + } + + conf := types.Config{} // no error handler, panic + pkg, _ := conf.Check(file.Name.Name, fset, []*ast.File{file}, &types.Info{}) + a := pkg.Scope().Lookup("A").Type() + + if alias, ok := a.(*types.Alias); ok { + got := alias.Rhs() + want := types.Typ[types.Invalid] + + if !types.Identical(got, want) { + t.Errorf("wrong type for B: got %v, want %v", got, want) + } + return + } + t.Errorf("unexpected type for A: %v", a) +} diff --git a/src/go/types/api_test.go b/src/go/types/api_test.go index 4396b8ae89..f7a98ae280 100644 --- a/src/go/types/api_test.go +++ b/src/go/types/api_test.go @@ -3176,3 +3176,39 @@ func (recv T) f(param int) (result int) { t.Errorf("got:\n%s\nwant:\n%s", got, want) } } + +func TestIssue73871(t *testing.T) { + const src = `package p + +func f[T ~[]byte](y T) []byte { return append([]byte(nil), y...) } + +// for illustration only: +type B []byte +var _ = f[B] +` + fset := token.NewFileSet() + f, _ := parser.ParseFile(fset, "p.go", src, 0) + + pkg := NewPackage("p", "p") + info := &Info{Types: make(map[ast.Expr]TypeAndValue)} + check := NewChecker(&Config{}, fset, pkg, info) + if err := check.Files([]*ast.File{f}); err != nil { + t.Fatal(err) + } + + // Check type inferred for 'append'. + // + // Before the fix, the inferred type of append's y parameter + // was T. When a client such as x/tools/go/ssa instantiated T=B, + // it would result in the Signature "func([]byte, B)" with the + // variadic flag set, an invalid combination that caused + // NewSignatureType to panic. + append := f.Decls[0].(*ast.FuncDecl).Body.List[0].(*ast.ReturnStmt).Results[0].(*ast.CallExpr).Fun + tAppend := info.TypeOf(append).(*Signature) + want := "func([]byte, ...byte) []byte" + if got := fmt.Sprint(tAppend); got != want { + // Before the fix, tAppend was func([]byte, T) []byte, + // where T prints as "<expected string type>". + t.Errorf("for append, inferred type %s, want %s", tAppend, want) + } +} diff --git a/src/go/types/builtins.go b/src/go/types/builtins.go index d190212e05..e9f2b3e21d 100644 --- a/src/go/types/builtins.go +++ b/src/go/types/builtins.go @@ -94,22 +94,25 @@ func (check *Checker) builtin(x *operand, call *ast.CallExpr, id builtinId) (_ b // to type []byte with a second argument of string type followed by ... . // This form appends the bytes of the string." - // get special case out of the way + // Handle append(bytes, y...) special case, where + // the type set of y is {string} or {string, []byte}. var sig *Signature if nargs == 2 && hasDots(call) { if ok, _ := x.assignableTo(check, NewSlice(universeByte), nil); ok { y := args[1] + hasString := false typeset(y.typ, func(_, u Type) bool { if s, _ := u.(*Slice); s != nil && Identical(s.elem, universeByte) { return true } if isString(u) { + hasString = true return true } y = nil return false }) - if y != nil { + if y != nil && hasString { // setting the signature also signals that we're done sig = makeSig(x.typ, x.typ, y.typ) sig.variadic = true diff --git a/src/go/types/check_test.go b/src/go/types/check_test.go index 823525828a..44e4fd0104 100644 --- a/src/go/types/check_test.go +++ b/src/go/types/check_test.go @@ -426,12 +426,6 @@ func TestIssue47243_TypedRHS(t *testing.T) { } func TestCheck(t *testing.T) { - old := buildcfg.Experiment.RangeFunc - defer func() { - buildcfg.Experiment.RangeFunc = old - }() - buildcfg.Experiment.RangeFunc = true - DefPredeclaredTestFuncs() testDirFiles(t, "../../internal/types/testdata/check", false) } diff --git a/src/go/types/decl.go b/src/go/types/decl.go index 742191cc1c..f40a8e54b9 100644 --- a/src/go/types/decl.go +++ b/src/go/types/decl.go @@ -321,11 +321,15 @@ func (check *Checker) cycleError(cycle []Object, start int) { // If obj is a type alias, mark it as valid (not broken) in order to avoid follow-on errors. obj := cycle[start] tname, _ := obj.(*TypeName) - if tname != nil && tname.IsAlias() { - // If we use Alias nodes, it is initialized with Typ[Invalid]. - // TODO(gri) Adjust this code if we initialize with nil. - if !check.conf._EnableAlias { - check.validAlias(tname, Typ[Invalid]) + if tname != nil { + if check.conf._EnableAlias { + if a, ok := tname.Type().(*Alias); ok { + a.fromRHS = Typ[Invalid] + } + } else { + if tname.IsAlias() { + check.validAlias(tname, Typ[Invalid]) + } } } @@ -582,17 +586,18 @@ func (check *Checker) typeDecl(obj *TypeName, tdecl *ast.TypeSpec, def *TypeName } if check.conf._EnableAlias { - // TODO(gri) Should be able to use nil instead of Typ[Invalid] to mark - // the alias as incomplete. Currently this causes problems - // with certain cycles. Investigate. - // - // NOTE(adonovan): to avoid the Invalid being prematurely observed - // by (e.g.) a var whose type is an unfinished cycle, - // Unalias does not memoize if Invalid. Perhaps we should use a - // special sentinel distinct from Invalid. - alias := check.newAlias(obj, Typ[Invalid]) + alias := check.newAlias(obj, nil) setDefType(def, alias) + // If we could not type the RHS, set it to invalid. This should + // only ever happen if we panic before setting. + defer func() { + if alias.fromRHS == nil { + alias.fromRHS = Typ[Invalid] + unalias(alias) + } + }() + // handle type parameters even if not allowed (Alias type is supported) if tparam0 != nil { if !versionErr && !buildcfg.Experiment.AliasTypeParams { @@ -606,8 +611,9 @@ func (check *Checker) typeDecl(obj *TypeName, tdecl *ast.TypeSpec, def *TypeName rhs = check.definedType(tdecl.Type, obj) assert(rhs != nil) + alias.fromRHS = rhs - Unalias(alias) // resolve alias.actual + unalias(alias) // resolve alias.actual } else { // With Go1.23, the default behavior is to use Alias nodes, // reflected by check.enableAlias. Signal non-default behavior. diff --git a/src/go/types/expr.go b/src/go/types/expr.go index aa8543f081..97d8c42997 100644 --- a/src/go/types/expr.go +++ b/src/go/types/expr.go @@ -887,6 +887,10 @@ func (check *Checker) matchTypes(x, y *operand) { if isTyped(x.typ) && isTyped(y.typ) { return false } + // A numeric type can only convert to another numeric type. + if allNumeric(x.typ) != allNumeric(y.typ) { + return false + } // An untyped operand may convert to its default type when paired with an empty interface // TODO(gri) This should only matter for comparisons (the only binary operation that is // valid with interfaces), but in that case the assignability check should take diff --git a/src/go/types/named.go b/src/go/types/named.go index 1282abfa3f..72fd4970bb 100644 --- a/src/go/types/named.go +++ b/src/go/types/named.go @@ -130,8 +130,8 @@ type Named struct { // accessed. methods []*Func - // loader may be provided to lazily load type parameters, underlying type, and methods. - loader func(*Named) (tparams []*TypeParam, underlying Type, methods []*Func) + // loader may be provided to lazily load type parameters, underlying type, methods, and delayed functions + loader func(*Named) ([]*TypeParam, Type, []*Func, []func()) } // instance holds information that is only necessary for instantiated named @@ -146,9 +146,11 @@ type instance struct { // namedState represents the possible states that a named type may assume. type namedState uint32 +// Note: the order of states is relevant const ( unresolved namedState = iota // tparams, underlying type and methods might be unavailable - resolved // resolve has run; methods might be incomplete (for instances) + resolved // resolve has run; methods might be unexpanded (for instances) + loaded // loader has run; constraints might be unexpanded (for generic types) complete // all data is known ) @@ -170,7 +172,7 @@ func NewNamed(obj *TypeName, underlying Type, methods []*Func) *Named { // accessible; but if n is an instantiated type, its methods may still be // unexpanded. func (n *Named) resolve() *Named { - if n.state() >= resolved { // avoid locking below + if n.state() > unresolved { // avoid locking below return n } @@ -179,7 +181,7 @@ func (n *Named) resolve() *Named { n.mu.Lock() defer n.mu.Unlock() - if n.state() >= resolved { + if n.state() > unresolved { return n } @@ -215,13 +217,20 @@ func (n *Named) resolve() *Named { assert(n.underlying == nil) assert(n.TypeArgs().Len() == 0) // instances are created by instantiation, in which case n.loader is nil - tparams, underlying, methods := n.loader(n) + tparams, underlying, methods, delayed := n.loader(n) + n.loader = nil n.tparams = bindTParams(tparams) n.underlying = underlying n.fromRHS = underlying // for cycle detection n.methods = methods - n.loader = nil + + // advance state to avoid deadlock calling delayed functions + n.setState(loaded) + + for _, f := range delayed { + f() + } } n.setState(complete) diff --git a/src/go/types/object.go b/src/go/types/object.go index aa7dcb835c..823c03c7fd 100644 --- a/src/go/types/object.go +++ b/src/go/types/object.go @@ -296,7 +296,7 @@ func NewTypeName(pos token.Pos, pkg *Package, name string, typ Type) *TypeName { // NewTypeNameLazy returns a new defined type like NewTypeName, but it // lazily calls resolve to finish constructing the Named object. -func _NewTypeNameLazy(pos token.Pos, pkg *Package, name string, load func(named *Named) (tparams []*TypeParam, underlying Type, methods []*Func)) *TypeName { +func _NewTypeNameLazy(pos token.Pos, pkg *Package, name string, load func(*Named) ([]*TypeParam, Type, []*Func, []func())) *TypeName { obj := NewTypeName(pos, pkg, name, nil) NewNamed(obj, nil, nil).loader = load return obj diff --git a/src/go/types/range.go b/src/go/types/range.go index ed7d83283c..303d001c72 100644 --- a/src/go/types/range.go +++ b/src/go/types/range.go @@ -12,7 +12,6 @@ package types import ( "go/ast" "go/constant" - "internal/buildcfg" . "internal/types/errors" ) @@ -240,7 +239,7 @@ func rangeKeyVal(check *Checker, orig Type, allowVersion func(goVersion) bool) ( assert(typ.dir != SendOnly) return typ.elem, nil, "", true case *Signature: - if !buildcfg.Experiment.RangeFunc && allowVersion != nil && !allowVersion(go1_23) { + if allowVersion != nil && !allowVersion(go1_23) { return bad("requires go1.23 or later") } // check iterator arity diff --git a/src/hash/crc32/crc32_amd64.go b/src/hash/crc32/crc32_amd64.go index 6be129f5dd..105ce01a1e 100644 --- a/src/hash/crc32/crc32_amd64.go +++ b/src/hash/crc32/crc32_amd64.go @@ -13,6 +13,11 @@ import ( "unsafe" ) +// Offset into internal/cpu records for use in assembly. +const ( + offsetX86HasAVX512VPCLMULQDQL = unsafe.Offsetof(cpu.X86.HasAVX512VPCLMULQDQ) +) + // This file contains the code to call the SSE 4.2 version of the Castagnoli // and IEEE CRC. diff --git a/src/hash/crc32/crc32_amd64.s b/src/hash/crc32/crc32_amd64.s index 6af6c253a7..85d8b67a71 100644 --- a/src/hash/crc32/crc32_amd64.s +++ b/src/hash/crc32/crc32_amd64.s @@ -3,6 +3,7 @@ // license that can be found in the LICENSE file. #include "textflag.h" +#include "go_asm.h" // castagnoliSSE42 updates the (non-inverted) crc with the given buffer. // @@ -136,15 +137,23 @@ loop: // Linux kernel, since they avoid the costly // PSHUFB 16 byte reversal proposed in the // original Intel paper. +// Splatted so it can be loaded with a single VMOVDQU64 DATA r2r1<>+0(SB)/8, $0x154442bd4 DATA r2r1<>+8(SB)/8, $0x1c6e41596 +DATA r2r1<>+16(SB)/8, $0x154442bd4 +DATA r2r1<>+24(SB)/8, $0x1c6e41596 +DATA r2r1<>+32(SB)/8, $0x154442bd4 +DATA r2r1<>+40(SB)/8, $0x1c6e41596 +DATA r2r1<>+48(SB)/8, $0x154442bd4 +DATA r2r1<>+56(SB)/8, $0x1c6e41596 + DATA r4r3<>+0(SB)/8, $0x1751997d0 DATA r4r3<>+8(SB)/8, $0x0ccaa009e DATA rupoly<>+0(SB)/8, $0x1db710641 DATA rupoly<>+8(SB)/8, $0x1f7011641 DATA r5<>+0(SB)/8, $0x163cd6124 -GLOBL r2r1<>(SB),RODATA,$16 +GLOBL r2r1<>(SB), RODATA, $64 GLOBL r4r3<>(SB),RODATA,$16 GLOBL rupoly<>(SB),RODATA,$16 GLOBL r5<>(SB),RODATA,$8 @@ -158,6 +167,43 @@ TEXT ·ieeeCLMUL(SB),NOSPLIT,$0 MOVQ p+8(FP), SI // data pointer MOVQ p_len+16(FP), CX // len(p) + // Check feature support and length to be >= 1024 bytes. + CMPB internal∕cpu·X86+const_offsetX86HasAVX512VPCLMULQDQL(SB), $1 + JNE useSSE42 + CMPQ CX, $1024 + JL useSSE42 + + // Use AVX512. Zero upper and Z10 and load initial CRC into lower part of Z10. + VPXORQ Z10, Z10, Z10 + VMOVAPS X0, X10 + VMOVDQU64 (SI), Z1 + VPXORQ Z10, Z1, Z1 // Merge initial CRC value into Z1 + ADDQ $64, SI // buf+=64 + SUBQ $64, CX // len-=64 + + VMOVDQU64 r2r1<>+0(SB), Z0 + +loopback64Avx512: + VMOVDQU64 (SI), Z11 // Load next + VPCLMULQDQ $0x11, Z0, Z1, Z5 + VPCLMULQDQ $0, Z0, Z1, Z1 + VPTERNLOGD $0x96, Z11, Z5, Z1 // Combine results with xor into Z1 + + ADDQ $0x40, DI + ADDQ $64, SI // buf+=64 + SUBQ $64, CX // len-=64 + CMPQ CX, $64 // Less than 64 bytes left? + JGE loopback64Avx512 + + // Unfold result into XMM1-XMM4 to match SSE4 code. + VEXTRACTF32X4 $1, Z1, X2 // X2: Second 128-bit lane + VEXTRACTF32X4 $2, Z1, X3 // X3: Third 128-bit lane + VEXTRACTF32X4 $3, Z1, X4 // X4: Fourth 128-bit lane + VZEROUPPER + JMP remain64 + + PCALIGN $16 +useSSE42: MOVOU (SI), X1 MOVOU 16(SI), X2 MOVOU 32(SI), X3 @@ -207,6 +253,7 @@ loopback64: CMPQ CX, $64 // Less than 64 bytes left? JGE loopback64 + PCALIGN $16 /* Fold result into a single register (X1) */ remain64: MOVOA r4r3<>+0(SB), X0 diff --git a/src/hash/crc32/crc32_test.go b/src/hash/crc32/crc32_test.go index 40acd7da4f..eb5e73c394 100644 --- a/src/hash/crc32/crc32_test.go +++ b/src/hash/crc32/crc32_test.go @@ -11,6 +11,7 @@ import ( "internal/testhash" "io" "math/rand" + "strings" "testing" ) @@ -67,6 +68,8 @@ var golden = []test{ {0x8c79fd79, 0x297a88ed, "Even if I could be Shakespeare, I think I should still choose to be Faraday. - A. Huxley", "crc\x01ʇ\x91Ml+\xb8\xa7", "crc\x01wB\x84\x81\xbf\xd6S\xdd"}, {0xa20b7167, 0x66ed1d8b, "The fugacity of a constituent in a mixture of gases at a given temperature is proportional to its mole fraction. Lewis-Randall Rule", "crc\x01ʇ\x91M<lR[", "crc\x01wB\x84\x81{\xaco\xb1"}, {0x8e0bb443, 0xdcded527, "How can you write a big system without C++? -Paul Glick", "crc\x01ʇ\x91M\x0e\x88\x89\xed", "crc\x01wB\x84\x813\xd7C\u007f"}, + {0x1010dab0, 0x8a11661f, strings.Repeat("01234567", 1024), "crc\x01ʇ\x91M\x92\xe5\xba\xf3", "crc\x01wB\x84\x81\x1a\x02\x88Y"}, + {0x772d04d7, 0x5a6f5c45, strings.Repeat("a", 1024+65), "crc\x01ʇ\x91M\xe7Љ\xd1", "crc\x01wB\x84\x81\x95B\xa9("}, } // testGoldenIEEE verifies that the given function returns diff --git a/src/hash/maphash/maphash_runtime.go b/src/hash/maphash/maphash_runtime.go index 91e7d49e2c..36ac638071 100644 --- a/src/hash/maphash/maphash_runtime.go +++ b/src/hash/maphash/maphash_runtime.go @@ -9,7 +9,6 @@ package maphash import ( "internal/abi" "internal/goarch" - "internal/goexperiment" "unsafe" ) @@ -51,12 +50,7 @@ func comparableHash[T comparable](v T, seed Seed) uint64 { s := seed.s var m map[T]struct{} mTyp := abi.TypeOf(m) - var hasher func(unsafe.Pointer, uintptr) uintptr - if goexperiment.SwissMap { - hasher = (*abi.SwissMapType)(unsafe.Pointer(mTyp)).Hasher - } else { - hasher = (*abi.OldMapType)(unsafe.Pointer(mTyp)).Hasher - } + hasher := (*abi.MapType)(unsafe.Pointer(mTyp)).Hasher if goarch.PtrSize == 8 { return uint64(hasher(abi.NoEscape(unsafe.Pointer(&v)), uintptr(s))) } diff --git a/src/image/image.go b/src/image/image.go index f08182ba06..2cc94075b2 100644 --- a/src/image/image.go +++ b/src/image/image.go @@ -34,7 +34,9 @@ // regardless of whether the image is itself malformed or not. A call to // [DecodeConfig] which returns a header which does not match the image returned // by [Decode] may be considered a security issue, and should be reported per the -// [Go Security Policy](https://go.dev/security/policy). +// [Go Security Policy]. +// +// [Go Security Policy]: https://go.dev/security/policy package image import ( diff --git a/src/internal/abi/abi.go b/src/internal/abi/abi.go index e1c8adccc7..6026701659 100644 --- a/src/internal/abi/abi.go +++ b/src/internal/abi/abi.go @@ -98,5 +98,7 @@ func (b *IntArgRegBitmap) Set(i int) { // //go:nosplit func (b *IntArgRegBitmap) Get(i int) bool { - return b[i/8]&(uint8(1)<<(i%8)) != 0 + // Compute p=&b[i/8], but without a bounds check. We don't have the stack for it. + p := (*byte)(unsafe.Pointer(uintptr(unsafe.Pointer(b)) + uintptr(i/8))) + return *p&(uint8(1)<<(i%8)) != 0 } diff --git a/src/internal/abi/bounds.go b/src/internal/abi/bounds.go new file mode 100644 index 0000000000..d6859802d2 --- /dev/null +++ b/src/internal/abi/bounds.go @@ -0,0 +1,113 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package abi + +// This type and constants are for encoding different +// kinds of bounds check failures. +type BoundsErrorCode uint8 + +const ( + BoundsIndex BoundsErrorCode = iota // s[x], 0 <= x < len(s) failed + BoundsSliceAlen // s[?:x], 0 <= x <= len(s) failed + BoundsSliceAcap // s[?:x], 0 <= x <= cap(s) failed + BoundsSliceB // s[x:y], 0 <= x <= y failed (but boundsSliceA didn't happen) + BoundsSlice3Alen // s[?:?:x], 0 <= x <= len(s) failed + BoundsSlice3Acap // s[?:?:x], 0 <= x <= cap(s) failed + BoundsSlice3B // s[?:x:y], 0 <= x <= y failed (but boundsSlice3A didn't happen) + BoundsSlice3C // s[x:y:?], 0 <= x <= y failed (but boundsSlice3A/B didn't happen) + BoundsConvert // (*[x]T)(s), 0 <= x <= len(s) failed + numBoundsCodes +) + +const ( + BoundsMaxReg = 15 + BoundsMaxConst = 31 +) + +// Here's how we encode PCDATA_PanicBounds entries: + +// We allow 16 registers (0-15) and 32 constants (0-31). +// Encode the following constant c: +// bits use +// ----------------------------- +// 0 x is in a register +// 1 y is in a register +// +// if x is in a register +// 2 x is signed +// [3:6] x's register number +// else +// [2:6] x's constant value +// +// if y is in a register +// [7:10] y's register number +// else +// [7:11] y's constant value +// +// The final integer is c * numBoundsCode + code + +// TODO: 32-bit + +// Encode bounds failure information into an integer for PCDATA_PanicBounds. +// Register numbers must be in 0-15. Constants must be in 0-31. +func BoundsEncode(code BoundsErrorCode, signed, xIsReg, yIsReg bool, xVal, yVal int) int { + c := int(0) + if xIsReg { + c |= 1 << 0 + if signed { + c |= 1 << 2 + } + if xVal < 0 || xVal > BoundsMaxReg { + panic("bad xReg") + } + c |= xVal << 3 + } else { + if xVal < 0 || xVal > BoundsMaxConst { + panic("bad xConst") + } + c |= xVal << 2 + } + if yIsReg { + c |= 1 << 1 + if yVal < 0 || yVal > BoundsMaxReg { + panic("bad yReg") + } + c |= yVal << 7 + } else { + if yVal < 0 || yVal > BoundsMaxConst { + panic("bad yConst") + } + c |= yVal << 7 + } + return c*int(numBoundsCodes) + int(code) +} +func BoundsDecode(v int) (code BoundsErrorCode, signed, xIsReg, yIsReg bool, xVal, yVal int) { + code = BoundsErrorCode(v % int(numBoundsCodes)) + c := v / int(numBoundsCodes) + xIsReg = c&1 != 0 + c >>= 1 + yIsReg = c&1 != 0 + c >>= 1 + if xIsReg { + signed = c&1 != 0 + c >>= 1 + xVal = c & 0xf + c >>= 4 + } else { + xVal = c & 0x1f + c >>= 5 + } + if yIsReg { + yVal = c & 0xf + c >>= 4 + } else { + yVal = c & 0x1f + c >>= 5 + } + if c != 0 { + panic("BoundsDecode decoding error") + } + return +} diff --git a/src/internal/abi/map_swiss.go b/src/internal/abi/map.go index 6c855667e3..4476dda5ca 100644 --- a/src/internal/abi/map_swiss.go +++ b/src/internal/abi/map.go @@ -12,24 +12,24 @@ import ( // runtime/runtime-gdb.py:MapTypePrinter contains its own copy const ( // Number of bits in the group.slot count. - SwissMapGroupSlotsBits = 3 + MapGroupSlotsBits = 3 // Number of slots in a group. - SwissMapGroupSlots = 1 << SwissMapGroupSlotsBits // 8 + MapGroupSlots = 1 << MapGroupSlotsBits // 8 // Maximum key or elem size to keep inline (instead of mallocing per element). // Must fit in a uint8. - SwissMapMaxKeyBytes = 128 - SwissMapMaxElemBytes = 128 + MapMaxKeyBytes = 128 + MapMaxElemBytes = 128 ctrlEmpty = 0b10000000 bitsetLSB = 0x0101010101010101 // Value of control word with all empty slots. - SwissMapCtrlEmpty = bitsetLSB * uint64(ctrlEmpty) + MapCtrlEmpty = bitsetLSB * uint64(ctrlEmpty) ) -type SwissMapType struct { +type MapType struct { Type Key *Type Elem *Type @@ -44,21 +44,21 @@ type SwissMapType struct { // Flag values const ( - SwissMapNeedKeyUpdate = 1 << iota - SwissMapHashMightPanic - SwissMapIndirectKey - SwissMapIndirectElem + MapNeedKeyUpdate = 1 << iota + MapHashMightPanic + MapIndirectKey + MapIndirectElem ) -func (mt *SwissMapType) NeedKeyUpdate() bool { // true if we need to update key on an overwrite - return mt.Flags&SwissMapNeedKeyUpdate != 0 +func (mt *MapType) NeedKeyUpdate() bool { // true if we need to update key on an overwrite + return mt.Flags&MapNeedKeyUpdate != 0 } -func (mt *SwissMapType) HashMightPanic() bool { // true if hash function might panic - return mt.Flags&SwissMapHashMightPanic != 0 +func (mt *MapType) HashMightPanic() bool { // true if hash function might panic + return mt.Flags&MapHashMightPanic != 0 } -func (mt *SwissMapType) IndirectKey() bool { // store ptr to key instead of key itself - return mt.Flags&SwissMapIndirectKey != 0 +func (mt *MapType) IndirectKey() bool { // store ptr to key instead of key itself + return mt.Flags&MapIndirectKey != 0 } -func (mt *SwissMapType) IndirectElem() bool { // store ptr to elem instead of elem itself - return mt.Flags&SwissMapIndirectElem != 0 +func (mt *MapType) IndirectElem() bool { // store ptr to elem instead of elem itself + return mt.Flags&MapIndirectElem != 0 } diff --git a/src/internal/abi/map_noswiss.go b/src/internal/abi/map_noswiss.go deleted file mode 100644 index ff8609efcf..0000000000 --- a/src/internal/abi/map_noswiss.go +++ /dev/null @@ -1,54 +0,0 @@ -// Copyright 2023 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package abi - -import ( - "unsafe" -) - -// Map constants common to several packages -// runtime/runtime-gdb.py:MapTypePrinter contains its own copy -const ( - // Maximum number of key/elem pairs a bucket can hold. - OldMapBucketCountBits = 3 // log2 of number of elements in a bucket. - OldMapBucketCount = 1 << OldMapBucketCountBits - - // Maximum key or elem size to keep inline (instead of mallocing per element). - // Must fit in a uint8. - // Note: fast map functions cannot handle big elems (bigger than MapMaxElemBytes). - OldMapMaxKeyBytes = 128 - OldMapMaxElemBytes = 128 // Must fit in a uint8. -) - -type OldMapType struct { - Type - Key *Type - Elem *Type - Bucket *Type // internal type representing a hash bucket - // function for hashing keys (ptr to key, seed) -> hash - Hasher func(unsafe.Pointer, uintptr) uintptr - KeySize uint8 // size of key slot - ValueSize uint8 // size of elem slot - BucketSize uint16 // size of bucket - Flags uint32 -} - -// Note: flag values must match those used in the TMAP case -// in ../cmd/compile/internal/reflectdata/reflect.go:writeType. -func (mt *OldMapType) IndirectKey() bool { // store ptr to key instead of key itself - return mt.Flags&1 != 0 -} -func (mt *OldMapType) IndirectElem() bool { // store ptr to elem instead of elem itself - return mt.Flags&2 != 0 -} -func (mt *OldMapType) ReflexiveKey() bool { // true if k==k for all keys - return mt.Flags&4 != 0 -} -func (mt *OldMapType) NeedKeyUpdate() bool { // true if we need to update key on an overwrite - return mt.Flags&8 != 0 -} -func (mt *OldMapType) HashMightPanic() bool { // true if hash function might panic - return mt.Flags&16 != 0 -} diff --git a/src/internal/abi/map_select_noswiss.go b/src/internal/abi/map_select_noswiss.go deleted file mode 100644 index ab2b69de7e..0000000000 --- a/src/internal/abi/map_select_noswiss.go +++ /dev/null @@ -1,10 +0,0 @@ -// Copyright 2023 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -package abi - -// See comment in map_select_swiss.go. -type mapType = OldMapType diff --git a/src/internal/abi/map_select_swiss.go b/src/internal/abi/map_select_swiss.go deleted file mode 100644 index 88a0bb2ebb..0000000000 --- a/src/internal/abi/map_select_swiss.go +++ /dev/null @@ -1,22 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build goexperiment.swissmap - -package abi - -// Select the map type that this binary is built using. This is for common -// lookup methods like Type.Key to know which type to use. -// -// Note that mapType *must not be used by any functions called in the -// compiler to build a target program* because the compiler must use the map -// type determined by run-time GOEXPERIMENT, not the build tags used to build -// the compiler. -// -// TODO(prattmic): This package is rather confusing because it has many -// functions that can't be used by the compiler (e.g., Type.Uncommon depends on -// the layout of type + uncommon objects in the binary. It would be incorrect -// for an ad-hoc local Type object). It may be best to move code that isn't -// usable by the compiler out of the package. -type mapType = SwissMapType diff --git a/src/internal/abi/symtab.go b/src/internal/abi/symtab.go index ce322f2d75..86d6700388 100644 --- a/src/internal/abi/symtab.go +++ b/src/internal/abi/symtab.go @@ -79,6 +79,7 @@ const ( PCDATA_StackMapIndex = 1 PCDATA_InlTreeIndex = 2 PCDATA_ArgLiveIndex = 3 + PCDATA_PanicBounds = 4 FUNCDATA_ArgsPointerMaps = 0 FUNCDATA_LocalsPointerMaps = 1 diff --git a/src/internal/abi/type.go b/src/internal/abi/type.go index 786fb9cd66..1920a8a37f 100644 --- a/src/internal/abi/type.go +++ b/src/internal/abi/type.go @@ -24,7 +24,7 @@ type Type struct { TFlag TFlag // extra type information flags Align_ uint8 // alignment of variable with this type FieldAlign_ uint8 // alignment of struct field with this type - Kind_ Kind // enumeration for C + Kind_ Kind // what kind of type this is (string, int, ...) // function for comparing objects of this type // (ptr to object A, ptr to object B) -> ==? Equal func(unsafe.Pointer, unsafe.Pointer) bool @@ -78,12 +78,6 @@ const ( UnsafePointer ) -const ( - // TODO (khr, drchase) why aren't these in TFlag? Investigate, fix if possible. - KindDirectIface Kind = 1 << 5 - KindMask Kind = (1 << 5) - 1 -) - // TFlag is used by a Type to signal what extra type information is // available in the memory directly following the Type value. type TFlag uint8 @@ -125,6 +119,15 @@ const ( // has type **byte instead of *byte. The runtime will store a // pointer to the GC pointer bitmask in *GCData. TFlagGCMaskOnDemand TFlag = 1 << 4 + + // TFlagDirectIface means that a value of this type is stored directly + // in the data field of an interface, instead of indirectly. Normally + // this means the type is pointer-ish. + TFlagDirectIface TFlag = 1 << 5 + + // Leaving this breadcrumb behind for dlv. It should not be used, and no + // Kind should be big enough to set this bit. + KindDirectIface Kind = 1 << 5 ) // NameOff is the offset to a name from moduledata.types. See resolveNameOff in runtime. @@ -190,7 +193,7 @@ func TypeFor[T any]() *Type { return (*PtrType)(unsafe.Pointer(TypeOf((*T)(nil)))).Elem } -func (t *Type) Kind() Kind { return t.Kind_ & KindMask } +func (t *Type) Kind() Kind { return t.Kind_ } func (t *Type) HasName() bool { return t.TFlag&TFlagNamed != 0 @@ -199,14 +202,9 @@ func (t *Type) HasName() bool { // Pointers reports whether t contains pointers. func (t *Type) Pointers() bool { return t.PtrBytes != 0 } -// IfaceIndir reports whether t is stored indirectly in an interface value. -func (t *Type) IfaceIndir() bool { - return t.Kind_&KindDirectIface == 0 -} - -// isDirectIface reports whether t is stored directly in an interface value. +// IsDirectIface reports whether t is stored directly in an interface value. func (t *Type) IsDirectIface() bool { - return t.Kind_&KindDirectIface != 0 + return t.TFlag&TFlagDirectIface != 0 } func (t *Type) GcSlice(begin, end uintptr) []byte { @@ -357,7 +355,7 @@ func (t *Type) Uncommon() *UncommonType { return &(*u)(unsafe.Pointer(t)).u case Map: type u struct { - mapType + MapType u UncommonType } return &(*u)(unsafe.Pointer(t)).u @@ -386,7 +384,7 @@ func (t *Type) Elem() *Type { tt := (*ChanType)(unsafe.Pointer(t)) return tt.Elem case Map: - tt := (*mapType)(unsafe.Pointer(t)) + tt := (*MapType)(unsafe.Pointer(t)) return tt.Elem case Pointer: tt := (*PtrType)(unsafe.Pointer(t)) @@ -406,12 +404,12 @@ func (t *Type) StructType() *StructType { return (*StructType)(unsafe.Pointer(t)) } -// MapType returns t cast to a *OldMapType or *SwissMapType, or nil if its tag does not match. -func (t *Type) MapType() *mapType { +// MapType returns t cast to a *MapType, or nil if its tag does not match. +func (t *Type) MapType() *MapType { if t.Kind() != Map { return nil } - return (*mapType)(unsafe.Pointer(t)) + return (*MapType)(unsafe.Pointer(t)) } // ArrayType returns t cast to a *ArrayType, or nil if its tag does not match. @@ -473,7 +471,7 @@ func (t *InterfaceType) NumMethod() int { return len(t.Methods) } func (t *Type) Key() *Type { if t.Kind() == Map { - return (*mapType)(unsafe.Pointer(t)).Key + return (*MapType)(unsafe.Pointer(t)).Key } return nil } diff --git a/src/internal/buildcfg/cfg.go b/src/internal/buildcfg/cfg.go index 5ae4c0c7ad..7e4ee365df 100644 --- a/src/internal/buildcfg/cfg.go +++ b/src/internal/buildcfg/cfg.go @@ -392,6 +392,8 @@ func GOGOARCH() (name, value string) { return "GOMIPS64", GOMIPS64 case "ppc64", "ppc64le": return "GOPPC64", fmt.Sprintf("power%d", GOPPC64) + case "riscv64": + return "GORISCV64", fmt.Sprintf("rva%du64", GORISCV64) case "wasm": return "GOWASM", GOWASM.String() } diff --git a/src/internal/buildcfg/exp.go b/src/internal/buildcfg/exp.go index 4c30ff1045..9199b7906f 100644 --- a/src/internal/buildcfg/exp.go +++ b/src/internal/buildcfg/exp.go @@ -82,8 +82,6 @@ func ParseGOEXPERIMENT(goos, goarch, goexp string) (*ExperimentFlags, error) { RegabiWrappers: regabiSupported, RegabiArgs: regabiSupported, AliasTypeParams: true, - SwissMap: true, - SyncHashTrieMap: true, SIMD: goarch == "amd64", // TODO remove this (default to false) when dev.simd is merged Dwarf5: dwarf5Supported, } diff --git a/src/internal/cgrouptest/cgrouptest_linux.go b/src/internal/cgrouptest/cgrouptest_linux.go index f23c37a705..8437f992f7 100644 --- a/src/internal/cgrouptest/cgrouptest_linux.go +++ b/src/internal/cgrouptest/cgrouptest_linux.go @@ -114,7 +114,7 @@ func findCurrent(t *testing.T) (string, string) { if ver != cgroup.V2 { t.Skipf("cgroup: running on cgroup v%d want v2", ver) } - rel := string(buf[1:n]) // The returned path always starts with /, skip it. + rel := string(buf[1:n]) // The returned path always starts with /, skip it. rel = filepath.Join(".", rel) // Make sure this isn't empty string at root. return mount, rel } diff --git a/src/internal/coverage/pkid.go b/src/internal/coverage/pkid.go index 30b5ad49ac..09501e6bd2 100644 --- a/src/internal/coverage/pkid.go +++ b/src/internal/coverage/pkid.go @@ -31,7 +31,7 @@ package coverage // slot: 6 path='internal/runtime/math' hard-coded id: 6 // slot: 7 path='internal/bytealg' hard-coded id: 7 // slot: 8 path='internal/goexperiment' -// slot: 9 path='internal/runtime/syscall' hard-coded id: 8 +// slot: 9 path='internal/runtime/syscall/linux' hard-coded id: 8 // slot: 10 path='runtime' hard-coded id: 9 // fatal error: runtime.addCovMeta // @@ -66,7 +66,8 @@ var rtPkgs = [...]string{ "internal/runtime/strconv", "internal/runtime/sys", "internal/runtime/maps", - "internal/runtime/syscall", + "internal/runtime/syscall/linux", + "internal/runtime/syscall/windows", "internal/runtime/cgroup", "internal/stringslite", "runtime", diff --git a/src/internal/cpu/cpu.go b/src/internal/cpu/cpu.go index 53633c7ca8..71b654549a 100644 --- a/src/internal/cpu/cpu.go +++ b/src/internal/cpu/cpu.go @@ -26,39 +26,40 @@ var CacheLineSize uintptr = CacheLinePadSize // in addition to the cpuid feature bit being set. // The struct is padded to avoid false sharing. var X86 struct { - _ CacheLinePad - HasAES bool - HasADX bool - HasAVX bool - HasAVXVNNI bool - HasAVX2 bool - HasAVX512 bool // Virtual feature: F+CD+BW+DQ+VL - HasAVX512F bool - HasAVX512CD bool - HasAVX512BW bool - HasAVX512DQ bool - HasAVX512VL bool - HasAVX512GFNI bool - HasAVX512VNNI bool - HasAVX512VBMI bool - HasAVX512VBMI2 bool - HasAVX512BITALG bool - HasAVX512VPOPCNTDQ bool - HasBMI1 bool - HasBMI2 bool - HasERMS bool - HasFSRM bool - HasFMA bool - HasOSXSAVE bool - HasPCLMULQDQ bool - HasPOPCNT bool - HasRDTSCP bool - HasSHA bool - HasSSE3 bool - HasSSSE3 bool - HasSSE41 bool - HasSSE42 bool - _ CacheLinePad + _ CacheLinePad + HasAES bool + HasADX bool + HasAVX bool + HasAVXVNNI bool + HasAVX2 bool + HasAVX512 bool // Virtual feature: F+CD+BW+DQ+VL + HasAVX512F bool + HasAVX512CD bool + HasAVX512BW bool + HasAVX512DQ bool + HasAVX512VL bool + HasAVX512GFNI bool + HasAVX512VNNI bool + HasAVX512VBMI bool + HasAVX512VBMI2 bool + HasAVX512BITALG bool + HasAVX512VPOPCNTDQ bool + HasAVX512VPCLMULQDQ bool + HasBMI1 bool + HasBMI2 bool + HasERMS bool + HasFSRM bool + HasFMA bool + HasOSXSAVE bool + HasPCLMULQDQ bool + HasPOPCNT bool + HasRDTSCP bool + HasSHA bool + HasSSE3 bool + HasSSSE3 bool + HasSSE41 bool + HasSSE42 bool + _ CacheLinePad } // The booleans in ARM contain the correspondingly named cpu feature bit. diff --git a/src/internal/cpu/cpu_x86.go b/src/internal/cpu/cpu_x86.go index 04d89955da..76742706b5 100644 --- a/src/internal/cpu/cpu_x86.go +++ b/src/internal/cpu/cpu_x86.go @@ -51,6 +51,10 @@ const ( cpuid_SHA = 1 << 29 cpuid_AVX512BW = 1 << 30 cpuid_AVX512VL = 1 << 31 + + // ecx bits + cpuid_AVX512VPCLMULQDQ = 1 << 10 + // edx bits cpuid_FSRM = 1 << 4 // edx bits for CPUID 0x80000001 @@ -68,6 +72,7 @@ func doinit() { {Name: "pclmulqdq", Feature: &X86.HasPCLMULQDQ}, {Name: "rdtscp", Feature: &X86.HasRDTSCP}, {Name: "sha", Feature: &X86.HasSHA}, + {Name: "vpclmulqdq", Feature: &X86.HasAVX512VPCLMULQDQ}, } level := getGOAMD64level() if level < 2 { @@ -172,6 +177,7 @@ func doinit() { X86.HasAVX512VBMI = isSet(ecx7, cpuid_AVX512VBMI) X86.HasAVX512VBMI2 = isSet(ecx7, cpuid_AVX512VBMI2) X86.HasAVX512VNNI = isSet(ecx7, cpuid_AVX512VNNI) + X86.HasAVX512VPCLMULQDQ = isSet(ecx7, cpuid_AVX512VPCLMULQDQ) } X86.HasFSRM = isSet(edx7, cpuid_FSRM) diff --git a/src/internal/goexperiment/exp_cacheprog_off.go b/src/internal/goexperiment/exp_cacheprog_off.go deleted file mode 100644 index 276855c7d6..0000000000 --- a/src/internal/goexperiment/exp_cacheprog_off.go +++ /dev/null @@ -1,8 +0,0 @@ -// Code generated by mkconsts.go. DO NOT EDIT. - -//go:build !goexperiment.cacheprog - -package goexperiment - -const CacheProg = false -const CacheProgInt = 0 diff --git a/src/internal/goexperiment/exp_cacheprog_on.go b/src/internal/goexperiment/exp_cacheprog_on.go deleted file mode 100644 index b959dd68b9..0000000000 --- a/src/internal/goexperiment/exp_cacheprog_on.go +++ /dev/null @@ -1,8 +0,0 @@ -// Code generated by mkconsts.go. DO NOT EDIT. - -//go:build goexperiment.cacheprog - -package goexperiment - -const CacheProg = true -const CacheProgInt = 1 diff --git a/src/internal/goexperiment/exp_randomizedheapbase64_off.go b/src/internal/goexperiment/exp_randomizedheapbase64_off.go new file mode 100644 index 0000000000..0a578535a4 --- /dev/null +++ b/src/internal/goexperiment/exp_randomizedheapbase64_off.go @@ -0,0 +1,8 @@ +// Code generated by mkconsts.go. DO NOT EDIT. + +//go:build !goexperiment.randomizedheapbase64 + +package goexperiment + +const RandomizedHeapBase64 = false +const RandomizedHeapBase64Int = 0 diff --git a/src/internal/goexperiment/exp_randomizedheapbase64_on.go b/src/internal/goexperiment/exp_randomizedheapbase64_on.go new file mode 100644 index 0000000000..10d59c7028 --- /dev/null +++ b/src/internal/goexperiment/exp_randomizedheapbase64_on.go @@ -0,0 +1,8 @@ +// Code generated by mkconsts.go. DO NOT EDIT. + +//go:build goexperiment.randomizedheapbase64 + +package goexperiment + +const RandomizedHeapBase64 = true +const RandomizedHeapBase64Int = 1 diff --git a/src/internal/goexperiment/exp_rangefunc_off.go b/src/internal/goexperiment/exp_rangefunc_off.go deleted file mode 100644 index fc028205db..0000000000 --- a/src/internal/goexperiment/exp_rangefunc_off.go +++ /dev/null @@ -1,8 +0,0 @@ -// Code generated by mkconsts.go. DO NOT EDIT. - -//go:build !goexperiment.rangefunc - -package goexperiment - -const RangeFunc = false -const RangeFuncInt = 0 diff --git a/src/internal/goexperiment/exp_rangefunc_on.go b/src/internal/goexperiment/exp_rangefunc_on.go deleted file mode 100644 index 25e7bd361b..0000000000 --- a/src/internal/goexperiment/exp_rangefunc_on.go +++ /dev/null @@ -1,8 +0,0 @@ -// Code generated by mkconsts.go. DO NOT EDIT. - -//go:build goexperiment.rangefunc - -package goexperiment - -const RangeFunc = true -const RangeFuncInt = 1 diff --git a/src/internal/goexperiment/exp_swissmap_off.go b/src/internal/goexperiment/exp_swissmap_off.go deleted file mode 100644 index 2af40aa60b..0000000000 --- a/src/internal/goexperiment/exp_swissmap_off.go +++ /dev/null @@ -1,8 +0,0 @@ -// Code generated by mkconsts.go. DO NOT EDIT. - -//go:build !goexperiment.swissmap - -package goexperiment - -const SwissMap = false -const SwissMapInt = 0 diff --git a/src/internal/goexperiment/exp_swissmap_on.go b/src/internal/goexperiment/exp_swissmap_on.go deleted file mode 100644 index 73be49b606..0000000000 --- a/src/internal/goexperiment/exp_swissmap_on.go +++ /dev/null @@ -1,8 +0,0 @@ -// Code generated by mkconsts.go. DO NOT EDIT. - -//go:build goexperiment.swissmap - -package goexperiment - -const SwissMap = true -const SwissMapInt = 1 diff --git a/src/internal/goexperiment/exp_synchashtriemap_off.go b/src/internal/goexperiment/exp_synchashtriemap_off.go deleted file mode 100644 index cab23aac1d..0000000000 --- a/src/internal/goexperiment/exp_synchashtriemap_off.go +++ /dev/null @@ -1,8 +0,0 @@ -// Code generated by mkconsts.go. DO NOT EDIT. - -//go:build !goexperiment.synchashtriemap - -package goexperiment - -const SyncHashTrieMap = false -const SyncHashTrieMapInt = 0 diff --git a/src/internal/goexperiment/exp_synchashtriemap_on.go b/src/internal/goexperiment/exp_synchashtriemap_on.go deleted file mode 100644 index 87433ef4de..0000000000 --- a/src/internal/goexperiment/exp_synchashtriemap_on.go +++ /dev/null @@ -1,8 +0,0 @@ -// Code generated by mkconsts.go. DO NOT EDIT. - -//go:build goexperiment.synchashtriemap - -package goexperiment - -const SyncHashTrieMap = true -const SyncHashTrieMapInt = 1 diff --git a/src/internal/goexperiment/flags.go b/src/internal/goexperiment/flags.go index 09349357a7..e24e3f1ff1 100644 --- a/src/internal/goexperiment/flags.go +++ b/src/internal/goexperiment/flags.go @@ -96,28 +96,15 @@ type Flags struct { // copy of the iteration variable. LoopVar bool - // CacheProg adds support to cmd/go to use a child process to implement - // the build cache; see https://github.com/golang/go/issues/59719. - CacheProg bool - // NewInliner enables a new+improved version of the function // inlining phase within the Go compiler. NewInliner bool - // RangeFunc enables range over func. - RangeFunc bool - // AliasTypeParams enables type parameters for alias types. // Requires that gotypesalias=1 is set with GODEBUG. // This flag will be removed with Go 1.25. AliasTypeParams bool - // SwissMap enables the SwissTable-based map implementation. - SwissMap bool - - // SyncHashTrieMap enables the HashTrieMap sync.Map implementation. - SyncHashTrieMap bool - // Synctest enables the testing/synctest package. Synctest bool @@ -130,6 +117,10 @@ type Flags struct { // GreenTeaGC enables the Green Tea GC implementation. GreenTeaGC bool + // RandomizedHeapBase enables heap base address randomization on 64-bit + // platforms. + RandomizedHeapBase64 bool + // SIMD enables the simd package and the compiler's handling // of SIMD intrinsics. SIMD bool diff --git a/src/internal/goversion/goversion.go b/src/internal/goversion/goversion.go index 18703a64ea..d8bfe7e085 100644 --- a/src/internal/goversion/goversion.go +++ b/src/internal/goversion/goversion.go @@ -9,4 +9,4 @@ package goversion // // It should be updated at the start of each development cycle to be // the version of the next Go 1.x release. See go.dev/issue/40705. -const Version = 25 +const Version = 26 diff --git a/src/internal/poll/fd_windows.go b/src/internal/poll/fd_windows.go index acc2ab0c6e..1748e5ef5a 100644 --- a/src/internal/poll/fd_windows.go +++ b/src/internal/poll/fd_windows.go @@ -77,16 +77,9 @@ type operation struct { mode int32 // fields used only by net package - fd *FD - buf syscall.WSABuf - msg windows.WSAMsg - sa syscall.Sockaddr - rsa *syscall.RawSockaddrAny - rsan int32 - handle syscall.Handle - flags uint32 - qty uint32 - bufs []syscall.WSABuf + buf syscall.WSABuf + rsa *syscall.RawSockaddrAny + bufs []syscall.WSABuf } func (o *operation) setEvent() { @@ -105,8 +98,8 @@ func (o *operation) close() { } } -func (o *operation) overlapped() *syscall.Overlapped { - if o.fd.isBlocking { +func (fd *FD) overlapped(o *operation) *syscall.Overlapped { + if fd.isBlocking { // Don't return the overlapped object if the file handle // doesn't use overlapped I/O. It could be used, but // that would then use the file pointer stored in the @@ -118,10 +111,7 @@ func (o *operation) overlapped() *syscall.Overlapped { func (o *operation) InitBuf(buf []byte) { o.buf.Len = uint32(len(buf)) - o.buf.Buf = nil - if len(buf) != 0 { - o.buf.Buf = &buf[0] - } + o.buf.Buf = unsafe.SliceData(buf) } func (o *operation) InitBufs(buf *[][]byte) { @@ -154,28 +144,26 @@ func (o *operation) ClearBufs() { o.bufs = o.bufs[:0] } -func (o *operation) InitMsg(p []byte, oob []byte) { - o.InitBuf(p) - o.msg.Buffers = &o.buf - o.msg.BufferCount = 1 - - o.msg.Name = nil - o.msg.Namelen = 0 - - o.msg.Flags = 0 - o.msg.Control.Len = uint32(len(oob)) - o.msg.Control.Buf = nil - if len(oob) != 0 { - o.msg.Control.Buf = &oob[0] +func newWSAMsg(p []byte, oob []byte, flags int) windows.WSAMsg { + return windows.WSAMsg{ + Buffers: &syscall.WSABuf{ + Len: uint32(len(p)), + Buf: unsafe.SliceData(p), + }, + BufferCount: 1, + Control: syscall.WSABuf{ + Len: uint32(len(oob)), + Buf: unsafe.SliceData(oob), + }, + Flags: uint32(flags), } } // waitIO waits for the IO operation o to complete. -func waitIO(o *operation) error { - if o.fd.isBlocking { +func (fd *FD) waitIO(o *operation) error { + if fd.isBlocking { panic("can't wait on blocking operations") } - fd := o.fd if !fd.pollable() { // The overlapped handle is not added to the runtime poller, // the only way to wait for the IO to complete is block until @@ -195,8 +183,7 @@ func waitIO(o *operation) error { } // cancelIO cancels the IO operation o and waits for it to complete. -func cancelIO(o *operation) { - fd := o.fd +func (fd *FD) cancelIO(o *operation) { if !fd.pollable() { return } @@ -214,8 +201,7 @@ func cancelIO(o *operation) { // It supports both synchronous and asynchronous IO. // o.qty and o.flags are set to zero before calling submit // to avoid reusing the values from a previous call. -func execIO(o *operation, submit func(o *operation) error) (int, error) { - fd := o.fd +func (fd *FD) execIO(o *operation, submit func(o *operation) (uint32, error)) (int, error) { // Notify runtime netpoll about starting IO. err := fd.pd.prepare(int(o.mode), fd.isFile) if err != nil { @@ -228,26 +214,25 @@ func execIO(o *operation, submit func(o *operation) error) (int, error) { // event to wait for the IO to complete. o.setEvent() } - o.qty = 0 - o.flags = 0 - err = submit(o) + qty, err := submit(o) var waitErr error // Blocking operations shouldn't return ERROR_IO_PENDING. // Continue without waiting if that happens. - if !o.fd.isBlocking && (err == syscall.ERROR_IO_PENDING || (err == nil && !o.fd.skipSyncNotif)) { + if !fd.isBlocking && (err == syscall.ERROR_IO_PENDING || (err == nil && !fd.skipSyncNotif)) { // IO started asynchronously or completed synchronously but // a sync notification is required. Wait for it to complete. - waitErr = waitIO(o) + waitErr = fd.waitIO(o) if waitErr != nil { // IO interrupted by "close" or "timeout". - cancelIO(o) + fd.cancelIO(o) // We issued a cancellation request, but the IO operation may still succeeded // before the cancellation request runs. } if fd.isFile { - err = windows.GetOverlappedResult(fd.Sysfd, &o.o, &o.qty, false) + err = windows.GetOverlappedResult(fd.Sysfd, &o.o, &qty, false) } else { - err = windows.WSAGetOverlappedResult(fd.Sysfd, &o.o, &o.qty, false, &o.flags) + var flags uint32 + err = windows.WSAGetOverlappedResult(fd.Sysfd, &o.o, &qty, false, &flags) } } switch err { @@ -271,7 +256,7 @@ func execIO(o *operation, submit func(o *operation) error) (int, error) { err = waitErr } } - return int(o.qty), err + return int(qty), err } // FD is a file descriptor. The net and os packages embed this type in @@ -399,8 +384,6 @@ func (fd *FD) Init(net string, pollable bool) error { fd.isBlocking = !pollable fd.rop.mode = 'r' fd.wop.mode = 'w' - fd.rop.fd = fd - fd.wop.fd = fd // It is safe to add overlapped handles that also perform I/O // outside of the runtime poller. The runtime poller will ignore @@ -514,8 +497,9 @@ func (fd *FD) Read(buf []byte) (int, error) { case kindFile, kindPipe: o := &fd.rop o.InitBuf(buf) - n, err = execIO(o, func(o *operation) error { - return syscall.ReadFile(o.fd.Sysfd, unsafe.Slice(o.buf.Buf, o.buf.Len), &o.qty, o.overlapped()) + n, err = fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = syscall.ReadFile(fd.Sysfd, unsafe.Slice(o.buf.Buf, o.buf.Len), &qty, fd.overlapped(o)) + return qty, err }) fd.addOffset(n) switch err { @@ -530,8 +514,10 @@ func (fd *FD) Read(buf []byte) (int, error) { case kindNet: o := &fd.rop o.InitBuf(buf) - n, err = execIO(o, func(o *operation) error { - return syscall.WSARecv(o.fd.Sysfd, &o.buf, 1, &o.qty, &o.flags, &o.o, nil) + n, err = fd.execIO(o, func(o *operation) (qty uint32, err error) { + var flags uint32 + err = syscall.WSARecv(fd.Sysfd, &o.buf, 1, &qty, &flags, &o.o, nil) + return qty, err }) if race.Enabled { race.Acquire(unsafe.Pointer(&ioSync)) @@ -645,8 +631,9 @@ func (fd *FD) Pread(b []byte, off int64) (int, error) { o := &fd.rop o.InitBuf(b) fd.setOffset(off) - n, err := execIO(o, func(o *operation) error { - return syscall.ReadFile(o.fd.Sysfd, unsafe.Slice(o.buf.Buf, o.buf.Len), &o.qty, &o.o) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = syscall.ReadFile(fd.Sysfd, unsafe.Slice(o.buf.Buf, o.buf.Len), &qty, &o.o) + return qty, err }) if err == syscall.ERROR_HANDLE_EOF { err = io.EOF @@ -671,12 +658,14 @@ func (fd *FD) ReadFrom(buf []byte) (int, syscall.Sockaddr, error) { defer fd.readUnlock() o := &fd.rop o.InitBuf(buf) - n, err := execIO(o, func(o *operation) error { + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { if o.rsa == nil { o.rsa = new(syscall.RawSockaddrAny) } - o.rsan = int32(unsafe.Sizeof(*o.rsa)) - return syscall.WSARecvFrom(o.fd.Sysfd, &o.buf, 1, &o.qty, &o.flags, o.rsa, &o.rsan, &o.o, nil) + rsan := int32(unsafe.Sizeof(*o.rsa)) + var flags uint32 + err = syscall.WSARecvFrom(fd.Sysfd, &o.buf, 1, &qty, &flags, o.rsa, &rsan, &o.o, nil) + return qty, err }) err = fd.eofError(n, err) if err != nil { @@ -700,12 +689,14 @@ func (fd *FD) ReadFromInet4(buf []byte, sa4 *syscall.SockaddrInet4) (int, error) defer fd.readUnlock() o := &fd.rop o.InitBuf(buf) - n, err := execIO(o, func(o *operation) error { + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { if o.rsa == nil { o.rsa = new(syscall.RawSockaddrAny) } - o.rsan = int32(unsafe.Sizeof(*o.rsa)) - return syscall.WSARecvFrom(o.fd.Sysfd, &o.buf, 1, &o.qty, &o.flags, o.rsa, &o.rsan, &o.o, nil) + rsan := int32(unsafe.Sizeof(*o.rsa)) + var flags uint32 + err = syscall.WSARecvFrom(fd.Sysfd, &o.buf, 1, &qty, &flags, o.rsa, &rsan, &o.o, nil) + return qty, err }) err = fd.eofError(n, err) if err != nil { @@ -729,12 +720,14 @@ func (fd *FD) ReadFromInet6(buf []byte, sa6 *syscall.SockaddrInet6) (int, error) defer fd.readUnlock() o := &fd.rop o.InitBuf(buf) - n, err := execIO(o, func(o *operation) error { + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { if o.rsa == nil { o.rsa = new(syscall.RawSockaddrAny) } - o.rsan = int32(unsafe.Sizeof(*o.rsa)) - return syscall.WSARecvFrom(o.fd.Sysfd, &o.buf, 1, &o.qty, &o.flags, o.rsa, &o.rsan, &o.o, nil) + rsan := int32(unsafe.Sizeof(*o.rsa)) + var flags uint32 + err = syscall.WSARecvFrom(fd.Sysfd, &o.buf, 1, &qty, &flags, o.rsa, &rsan, &o.o, nil) + return qty, err }) err = fd.eofError(n, err) if err != nil { @@ -770,8 +763,9 @@ func (fd *FD) Write(buf []byte) (int, error) { case kindPipe, kindFile: o := &fd.wop o.InitBuf(b) - n, err = execIO(o, func(o *operation) error { - return syscall.WriteFile(o.fd.Sysfd, unsafe.Slice(o.buf.Buf, o.buf.Len), &o.qty, o.overlapped()) + n, err = fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = syscall.WriteFile(fd.Sysfd, unsafe.Slice(o.buf.Buf, o.buf.Len), &qty, fd.overlapped(o)) + return qty, err }) fd.addOffset(n) case kindNet: @@ -780,8 +774,9 @@ func (fd *FD) Write(buf []byte) (int, error) { } o := &fd.wop o.InitBuf(b) - n, err = execIO(o, func(o *operation) error { - return syscall.WSASend(o.fd.Sysfd, &o.buf, 1, &o.qty, 0, &o.o, nil) + n, err = fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = syscall.WSASend(fd.Sysfd, &o.buf, 1, &qty, 0, &o.o, nil) + return qty, err }) } ntotal += n @@ -869,8 +864,9 @@ func (fd *FD) Pwrite(buf []byte, off int64) (int, error) { o := &fd.wop o.InitBuf(b) fd.setOffset(off + int64(ntotal)) - n, err := execIO(o, func(o *operation) error { - return syscall.WriteFile(o.fd.Sysfd, unsafe.Slice(o.buf.Buf, o.buf.Len), &o.qty, &o.o) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = syscall.WriteFile(fd.Sysfd, unsafe.Slice(o.buf.Buf, o.buf.Len), &qty, &o.o) + return qty, err }) if n > 0 { ntotal += n @@ -898,8 +894,9 @@ func (fd *FD) Writev(buf *[][]byte) (int64, error) { } o := &fd.wop o.InitBufs(buf) - n, err := execIO(o, func(o *operation) error { - return syscall.WSASend(o.fd.Sysfd, &o.bufs[0], uint32(len(o.bufs)), &o.qty, 0, &o.o, nil) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = syscall.WSASend(fd.Sysfd, &o.bufs[0], uint32(len(o.bufs)), &qty, 0, &o.o, nil) + return qty, err }) o.ClearBufs() TestHookDidWritev(n) @@ -918,9 +915,9 @@ func (fd *FD) WriteTo(buf []byte, sa syscall.Sockaddr) (int, error) { // handle zero-byte payload o := &fd.wop o.InitBuf(buf) - o.sa = sa - n, err := execIO(o, func(o *operation) error { - return syscall.WSASendto(o.fd.Sysfd, &o.buf, 1, &o.qty, 0, o.sa, &o.o, nil) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = syscall.WSASendto(fd.Sysfd, &o.buf, 1, &qty, 0, sa, &o.o, nil) + return qty, err }) return n, err } @@ -933,9 +930,9 @@ func (fd *FD) WriteTo(buf []byte, sa syscall.Sockaddr) (int, error) { } o := &fd.wop o.InitBuf(b) - o.sa = sa - n, err := execIO(o, func(o *operation) error { - return syscall.WSASendto(o.fd.Sysfd, &o.buf, 1, &o.qty, 0, o.sa, &o.o, nil) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = syscall.WSASendto(fd.Sysfd, &o.buf, 1, &qty, 0, sa, &o.o, nil) + return qty, err }) ntotal += int(n) if err != nil { @@ -957,8 +954,9 @@ func (fd *FD) WriteToInet4(buf []byte, sa4 *syscall.SockaddrInet4) (int, error) // handle zero-byte payload o := &fd.wop o.InitBuf(buf) - n, err := execIO(o, func(o *operation) error { - return windows.WSASendtoInet4(o.fd.Sysfd, &o.buf, 1, &o.qty, 0, sa4, &o.o, nil) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = windows.WSASendtoInet4(fd.Sysfd, &o.buf, 1, &qty, 0, sa4, &o.o, nil) + return qty, err }) return n, err } @@ -971,8 +969,9 @@ func (fd *FD) WriteToInet4(buf []byte, sa4 *syscall.SockaddrInet4) (int, error) } o := &fd.wop o.InitBuf(b) - n, err := execIO(o, func(o *operation) error { - return windows.WSASendtoInet4(o.fd.Sysfd, &o.buf, 1, &o.qty, 0, sa4, &o.o, nil) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = windows.WSASendtoInet4(fd.Sysfd, &o.buf, 1, &qty, 0, sa4, &o.o, nil) + return qty, err }) ntotal += int(n) if err != nil { @@ -994,8 +993,9 @@ func (fd *FD) WriteToInet6(buf []byte, sa6 *syscall.SockaddrInet6) (int, error) // handle zero-byte payload o := &fd.wop o.InitBuf(buf) - n, err := execIO(o, func(o *operation) error { - return windows.WSASendtoInet6(o.fd.Sysfd, &o.buf, 1, &o.qty, 0, sa6, &o.o, nil) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = windows.WSASendtoInet6(fd.Sysfd, &o.buf, 1, &qty, 0, sa6, &o.o, nil) + return qty, err }) return n, err } @@ -1008,8 +1008,9 @@ func (fd *FD) WriteToInet6(buf []byte, sa6 *syscall.SockaddrInet6) (int, error) } o := &fd.wop o.InitBuf(b) - n, err := execIO(o, func(o *operation) error { - return windows.WSASendtoInet6(o.fd.Sysfd, &o.buf, 1, &o.qty, 0, sa6, &o.o, nil) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = windows.WSASendtoInet6(fd.Sysfd, &o.buf, 1, &qty, 0, sa6, &o.o, nil) + return qty, err }) ntotal += int(n) if err != nil { @@ -1025,19 +1026,19 @@ func (fd *FD) WriteToInet6(buf []byte, sa6 *syscall.SockaddrInet6) (int, error) // than in the net package so that it can use fd.wop. func (fd *FD) ConnectEx(ra syscall.Sockaddr) error { o := &fd.wop - o.sa = ra - _, err := execIO(o, func(o *operation) error { - return ConnectExFunc(o.fd.Sysfd, o.sa, nil, 0, nil, &o.o) + _, err := fd.execIO(o, func(o *operation) (uint32, error) { + return 0, ConnectExFunc(fd.Sysfd, ra, nil, 0, nil, &o.o) }) return err } func (fd *FD) acceptOne(s syscall.Handle, rawsa []syscall.RawSockaddrAny, o *operation) (string, error) { // Submit accept request. - o.handle = s - o.rsan = int32(unsafe.Sizeof(rawsa[0])) - _, err := execIO(o, func(o *operation) error { - return AcceptFunc(o.fd.Sysfd, o.handle, (*byte)(unsafe.Pointer(&rawsa[0])), 0, uint32(o.rsan), uint32(o.rsan), &o.qty, &o.o) + rsan := uint32(unsafe.Sizeof(rawsa[0])) + _, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = AcceptFunc(fd.Sysfd, s, (*byte)(unsafe.Pointer(&rawsa[0])), 0, rsan, rsan, &qty, &o.o) + return qty, err + }) if err != nil { CloseFunc(s) @@ -1072,7 +1073,7 @@ func (fd *FD) Accept(sysSocket func() (syscall.Handle, error)) (syscall.Handle, errcall, err := fd.acceptOne(s, rawsa[:], o) if err == nil { - return s, rawsa[:], uint32(o.rsan), "", nil + return s, rawsa[:], uint32(unsafe.Sizeof(rawsa[0])), "", nil } // Sometimes we see WSAECONNRESET and ERROR_NETNAME_DELETED is @@ -1179,11 +1180,13 @@ func (fd *FD) RawRead(f func(uintptr) bool) error { // socket is readable. h/t https://stackoverflow.com/a/42019668/332798 o := &fd.rop o.InitBuf(nil) - _, err := execIO(o, func(o *operation) error { + _, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + var flags uint32 if !fd.IsStream { - o.flags |= windows.MSG_PEEK + flags |= windows.MSG_PEEK } - return syscall.WSARecv(o.fd.Sysfd, &o.buf, 1, &o.qty, &o.flags, &o.o, nil) + err = syscall.WSARecv(fd.Sysfd, &o.buf, 1, &qty, &flags, &o.o, nil) + return qty, err }) if err == windows.WSAEMSGSIZE { // expected with a 0-byte peek, ignore. @@ -1271,22 +1274,22 @@ func (fd *FD) ReadMsg(p []byte, oob []byte, flags int) (int, int, int, syscall.S } o := &fd.rop - o.InitMsg(p, oob) if o.rsa == nil { o.rsa = new(syscall.RawSockaddrAny) } - o.msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) - o.msg.Namelen = int32(unsafe.Sizeof(*o.rsa)) - o.msg.Flags = uint32(flags) - n, err := execIO(o, func(o *operation) error { - return windows.WSARecvMsg(o.fd.Sysfd, &o.msg, &o.qty, &o.o, nil) + msg := newWSAMsg(p, oob, flags) + msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) + msg.Namelen = int32(unsafe.Sizeof(*o.rsa)) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = windows.WSARecvMsg(fd.Sysfd, &msg, &qty, &o.o, nil) + return qty, err }) err = fd.eofError(n, err) var sa syscall.Sockaddr if err == nil { sa, err = o.rsa.Sockaddr() } - return n, int(o.msg.Control.Len), int(o.msg.Flags), sa, err + return n, int(msg.Control.Len), int(msg.Flags), sa, err } // ReadMsgInet4 is ReadMsg, but specialized to return a syscall.SockaddrInet4. @@ -1301,21 +1304,21 @@ func (fd *FD) ReadMsgInet4(p []byte, oob []byte, flags int, sa4 *syscall.Sockadd } o := &fd.rop - o.InitMsg(p, oob) if o.rsa == nil { o.rsa = new(syscall.RawSockaddrAny) } - o.msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) - o.msg.Namelen = int32(unsafe.Sizeof(*o.rsa)) - o.msg.Flags = uint32(flags) - n, err := execIO(o, func(o *operation) error { - return windows.WSARecvMsg(o.fd.Sysfd, &o.msg, &o.qty, &o.o, nil) + msg := newWSAMsg(p, oob, flags) + msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) + msg.Namelen = int32(unsafe.Sizeof(*o.rsa)) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = windows.WSARecvMsg(fd.Sysfd, &msg, &qty, &o.o, nil) + return qty, err }) err = fd.eofError(n, err) if err == nil { rawToSockaddrInet4(o.rsa, sa4) } - return n, int(o.msg.Control.Len), int(o.msg.Flags), err + return n, int(msg.Control.Len), int(msg.Flags), err } // ReadMsgInet6 is ReadMsg, but specialized to return a syscall.SockaddrInet6. @@ -1330,21 +1333,21 @@ func (fd *FD) ReadMsgInet6(p []byte, oob []byte, flags int, sa6 *syscall.Sockadd } o := &fd.rop - o.InitMsg(p, oob) if o.rsa == nil { o.rsa = new(syscall.RawSockaddrAny) } - o.msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) - o.msg.Namelen = int32(unsafe.Sizeof(*o.rsa)) - o.msg.Flags = uint32(flags) - n, err := execIO(o, func(o *operation) error { - return windows.WSARecvMsg(o.fd.Sysfd, &o.msg, &o.qty, &o.o, nil) + msg := newWSAMsg(p, oob, flags) + msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) + msg.Namelen = int32(unsafe.Sizeof(*o.rsa)) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = windows.WSARecvMsg(fd.Sysfd, &msg, &qty, &o.o, nil) + return qty, err }) err = fd.eofError(n, err) if err == nil { rawToSockaddrInet6(o.rsa, sa6) } - return n, int(o.msg.Control.Len), int(o.msg.Flags), err + return n, int(msg.Control.Len), int(msg.Flags), err } // WriteMsg wraps the WSASendMsg network call. @@ -1359,7 +1362,7 @@ func (fd *FD) WriteMsg(p []byte, oob []byte, sa syscall.Sockaddr) (int, int, err defer fd.writeUnlock() o := &fd.wop - o.InitMsg(p, oob) + msg := newWSAMsg(p, oob, 0) if sa != nil { if o.rsa == nil { o.rsa = new(syscall.RawSockaddrAny) @@ -1368,13 +1371,14 @@ func (fd *FD) WriteMsg(p []byte, oob []byte, sa syscall.Sockaddr) (int, int, err if err != nil { return 0, 0, err } - o.msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) - o.msg.Namelen = len + msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) + msg.Namelen = len } - n, err := execIO(o, func(o *operation) error { - return windows.WSASendMsg(o.fd.Sysfd, &o.msg, 0, &o.qty, &o.o, nil) + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = windows.WSASendMsg(fd.Sysfd, &msg, 0, nil, &o.o, nil) + return qty, err }) - return n, int(o.msg.Control.Len), err + return n, int(msg.Control.Len), err } // WriteMsgInet4 is WriteMsg specialized for syscall.SockaddrInet4. @@ -1389,17 +1393,18 @@ func (fd *FD) WriteMsgInet4(p []byte, oob []byte, sa *syscall.SockaddrInet4) (in defer fd.writeUnlock() o := &fd.wop - o.InitMsg(p, oob) if o.rsa == nil { o.rsa = new(syscall.RawSockaddrAny) } len := sockaddrInet4ToRaw(o.rsa, sa) - o.msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) - o.msg.Namelen = len - n, err := execIO(o, func(o *operation) error { - return windows.WSASendMsg(o.fd.Sysfd, &o.msg, 0, &o.qty, &o.o, nil) + msg := newWSAMsg(p, oob, 0) + msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) + msg.Namelen = len + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = windows.WSASendMsg(fd.Sysfd, &msg, 0, nil, &o.o, nil) + return qty, err }) - return n, int(o.msg.Control.Len), err + return n, int(msg.Control.Len), err } // WriteMsgInet6 is WriteMsg specialized for syscall.SockaddrInet6. @@ -1414,17 +1419,18 @@ func (fd *FD) WriteMsgInet6(p []byte, oob []byte, sa *syscall.SockaddrInet6) (in defer fd.writeUnlock() o := &fd.wop - o.InitMsg(p, oob) if o.rsa == nil { o.rsa = new(syscall.RawSockaddrAny) } + msg := newWSAMsg(p, oob, 0) len := sockaddrInet6ToRaw(o.rsa, sa) - o.msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) - o.msg.Namelen = len - n, err := execIO(o, func(o *operation) error { - return windows.WSASendMsg(o.fd.Sysfd, &o.msg, 0, &o.qty, &o.o, nil) + msg.Name = (syscall.Pointer)(unsafe.Pointer(o.rsa)) + msg.Namelen = len + n, err := fd.execIO(o, func(o *operation) (qty uint32, err error) { + err = windows.WSASendMsg(fd.Sysfd, &msg, 0, nil, &o.o, nil) + return qty, err }) - return n, int(o.msg.Control.Len), err + return n, int(msg.Control.Len), err } func DupCloseOnExec(fd int) (int, string, error) { diff --git a/src/internal/poll/sendfile_windows.go b/src/internal/poll/sendfile_windows.go index d72bcd5871..a052f4a1f8 100644 --- a/src/internal/poll/sendfile_windows.go +++ b/src/internal/poll/sendfile_windows.go @@ -63,7 +63,6 @@ func SendFile(fd *FD, src uintptr, size int64) (written int64, err error, handle const maxChunkSizePerCall = int64(0x7fffffff - 1) o := &fd.wop - o.handle = hsrc for size > 0 { chunkSize := maxChunkSizePerCall if chunkSize > size { @@ -74,9 +73,12 @@ func SendFile(fd *FD, src uintptr, size int64) (written int64, err error, handle o.o.Offset = uint32(off) o.o.OffsetHigh = uint32(off >> 32) - n, err := execIO(o, func(o *operation) error { - o.qty = uint32(chunkSize) - return syscall.TransmitFile(o.fd.Sysfd, o.handle, o.qty, 0, &o.o, nil, syscall.TF_WRITE_BEHIND) + n, err := fd.execIO(o, func(o *operation) (uint32, error) { + err := syscall.TransmitFile(fd.Sysfd, hsrc, uint32(chunkSize), 0, &o.o, nil, syscall.TF_WRITE_BEHIND) + if err != nil { + return 0, err + } + return uint32(chunkSize), nil }) if err != nil { return written, err, written > 0 diff --git a/src/internal/reflectlite/export_test.go b/src/internal/reflectlite/export_test.go index 0ad3d97c15..93762a8387 100644 --- a/src/internal/reflectlite/export_test.go +++ b/src/internal/reflectlite/export_test.go @@ -70,7 +70,7 @@ func Zero(typ Type) Value { } t := typ.common() fl := flag(t.Kind()) - if t.IfaceIndir() { + if !t.IsDirectIface() { return Value{t, unsafe_New(t), fl | flagIndir} } return Value{t, nil, fl} diff --git a/src/internal/reflectlite/value.go b/src/internal/reflectlite/value.go index 7b231d554f..a92df613f5 100644 --- a/src/internal/reflectlite/value.go +++ b/src/internal/reflectlite/value.go @@ -52,7 +52,7 @@ type Value struct { // - flagIndir: val holds a pointer to the data // - flagAddr: v.CanAddr is true (implies flagIndir and ptr is non-nil) // - flagMethod: v is a method value. - // If ifaceIndir(typ), code can assume that flagIndir is set. + // If !typ.IsDirectIface(), code can assume that flagIndir is set. // // The remaining 22+ bits give a method number for method values. // If flag.kind() != Func, code can assume that flagMethod is unset. @@ -118,7 +118,7 @@ func packEface(v Value) any { e := (*abi.EmptyInterface)(unsafe.Pointer(&i)) // First, fill in the data portion of the interface. switch { - case t.IfaceIndir(): + case !t.IsDirectIface(): if v.flag&flagIndir == 0 { panic("bad indir") } @@ -155,7 +155,7 @@ func unpackEface(i any) Value { return Value{} } f := flag(t.Kind()) - if t.IfaceIndir() { + if !t.IsDirectIface() { f |= flagIndir } return Value{t, e.Data, f} diff --git a/src/internal/runtime/cgobench/bench_test.go b/src/internal/runtime/cgobench/bench_test.go new file mode 100644 index 0000000000..b4d8efec5e --- /dev/null +++ b/src/internal/runtime/cgobench/bench_test.go @@ -0,0 +1,26 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build cgo + +package cgobench_test + +import ( + "internal/runtime/cgobench" + "testing" +) + +func BenchmarkCgoCall(b *testing.B) { + for b.Loop() { + cgobench.Empty() + } +} + +func BenchmarkCgoCallParallel(b *testing.B) { + b.RunParallel(func(pb *testing.PB) { + for pb.Next() { + cgobench.Empty() + } + }) +} diff --git a/src/internal/runtime/cgobench/funcs.go b/src/internal/runtime/cgobench/funcs.go new file mode 100644 index 0000000000..db685180a1 --- /dev/null +++ b/src/internal/runtime/cgobench/funcs.go @@ -0,0 +1,17 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build cgo + +package cgobench + +/* +static void empty() { +} +*/ +import "C" + +func Empty() { + C.empty() +} diff --git a/src/internal/runtime/cgroup/cgroup_linux.go b/src/internal/runtime/cgroup/cgroup_linux.go index 2fc3b225c5..91815b4a1d 100644 --- a/src/internal/runtime/cgroup/cgroup_linux.go +++ b/src/internal/runtime/cgroup/cgroup_linux.go @@ -7,7 +7,7 @@ package cgroup import ( "internal/bytealg" "internal/runtime/strconv" - "internal/runtime/syscall" + "internal/runtime/syscall/linux" ) var ( @@ -77,10 +77,10 @@ type CPU struct { func (c CPU) Close() { switch c.version { case V1: - syscall.Close(c.quotaFD) - syscall.Close(c.periodFD) + linux.Close(c.quotaFD) + linux.Close(c.periodFD) case V2: - syscall.Close(c.quotaFD) + linux.Close(c.quotaFD) default: throw("impossible cgroup version") } @@ -112,7 +112,7 @@ func OpenCPU(scratch []byte) (CPU, error) { case 1: n2 := copy(base[n:], v1QuotaFile) path := base[:n+n2] - quotaFD, errno := syscall.Open(&path[0], syscall.O_RDONLY|syscall.O_CLOEXEC, 0) + quotaFD, errno := linux.Open(&path[0], linux.O_RDONLY|linux.O_CLOEXEC, 0) if errno != 0 { // This may fail if this process was migrated out of // the cgroup found by FindCPU and that cgroup has been @@ -122,7 +122,7 @@ func OpenCPU(scratch []byte) (CPU, error) { n2 = copy(base[n:], v1PeriodFile) path = base[:n+n2] - periodFD, errno := syscall.Open(&path[0], syscall.O_RDONLY|syscall.O_CLOEXEC, 0) + periodFD, errno := linux.Open(&path[0], linux.O_RDONLY|linux.O_CLOEXEC, 0) if errno != 0 { // This may fail if this process was migrated out of // the cgroup found by FindCPU and that cgroup has been @@ -139,7 +139,7 @@ func OpenCPU(scratch []byte) (CPU, error) { case 2: n2 := copy(base[n:], v2MaxFile) path := base[:n+n2] - maxFD, errno := syscall.Open(&path[0], syscall.O_RDONLY|syscall.O_CLOEXEC, 0) + maxFD, errno := linux.Open(&path[0], linux.O_RDONLY|linux.O_CLOEXEC, 0) if errno != 0 { // This may fail if this process was migrated out of // the cgroup found by FindCPU and that cgroup has been @@ -200,7 +200,7 @@ func readV1Number(fd int) (int64, error) { // // Always read from the beginning of the file to get a fresh value. var b [64]byte - n, errno := syscall.Pread(fd, b[:], 0) + n, errno := linux.Pread(fd, b[:], 0) if errno != 0 { return 0, errSyscallFailed } @@ -248,7 +248,7 @@ func readV2Limit(fd int) (float64, bool, error) { // // Always read from the beginning of the file to get a fresh value. var b [64]byte - n, errno := syscall.Pread(fd, b[:], 0) + n, errno := linux.Pread(fd, b[:], 0) if errno != 0 { return 0, false, errSyscallFailed } @@ -345,8 +345,8 @@ func FindCPU(out []byte, scratch []byte) (int, Version, error) { // Returns ErrNoCgroup if the process is not in a CPU cgroup. func FindCPURelativePath(out []byte, scratch []byte) (int, Version, error) { path := []byte("/proc/self/cgroup\x00") - fd, errno := syscall.Open(&path[0], syscall.O_RDONLY|syscall.O_CLOEXEC, 0) - if errno == syscall.ENOENT { + fd, errno := linux.Open(&path[0], linux.O_RDONLY|linux.O_CLOEXEC, 0) + if errno == linux.ENOENT { return 0, 0, ErrNoCgroup } else if errno != 0 { return 0, 0, errSyscallFailed @@ -354,13 +354,13 @@ func FindCPURelativePath(out []byte, scratch []byte) (int, Version, error) { // The relative path always starts with /, so we can directly append it // to the mount point. - n, version, err := parseCPURelativePath(fd, syscall.Read, out[:], scratch) + n, version, err := parseCPURelativePath(fd, linux.Read, out[:], scratch) if err != nil { - syscall.Close(fd) + linux.Close(fd) return 0, 0, err } - syscall.Close(fd) + linux.Close(fd) return n, version, nil } @@ -489,19 +489,19 @@ func FindCPUMountPoint(out []byte, scratch []byte) (int, error) { checkBufferSize(scratch, ParseSize) path := []byte("/proc/self/mountinfo\x00") - fd, errno := syscall.Open(&path[0], syscall.O_RDONLY|syscall.O_CLOEXEC, 0) - if errno == syscall.ENOENT { + fd, errno := linux.Open(&path[0], linux.O_RDONLY|linux.O_CLOEXEC, 0) + if errno == linux.ENOENT { return 0, ErrNoCgroup } else if errno != 0 { return 0, errSyscallFailed } - n, err := parseCPUMount(fd, syscall.Read, out, scratch) + n, err := parseCPUMount(fd, linux.Read, out, scratch) if err != nil { - syscall.Close(fd) + linux.Close(fd) return 0, err } - syscall.Close(fd) + linux.Close(fd) return n, nil } diff --git a/src/internal/runtime/cgroup/line_reader.go b/src/internal/runtime/cgroup/line_reader.go index 382cfd70d1..9a7213327c 100644 --- a/src/internal/runtime/cgroup/line_reader.go +++ b/src/internal/runtime/cgroup/line_reader.go @@ -55,7 +55,7 @@ type lineReader struct { // remainder of the line skipped. See next for more details. // // read is the function used to read more bytes from fd. This is usually -// internal/runtime/syscall.Read. Note that this follows syscall semantics (not +// internal/runtime/syscall/linux.Read. Note that this follows syscall semantics (not // io.Reader), so EOF is indicated with n=0, errno=0. func newLineReader(fd int, scratch []byte, read func(fd int, b []byte) (n int, errno uintptr)) *lineReader { return &lineReader{ diff --git a/src/internal/runtime/exithook/hooks.go b/src/internal/runtime/exithook/hooks.go index eb8aa1ce0a..8dcfb9ed3c 100644 --- a/src/internal/runtime/exithook/hooks.go +++ b/src/internal/runtime/exithook/hooks.go @@ -8,7 +8,7 @@ // from a safe context (e.g. not an error/panic path or signal // handler, preemption enabled, allocation allowed, write barriers // allowed, etc), and that the exit function F will be invoked under -// similar circumstances. That is the say, we are expecting that F +// similar circumstances. That is to say, we are expecting that F // uses normal / high-level Go code as opposed to one of the more // restricted dialects used for the trickier parts of the runtime. package exithook diff --git a/src/internal/runtime/maps/export_noswiss_test.go b/src/internal/runtime/maps/export_noswiss_test.go deleted file mode 100644 index 333fc6ce90..0000000000 --- a/src/internal/runtime/maps/export_noswiss_test.go +++ /dev/null @@ -1,51 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -// This file allows non-GOEXPERIMENT=swissmap builds (i.e., old map builds) to -// construct a swissmap table for running the tests in this package. - -package maps - -import ( - "internal/abi" - "unsafe" -) - -type instantiatedGroup[K comparable, V any] struct { - ctrls ctrlGroup - slots [abi.SwissMapGroupSlots]instantiatedSlot[K, V] -} - -type instantiatedSlot[K comparable, V any] struct { - key K - elem V -} - -func newTestMapType[K comparable, V any]() *abi.SwissMapType { - var m map[K]V - mTyp := abi.TypeOf(m) - omt := (*abi.OldMapType)(unsafe.Pointer(mTyp)) - - var grp instantiatedGroup[K, V] - var slot instantiatedSlot[K, V] - - mt := &abi.SwissMapType{ - Key: omt.Key, - Elem: omt.Elem, - Group: abi.TypeOf(grp), - Hasher: omt.Hasher, - SlotSize: unsafe.Sizeof(slot), - GroupSize: unsafe.Sizeof(grp), - ElemOff: unsafe.Offsetof(slot.elem), - } - if omt.NeedKeyUpdate() { - mt.Flags |= abi.SwissMapNeedKeyUpdate - } - if omt.HashMightPanic() { - mt.Flags |= abi.SwissMapHashMightPanic - } - return mt -} diff --git a/src/internal/runtime/maps/export_swiss_test.go b/src/internal/runtime/maps/export_swiss_test.go deleted file mode 100644 index 3c6faf5c48..0000000000 --- a/src/internal/runtime/maps/export_swiss_test.go +++ /dev/null @@ -1,19 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build goexperiment.swissmap - -package maps - -import ( - "internal/abi" - "unsafe" -) - -func newTestMapType[K comparable, V any]() *abi.SwissMapType { - var m map[K]V - mTyp := abi.TypeOf(m) - mt := (*abi.SwissMapType)(unsafe.Pointer(mTyp)) - return mt -} diff --git a/src/internal/runtime/maps/export_test.go b/src/internal/runtime/maps/export_test.go index 2c7b05ea2d..adce44ba93 100644 --- a/src/internal/runtime/maps/export_test.go +++ b/src/internal/runtime/maps/export_test.go @@ -22,7 +22,14 @@ const MaxAvgGroupLoad = maxAvgGroupLoad // we can't properly test hint alloc overflows with this. const maxAllocTest = 1 << 30 -func NewTestMap[K comparable, V any](hint uintptr) (*Map, *abi.SwissMapType) { +func newTestMapType[K comparable, V any]() *abi.MapType { + var m map[K]V + mTyp := abi.TypeOf(m) + mt := (*abi.MapType)(unsafe.Pointer(mTyp)) + return mt +} + +func NewTestMap[K comparable, V any](hint uintptr) (*Map, *abi.MapType) { mt := newTestMapType[K, V]() return NewMap(mt, hint, nil, maxAllocTest), mt } @@ -61,7 +68,7 @@ func (m *Map) GroupCount() uint64 { // Returns nil if there are no full groups. // Returns nil if a group is full but contains entirely deleted slots. // Returns nil if the map is small. -func (m *Map) KeyFromFullGroup(typ *abi.SwissMapType) unsafe.Pointer { +func (m *Map) KeyFromFullGroup(typ *abi.MapType) unsafe.Pointer { if m.dirLen <= 0 { return nil } @@ -82,7 +89,7 @@ func (m *Map) KeyFromFullGroup(typ *abi.SwissMapType) unsafe.Pointer { } // All full or deleted slots. - for j := uintptr(0); j < abi.SwissMapGroupSlots; j++ { + for j := uintptr(0); j < abi.MapGroupSlots; j++ { if g.ctrls().get(j) == ctrlDeleted { continue } @@ -99,7 +106,7 @@ func (m *Map) KeyFromFullGroup(typ *abi.SwissMapType) unsafe.Pointer { } // Returns nil if the map is small. -func (m *Map) TableFor(typ *abi.SwissMapType, key unsafe.Pointer) *table { +func (m *Map) TableFor(typ *abi.MapType, key unsafe.Pointer) *table { if m.dirLen <= 0 { return nil } diff --git a/src/internal/runtime/maps/group.go b/src/internal/runtime/maps/group.go index 5fd87218d1..b23ff76f98 100644 --- a/src/internal/runtime/maps/group.go +++ b/src/internal/runtime/maps/group.go @@ -39,7 +39,7 @@ const ( // On other architectures, bitset uses one byte per slot, where each byte is // either 0x80 if the slot is part of the set or 0x00 otherwise. This makes it // convenient to calculate for an entire group at once using standard -// arithemetic instructions. +// arithmetic instructions. type bitset uint64 // first returns the relative index of the first control byte in the group that @@ -122,7 +122,7 @@ func (b bitset) count() int { // TODO(prattmic): Consider inverting the top bit so that the zero value is empty. type ctrl uint8 -// ctrlGroup is a fixed size array of abi.SwissMapGroupSlots control bytes +// ctrlGroup is a fixed size array of abi.MapGroupSlots control bytes // stored in a uint64. type ctrlGroup uint64 @@ -157,7 +157,7 @@ func (g ctrlGroup) matchH2(h uintptr) bitset { // Portable implementation of matchH2. // // Note: On AMD64, this is an intrinsic implemented with SIMD instructions. See -// note on bitset about the packed instrinsified return value. +// note on bitset about the packed intrinsified return value. func ctrlGroupMatchH2(g ctrlGroup, h uintptr) bitset { // NB: This generic matching routine produces false positive matches when // h is 2^N and the control bytes have a seq of 2^N followed by 2^N+1. For @@ -179,7 +179,7 @@ func (g ctrlGroup) matchEmpty() bitset { // Portable implementation of matchEmpty. // // Note: On AMD64, this is an intrinsic implemented with SIMD instructions. See -// note on bitset about the packed instrinsified return value. +// note on bitset about the packed intrinsified return value. func ctrlGroupMatchEmpty(g ctrlGroup) bitset { // An empty slot is 1000 0000 // A deleted slot is 1111 1110 @@ -200,7 +200,7 @@ func (g ctrlGroup) matchEmptyOrDeleted() bitset { // Portable implementation of matchEmptyOrDeleted. // // Note: On AMD64, this is an intrinsic implemented with SIMD instructions. See -// note on bitset about the packed instrinsified return value. +// note on bitset about the packed intrinsified return value. func ctrlGroupMatchEmptyOrDeleted(g ctrlGroup) bitset { // An empty slot is 1000 0000 // A deleted slot is 1111 1110 @@ -219,7 +219,7 @@ func (g ctrlGroup) matchFull() bitset { // Portable implementation of matchFull. // // Note: On AMD64, this is an intrinsic implemented with SIMD instructions. See -// note on bitset about the packed instrinsified return value. +// note on bitset about the packed intrinsified return value. func ctrlGroupMatchFull(g ctrlGroup) bitset { // An empty slot is 1000 0000 // A deleted slot is 1111 1110 @@ -233,7 +233,7 @@ func ctrlGroupMatchFull(g ctrlGroup) bitset { // groupReference is a wrapper type representing a single slot group stored at // data. // -// A group holds abi.SwissMapGroupSlots slots (key/elem pairs) plus their +// A group holds abi.MapGroupSlots slots (key/elem pairs) plus their // control word. type groupReference struct { // data points to the group, which is described by typ.Group and has @@ -241,7 +241,7 @@ type groupReference struct { // // type group struct { // ctrls ctrlGroup - // slots [abi.SwissMapGroupSlots]slot + // slots [abi.MapGroupSlots]slot // } // // type slot struct { @@ -281,14 +281,14 @@ func (g *groupReference) ctrls() *ctrlGroup { } // key returns a pointer to the key at index i. -func (g *groupReference) key(typ *abi.SwissMapType, i uintptr) unsafe.Pointer { +func (g *groupReference) key(typ *abi.MapType, i uintptr) unsafe.Pointer { offset := groupSlotsOffset + i*typ.SlotSize return unsafe.Pointer(uintptr(g.data) + offset) } // elem returns a pointer to the element at index i. -func (g *groupReference) elem(typ *abi.SwissMapType, i uintptr) unsafe.Pointer { +func (g *groupReference) elem(typ *abi.MapType, i uintptr) unsafe.Pointer { offset := groupSlotsOffset + i*typ.SlotSize + typ.ElemOff return unsafe.Pointer(uintptr(g.data) + offset) @@ -310,7 +310,7 @@ type groupsReference struct { // newGroups allocates a new array of length groups. // // Length must be a power of two. -func newGroups(typ *abi.SwissMapType, length uint64) groupsReference { +func newGroups(typ *abi.MapType, length uint64) groupsReference { return groupsReference{ // TODO: make the length type the same throughout. data: newarray(typ.Group, int(length)), @@ -319,7 +319,7 @@ func newGroups(typ *abi.SwissMapType, length uint64) groupsReference { } // group returns the group at index i. -func (g *groupsReference) group(typ *abi.SwissMapType, i uint64) groupReference { +func (g *groupsReference) group(typ *abi.MapType, i uint64) groupReference { // TODO(prattmic): Do something here about truncation on cast to // uintptr on 32-bit systems? offset := uintptr(i) * typ.GroupSize @@ -329,11 +329,11 @@ func (g *groupsReference) group(typ *abi.SwissMapType, i uint64) groupReference } } -func cloneGroup(typ *abi.SwissMapType, newGroup, oldGroup groupReference) { +func cloneGroup(typ *abi.MapType, newGroup, oldGroup groupReference) { typedmemmove(typ.Group, newGroup.data, oldGroup.data) if typ.IndirectKey() { // Deep copy keys if indirect. - for i := uintptr(0); i < abi.SwissMapGroupSlots; i++ { + for i := uintptr(0); i < abi.MapGroupSlots; i++ { oldKey := *(*unsafe.Pointer)(oldGroup.key(typ, i)) if oldKey == nil { continue @@ -345,7 +345,7 @@ func cloneGroup(typ *abi.SwissMapType, newGroup, oldGroup groupReference) { } if typ.IndirectElem() { // Deep copy elems if indirect. - for i := uintptr(0); i < abi.SwissMapGroupSlots; i++ { + for i := uintptr(0); i < abi.MapGroupSlots; i++ { oldElem := *(*unsafe.Pointer)(oldGroup.elem(typ, i)) if oldElem == nil { continue diff --git a/src/internal/runtime/maps/map.go b/src/internal/runtime/maps/map.go index 3b9a06239c..865a3f36c2 100644 --- a/src/internal/runtime/maps/map.go +++ b/src/internal/runtime/maps/map.go @@ -21,7 +21,7 @@ import ( // // Terminology: // - Slot: A storage location of a single key/element pair. -// - Group: A group of abi.SwissMapGroupSlots (8) slots, plus a control word. +// - Group: A group of abi.MapGroupSlots (8) slots, plus a control word. // - Control word: An 8-byte word which denotes whether each slot is empty, // deleted, or used. If a slot is used, its control byte also contains the // lower 7 bits of the hash (H2). @@ -113,7 +113,7 @@ import ( // Note that each table has its own load factor and grows independently. If the // 1st bucket grows, it will split. We'll need 2 bits to select tables, though // we'll have 3 tables total rather than 4. We support this by allowing -// multiple indicies to point to the same table. This example: +// multiple indices to point to the same table. This example: // // directory (globalDepth=2) // +----+ @@ -191,7 +191,7 @@ func h2(h uintptr) uintptr { return h & 0x7f } -// Note: changes here must be reflected in cmd/compile/internal/reflectdata/map_swiss.go:SwissMapType. +// Note: changes here must be reflected in cmd/compile/internal/reflectdata/map.go:MapType. type Map struct { // The number of filled slots (i.e. the number of elements in all // tables). Excludes deleted slots. @@ -212,7 +212,7 @@ type Map struct { // details. // // Small map optimization: if the map always contained - // abi.SwissMapGroupSlots or fewer entries, it fits entirely in a + // abi.MapGroupSlots or fewer entries, it fits entirely in a // single group. In that case dirPtr points directly to a single group. // // dirPtr *group @@ -257,14 +257,14 @@ func depthToShift(depth uint8) uint8 { // maxAlloc should be runtime.maxAlloc. // // TODO(prattmic): Put maxAlloc somewhere accessible. -func NewMap(mt *abi.SwissMapType, hint uintptr, m *Map, maxAlloc uintptr) *Map { +func NewMap(mt *abi.MapType, hint uintptr, m *Map, maxAlloc uintptr) *Map { if m == nil { m = new(Map) } m.seed = uintptr(rand()) - if hint <= abi.SwissMapGroupSlots { + if hint <= abi.MapGroupSlots { // A small map can fill all 8 slots, so no need to increase // target capacity. // @@ -286,7 +286,7 @@ func NewMap(mt *abi.SwissMapType, hint uintptr, m *Map, maxAlloc uintptr) *Map { // Set initial capacity to hold hint entries without growing in the // average case. - targetCapacity := (hint * abi.SwissMapGroupSlots) / maxAvgGroupLoad + targetCapacity := (hint * abi.MapGroupSlots) / maxAvgGroupLoad if targetCapacity < hint { // overflow return m // return an empty map. } @@ -365,7 +365,7 @@ func (m *Map) installTableSplit(old, left, right *table) { t := m.directoryAt(uintptr(i)) newDir[2*i] = t newDir[2*i+1] = t - // t may already exist in multiple indicies. We should + // t may already exist in multiple indices. We should // only update t.index once. Since the index must // increase, seeing the original index means this must // be the first time we've encountered this table. @@ -380,7 +380,7 @@ func (m *Map) installTableSplit(old, left, right *table) { m.dirLen = len(newDir) } - // N.B. left and right may still consume multiple indicies if the + // N.B. left and right may still consume multiple indices if the // directory has grown multiple times since old was last split. left.index = old.index m.replaceTable(left) @@ -396,11 +396,11 @@ func (m *Map) Used() uint64 { // Get performs a lookup of the key that key points to. It returns a pointer to // the element, or false if the key doesn't exist. -func (m *Map) Get(typ *abi.SwissMapType, key unsafe.Pointer) (unsafe.Pointer, bool) { +func (m *Map) Get(typ *abi.MapType, key unsafe.Pointer) (unsafe.Pointer, bool) { return m.getWithoutKey(typ, key) } -func (m *Map) getWithKey(typ *abi.SwissMapType, key unsafe.Pointer) (unsafe.Pointer, unsafe.Pointer, bool) { +func (m *Map) getWithKey(typ *abi.MapType, key unsafe.Pointer) (unsafe.Pointer, unsafe.Pointer, bool) { if m.Used() == 0 { return nil, nil, false } @@ -419,7 +419,7 @@ func (m *Map) getWithKey(typ *abi.SwissMapType, key unsafe.Pointer) (unsafe.Poin return m.directoryAt(idx).getWithKey(typ, hash, key) } -func (m *Map) getWithoutKey(typ *abi.SwissMapType, key unsafe.Pointer) (unsafe.Pointer, bool) { +func (m *Map) getWithoutKey(typ *abi.MapType, key unsafe.Pointer) (unsafe.Pointer, bool) { if m.Used() == 0 { return nil, false } @@ -439,7 +439,7 @@ func (m *Map) getWithoutKey(typ *abi.SwissMapType, key unsafe.Pointer) (unsafe.P return m.directoryAt(idx).getWithoutKey(typ, hash, key) } -func (m *Map) getWithKeySmall(typ *abi.SwissMapType, hash uintptr, key unsafe.Pointer) (unsafe.Pointer, unsafe.Pointer, bool) { +func (m *Map) getWithKeySmall(typ *abi.MapType, hash uintptr, key unsafe.Pointer) (unsafe.Pointer, unsafe.Pointer, bool) { g := groupReference{ data: m.dirPtr, } @@ -470,7 +470,7 @@ func (m *Map) getWithKeySmall(typ *abi.SwissMapType, hash uintptr, key unsafe.Po return nil, nil, false } -func (m *Map) Put(typ *abi.SwissMapType, key, elem unsafe.Pointer) { +func (m *Map) Put(typ *abi.MapType, key, elem unsafe.Pointer) { slotElem := m.PutSlot(typ, key) typedmemmove(typ.Elem, slotElem, elem) } @@ -479,7 +479,7 @@ func (m *Map) Put(typ *abi.SwissMapType, key, elem unsafe.Pointer) { // should be written. // // PutSlot never returns nil. -func (m *Map) PutSlot(typ *abi.SwissMapType, key unsafe.Pointer) unsafe.Pointer { +func (m *Map) PutSlot(typ *abi.MapType, key unsafe.Pointer) unsafe.Pointer { if m.writing != 0 { fatal("concurrent map writes") } @@ -495,7 +495,7 @@ func (m *Map) PutSlot(typ *abi.SwissMapType, key unsafe.Pointer) unsafe.Pointer } if m.dirLen == 0 { - if m.used < abi.SwissMapGroupSlots { + if m.used < abi.MapGroupSlots { elem := m.putSlotSmall(typ, hash, key) if m.writing == 0 { @@ -529,7 +529,7 @@ func (m *Map) PutSlot(typ *abi.SwissMapType, key unsafe.Pointer) unsafe.Pointer } } -func (m *Map) putSlotSmall(typ *abi.SwissMapType, hash uintptr, key unsafe.Pointer) unsafe.Pointer { +func (m *Map) putSlotSmall(typ *abi.MapType, hash uintptr, key unsafe.Pointer) unsafe.Pointer { g := groupReference{ data: m.dirPtr, } @@ -591,7 +591,7 @@ func (m *Map) putSlotSmall(typ *abi.SwissMapType, hash uintptr, key unsafe.Point return slotElem } -func (m *Map) growToSmall(typ *abi.SwissMapType) { +func (m *Map) growToSmall(typ *abi.MapType) { grp := newGroups(typ, 1) m.dirPtr = grp.data @@ -601,14 +601,14 @@ func (m *Map) growToSmall(typ *abi.SwissMapType) { g.ctrls().setEmpty() } -func (m *Map) growToTable(typ *abi.SwissMapType) { - tab := newTable(typ, 2*abi.SwissMapGroupSlots, 0, 0) +func (m *Map) growToTable(typ *abi.MapType) { + tab := newTable(typ, 2*abi.MapGroupSlots, 0, 0) g := groupReference{ data: m.dirPtr, } - for i := uintptr(0); i < abi.SwissMapGroupSlots; i++ { + for i := uintptr(0); i < abi.MapGroupSlots; i++ { if (g.ctrls().get(i) & ctrlEmpty) == ctrlEmpty { // Empty continue @@ -640,7 +640,7 @@ func (m *Map) growToTable(typ *abi.SwissMapType) { m.globalShift = depthToShift(m.globalDepth) } -func (m *Map) Delete(typ *abi.SwissMapType, key unsafe.Pointer) { +func (m *Map) Delete(typ *abi.MapType, key unsafe.Pointer) { if m == nil || m.Used() == 0 { if err := mapKeyError(typ, key); err != nil { panic(err) // see issue 23734 @@ -680,7 +680,7 @@ func (m *Map) Delete(typ *abi.SwissMapType, key unsafe.Pointer) { m.writing ^= 1 } -func (m *Map) deleteSmall(typ *abi.SwissMapType, hash uintptr, key unsafe.Pointer) { +func (m *Map) deleteSmall(typ *abi.MapType, hash uintptr, key unsafe.Pointer) { g := groupReference{ data: m.dirPtr, } @@ -728,7 +728,7 @@ func (m *Map) deleteSmall(typ *abi.SwissMapType, hash uintptr, key unsafe.Pointe } // Clear deletes all entries from the map resulting in an empty map. -func (m *Map) Clear(typ *abi.SwissMapType) { +func (m *Map) Clear(typ *abi.MapType) { if m == nil || m.Used() == 0 && !m.tombstonePossible { return } @@ -766,7 +766,7 @@ func (m *Map) Clear(typ *abi.SwissMapType) { m.writing ^= 1 } -func (m *Map) clearSmall(typ *abi.SwissMapType) { +func (m *Map) clearSmall(typ *abi.MapType) { g := groupReference{ data: m.dirPtr, } @@ -777,7 +777,7 @@ func (m *Map) clearSmall(typ *abi.SwissMapType) { m.used = 0 } -func (m *Map) Clone(typ *abi.SwissMapType) *Map { +func (m *Map) Clone(typ *abi.MapType) *Map { // Note: this should never be called with a nil map. if m.writing != 0 { fatal("concurrent map clone and map write") @@ -814,14 +814,7 @@ func (m *Map) Clone(typ *abi.SwissMapType) *Map { return m } -func OldMapKeyError(t *abi.OldMapType, p unsafe.Pointer) error { - if !t.HashMightPanic() { - return nil - } - return mapKeyError2(t.Key, p) -} - -func mapKeyError(t *abi.SwissMapType, p unsafe.Pointer) error { +func mapKeyError(t *abi.MapType, p unsafe.Pointer) error { if !t.HashMightPanic() { return nil } @@ -859,7 +852,7 @@ func mapKeyError2(t *abi.Type, p unsafe.Pointer) error { return unhashableTypeError{t} } - if t.Kind_&abi.KindDirectIface != 0 { + if t.IsDirectIface() { return mapKeyError2(t, unsafe.Pointer(pdata)) } else { return mapKeyError2(t, *pdata) diff --git a/src/internal/runtime/maps/map_swiss_test.go b/src/internal/runtime/maps/map_swiss_test.go deleted file mode 100644 index eef1c5b191..0000000000 --- a/src/internal/runtime/maps/map_swiss_test.go +++ /dev/null @@ -1,267 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Tests of map internals that need to use the builtin map type, and thus must -// be built with GOEXPERIMENT=swissmap. - -//go:build goexperiment.swissmap - -package maps_test - -import ( - "fmt" - "internal/abi" - "internal/runtime/maps" - "testing" - "unsafe" -) - -var alwaysFalse bool -var escapeSink any - -func escape[T any](x T) T { - if alwaysFalse { - escapeSink = x - } - return x -} - -const ( - belowMax = abi.SwissMapGroupSlots * 3 / 2 // 1.5 * group max = 2 groups @ 75% - atMax = (2 * abi.SwissMapGroupSlots * maps.MaxAvgGroupLoad) / abi.SwissMapGroupSlots // 2 groups at 7/8 full. -) - -func TestTableGroupCount(t *testing.T) { - // Test that maps of different sizes have the right number of - // tables/groups. - - type mapCount struct { - tables int - groups uint64 - } - - type mapCase struct { - initialLit mapCount - initialHint mapCount - after mapCount - } - - var testCases = []struct { - n int // n is the number of map elements - escape mapCase // expected values for escaping map - }{ - { - n: -(1 << 30), - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{0, 0}, - after: mapCount{0, 0}, - }, - }, - { - n: -1, - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{0, 0}, - after: mapCount{0, 0}, - }, - }, - { - n: 0, - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{0, 0}, - after: mapCount{0, 0}, - }, - }, - { - n: 1, - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{0, 0}, - after: mapCount{0, 1}, - }, - }, - { - n: abi.SwissMapGroupSlots, - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{0, 0}, - after: mapCount{0, 1}, - }, - }, - { - n: abi.SwissMapGroupSlots + 1, - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{1, 2}, - after: mapCount{1, 2}, - }, - }, - { - n: belowMax, // 1.5 group max = 2 groups @ 75% - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{1, 2}, - after: mapCount{1, 2}, - }, - }, - { - n: atMax, // 2 groups at max - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{1, 2}, - after: mapCount{1, 2}, - }, - }, - { - n: atMax + 1, // 2 groups at max + 1 -> grow to 4 groups - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{1, 4}, - after: mapCount{1, 4}, - }, - }, - { - n: 2 * belowMax, // 3 * group max = 4 groups @75% - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{1, 4}, - after: mapCount{1, 4}, - }, - }, - { - n: 2*atMax + 1, // 4 groups at max + 1 -> grow to 8 groups - escape: mapCase{ - initialLit: mapCount{0, 0}, - initialHint: mapCount{1, 8}, - after: mapCount{1, 8}, - }, - }, - } - - testMap := func(t *testing.T, m map[int]int, n int, initial, after mapCount) { - mm := *(**maps.Map)(unsafe.Pointer(&m)) - - gotTab := mm.TableCount() - if gotTab != initial.tables { - t.Errorf("initial TableCount got %d want %d", gotTab, initial.tables) - } - - gotGroup := mm.GroupCount() - if gotGroup != initial.groups { - t.Errorf("initial GroupCount got %d want %d", gotGroup, initial.groups) - } - - for i := 0; i < n; i++ { - m[i] = i - } - - gotTab = mm.TableCount() - if gotTab != after.tables { - t.Errorf("after TableCount got %d want %d", gotTab, after.tables) - } - - gotGroup = mm.GroupCount() - if gotGroup != after.groups { - t.Errorf("after GroupCount got %d want %d", gotGroup, after.groups) - } - } - - t.Run("mapliteral", func(t *testing.T) { - for _, tc := range testCases { - t.Run(fmt.Sprintf("n=%d", tc.n), func(t *testing.T) { - t.Run("escape", func(t *testing.T) { - m := escape(map[int]int{}) - testMap(t, m, tc.n, tc.escape.initialLit, tc.escape.after) - }) - }) - } - }) - t.Run("nohint", func(t *testing.T) { - for _, tc := range testCases { - t.Run(fmt.Sprintf("n=%d", tc.n), func(t *testing.T) { - t.Run("escape", func(t *testing.T) { - m := escape(make(map[int]int)) - testMap(t, m, tc.n, tc.escape.initialLit, tc.escape.after) - }) - }) - } - }) - t.Run("makemap", func(t *testing.T) { - for _, tc := range testCases { - t.Run(fmt.Sprintf("n=%d", tc.n), func(t *testing.T) { - t.Run("escape", func(t *testing.T) { - m := escape(make(map[int]int, tc.n)) - testMap(t, m, tc.n, tc.escape.initialHint, tc.escape.after) - }) - }) - } - }) - t.Run("makemap64", func(t *testing.T) { - for _, tc := range testCases { - t.Run(fmt.Sprintf("n=%d", tc.n), func(t *testing.T) { - t.Run("escape", func(t *testing.T) { - m := escape(make(map[int]int, int64(tc.n))) - testMap(t, m, tc.n, tc.escape.initialHint, tc.escape.after) - }) - }) - } - }) -} - -func TestTombstoneGrow(t *testing.T) { - tableSizes := []int{16, 32, 64, 128, 256} - for _, tableSize := range tableSizes { - for _, load := range []string{"low", "mid", "high"} { - capacity := tableSize * 7 / 8 - var initialElems int - switch load { - case "low": - initialElems = capacity / 8 - case "mid": - initialElems = capacity / 2 - case "high": - initialElems = capacity - } - t.Run(fmt.Sprintf("tableSize=%d/elems=%d/load=%0.3f", tableSize, initialElems, float64(initialElems)/float64(tableSize)), func(t *testing.T) { - allocs := testing.AllocsPerRun(1, func() { - // Fill the map with elements. - m := make(map[int]int, capacity) - for i := range initialElems { - m[i] = i - } - - // This is the heart of our test. - // Loop over the map repeatedly, deleting a key then adding a not-yet-seen key - // while keeping the map at a ~constant number of elements (+/-1). - nextKey := initialElems - for range 100000 { - for k := range m { - delete(m, k) - break - } - m[nextKey] = nextKey - nextKey++ - if len(m) != initialElems { - t.Fatal("len(m) should remain constant") - } - } - }) - - // The make has 4 allocs (map, directory, table, groups). - // Each growth has 2 allocs (table, groups). - // We allow two growths if we start full, 1 otherwise. - // Fail (somewhat arbitrarily) if there are more than that. - allowed := float64(4 + 1*2) - if initialElems == capacity { - allowed += 2 - } - if allocs > allowed { - t.Fatalf("got %v allocations, allowed %v", allocs, allowed) - } - }) - } - } -} diff --git a/src/internal/runtime/maps/map_test.go b/src/internal/runtime/maps/map_test.go index 160450ebb2..c8ef25af9a 100644 --- a/src/internal/runtime/maps/map_test.go +++ b/src/internal/runtime/maps/map_test.go @@ -15,8 +15,8 @@ import ( func TestCtrlSize(t *testing.T) { cs := unsafe.Sizeof(maps.CtrlGroup(0)) - if cs != abi.SwissMapGroupSlots { - t.Errorf("ctrlGroup size got %d want abi.SwissMapGroupSlots %d", cs, abi.SwissMapGroupSlots) + if cs != abi.MapGroupSlots { + t.Errorf("ctrlGroup size got %d want abi.MapGroupSlots %d", cs, abi.MapGroupSlots) } } @@ -630,7 +630,7 @@ func TestMapZeroSizeSlot(t *testing.T) { } func TestMapIndirect(t *testing.T) { - type big [abi.SwissMapMaxKeyBytes + abi.SwissMapMaxElemBytes]byte + type big [abi.MapMaxKeyBytes + abi.MapMaxElemBytes]byte m, typ := maps.NewTestMap[big, big](8) @@ -699,3 +699,252 @@ func TestMapDeleteClear(t *testing.T) { t.Errorf("Delete(%d) failed to clear element. got %d want 0", key, gotElem) } } + +var alwaysFalse bool +var escapeSink any + +func escape[T any](x T) T { + if alwaysFalse { + escapeSink = x + } + return x +} + +const ( + belowMax = abi.MapGroupSlots * 3 / 2 // 1.5 * group max = 2 groups @ 75% + atMax = (2 * abi.MapGroupSlots * maps.MaxAvgGroupLoad) / abi.MapGroupSlots // 2 groups at 7/8 full. +) + +func TestTableGroupCount(t *testing.T) { + // Test that maps of different sizes have the right number of + // tables/groups. + + type mapCount struct { + tables int + groups uint64 + } + + type mapCase struct { + initialLit mapCount + initialHint mapCount + after mapCount + } + + var testCases = []struct { + n int // n is the number of map elements + escape mapCase // expected values for escaping map + }{ + { + n: -(1 << 30), + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{0, 0}, + after: mapCount{0, 0}, + }, + }, + { + n: -1, + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{0, 0}, + after: mapCount{0, 0}, + }, + }, + { + n: 0, + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{0, 0}, + after: mapCount{0, 0}, + }, + }, + { + n: 1, + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{0, 0}, + after: mapCount{0, 1}, + }, + }, + { + n: abi.MapGroupSlots, + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{0, 0}, + after: mapCount{0, 1}, + }, + }, + { + n: abi.MapGroupSlots + 1, + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{1, 2}, + after: mapCount{1, 2}, + }, + }, + { + n: belowMax, // 1.5 group max = 2 groups @ 75% + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{1, 2}, + after: mapCount{1, 2}, + }, + }, + { + n: atMax, // 2 groups at max + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{1, 2}, + after: mapCount{1, 2}, + }, + }, + { + n: atMax + 1, // 2 groups at max + 1 -> grow to 4 groups + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{1, 4}, + after: mapCount{1, 4}, + }, + }, + { + n: 2 * belowMax, // 3 * group max = 4 groups @75% + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{1, 4}, + after: mapCount{1, 4}, + }, + }, + { + n: 2*atMax + 1, // 4 groups at max + 1 -> grow to 8 groups + escape: mapCase{ + initialLit: mapCount{0, 0}, + initialHint: mapCount{1, 8}, + after: mapCount{1, 8}, + }, + }, + } + + testMap := func(t *testing.T, m map[int]int, n int, initial, after mapCount) { + mm := *(**maps.Map)(unsafe.Pointer(&m)) + + gotTab := mm.TableCount() + if gotTab != initial.tables { + t.Errorf("initial TableCount got %d want %d", gotTab, initial.tables) + } + + gotGroup := mm.GroupCount() + if gotGroup != initial.groups { + t.Errorf("initial GroupCount got %d want %d", gotGroup, initial.groups) + } + + for i := 0; i < n; i++ { + m[i] = i + } + + gotTab = mm.TableCount() + if gotTab != after.tables { + t.Errorf("after TableCount got %d want %d", gotTab, after.tables) + } + + gotGroup = mm.GroupCount() + if gotGroup != after.groups { + t.Errorf("after GroupCount got %d want %d", gotGroup, after.groups) + } + } + + t.Run("mapliteral", func(t *testing.T) { + for _, tc := range testCases { + t.Run(fmt.Sprintf("n=%d", tc.n), func(t *testing.T) { + t.Run("escape", func(t *testing.T) { + m := escape(map[int]int{}) + testMap(t, m, tc.n, tc.escape.initialLit, tc.escape.after) + }) + }) + } + }) + t.Run("nohint", func(t *testing.T) { + for _, tc := range testCases { + t.Run(fmt.Sprintf("n=%d", tc.n), func(t *testing.T) { + t.Run("escape", func(t *testing.T) { + m := escape(make(map[int]int)) + testMap(t, m, tc.n, tc.escape.initialLit, tc.escape.after) + }) + }) + } + }) + t.Run("makemap", func(t *testing.T) { + for _, tc := range testCases { + t.Run(fmt.Sprintf("n=%d", tc.n), func(t *testing.T) { + t.Run("escape", func(t *testing.T) { + m := escape(make(map[int]int, tc.n)) + testMap(t, m, tc.n, tc.escape.initialHint, tc.escape.after) + }) + }) + } + }) + t.Run("makemap64", func(t *testing.T) { + for _, tc := range testCases { + t.Run(fmt.Sprintf("n=%d", tc.n), func(t *testing.T) { + t.Run("escape", func(t *testing.T) { + m := escape(make(map[int]int, int64(tc.n))) + testMap(t, m, tc.n, tc.escape.initialHint, tc.escape.after) + }) + }) + } + }) +} + +func TestTombstoneGrow(t *testing.T) { + tableSizes := []int{16, 32, 64, 128, 256} + for _, tableSize := range tableSizes { + for _, load := range []string{"low", "mid", "high"} { + capacity := tableSize * 7 / 8 + var initialElems int + switch load { + case "low": + initialElems = capacity / 8 + case "mid": + initialElems = capacity / 2 + case "high": + initialElems = capacity + } + t.Run(fmt.Sprintf("tableSize=%d/elems=%d/load=%0.3f", tableSize, initialElems, float64(initialElems)/float64(tableSize)), func(t *testing.T) { + allocs := testing.AllocsPerRun(1, func() { + // Fill the map with elements. + m := make(map[int]int, capacity) + for i := range initialElems { + m[i] = i + } + + // This is the heart of our test. + // Loop over the map repeatedly, deleting a key then adding a not-yet-seen key + // while keeping the map at a ~constant number of elements (+/-1). + nextKey := initialElems + for range 100000 { + for k := range m { + delete(m, k) + break + } + m[nextKey] = nextKey + nextKey++ + if len(m) != initialElems { + t.Fatal("len(m) should remain constant") + } + } + }) + + // The make has 4 allocs (map, directory, table, groups). + // Each growth has 2 allocs (table, groups). + // We allow two growths if we start full, 1 otherwise. + // Fail (somewhat arbitrarily) if there are more than that. + allowed := float64(4 + 1*2) + if initialElems == capacity { + allowed += 2 + } + if allocs > allowed { + t.Fatalf("got %v allocations, allowed %v", allocs, allowed) + } + }) + } + } +} diff --git a/src/internal/runtime/maps/runtime.go b/src/internal/runtime/maps/runtime.go index 3d06f54f4d..ff8a748249 100644 --- a/src/internal/runtime/maps/runtime.go +++ b/src/internal/runtime/maps/runtime.go @@ -6,6 +6,10 @@ package maps import ( "internal/abi" + "internal/asan" + "internal/msan" + "internal/race" + "internal/runtime/sys" "unsafe" ) @@ -28,3 +32,337 @@ func newarray(typ *abi.Type, n int) unsafe.Pointer //go:linkname newobject func newobject(typ *abi.Type) unsafe.Pointer + +// Pushed from runtime in order to use runtime.plainError +// +//go:linkname errNilAssign +var errNilAssign error + +// Pull from runtime. It is important that is this the exact same copy as the +// runtime because runtime.mapaccess1_fat compares the returned pointer with +// &runtime.zeroVal[0]. +// TODO: move zeroVal to internal/abi? +// +//go:linkname zeroVal runtime.zeroVal +var zeroVal [abi.ZeroValSize]byte + +// mapaccess1 returns a pointer to h[key]. Never returns nil, instead +// it will return a reference to the zero object for the elem type if +// the key is not in the map. +// NOTE: The returned pointer may keep the whole map live, so don't +// hold onto it for very long. +// +//go:linkname runtime_mapaccess1 runtime.mapaccess1 +func runtime_mapaccess1(typ *abi.MapType, m *Map, key unsafe.Pointer) unsafe.Pointer { + if race.Enabled && m != nil { + callerpc := sys.GetCallerPC() + pc := abi.FuncPCABIInternal(runtime_mapaccess1) + race.ReadPC(unsafe.Pointer(m), callerpc, pc) + race.ReadObjectPC(typ.Key, key, callerpc, pc) + } + if msan.Enabled && m != nil { + msan.Read(key, typ.Key.Size_) + } + if asan.Enabled && m != nil { + asan.Read(key, typ.Key.Size_) + } + + if m == nil || m.Used() == 0 { + if err := mapKeyError(typ, key); err != nil { + panic(err) // see issue 23734 + } + return unsafe.Pointer(&zeroVal[0]) + } + + if m.writing != 0 { + fatal("concurrent map read and map write") + } + + hash := typ.Hasher(key, m.seed) + + if m.dirLen <= 0 { + _, elem, ok := m.getWithKeySmall(typ, hash, key) + if !ok { + return unsafe.Pointer(&zeroVal[0]) + } + return elem + } + + // Select table. + idx := m.directoryIndex(hash) + t := m.directoryAt(idx) + + // Probe table. + seq := makeProbeSeq(h1(hash), t.groups.lengthMask) + for ; ; seq = seq.next() { + g := t.groups.group(typ, seq.offset) + + match := g.ctrls().matchH2(h2(hash)) + + for match != 0 { + i := match.first() + + slotKey := g.key(typ, i) + slotKeyOrig := slotKey + if typ.IndirectKey() { + slotKey = *((*unsafe.Pointer)(slotKey)) + } + if typ.Key.Equal(key, slotKey) { + slotElem := unsafe.Pointer(uintptr(slotKeyOrig) + typ.ElemOff) + if typ.IndirectElem() { + slotElem = *((*unsafe.Pointer)(slotElem)) + } + return slotElem + } + match = match.removeFirst() + } + + match = g.ctrls().matchEmpty() + if match != 0 { + // Finding an empty slot means we've reached the end of + // the probe sequence. + return unsafe.Pointer(&zeroVal[0]) + } + } +} + +//go:linkname runtime_mapaccess2 runtime.mapaccess2 +func runtime_mapaccess2(typ *abi.MapType, m *Map, key unsafe.Pointer) (unsafe.Pointer, bool) { + if race.Enabled && m != nil { + callerpc := sys.GetCallerPC() + pc := abi.FuncPCABIInternal(runtime_mapaccess1) + race.ReadPC(unsafe.Pointer(m), callerpc, pc) + race.ReadObjectPC(typ.Key, key, callerpc, pc) + } + if msan.Enabled && m != nil { + msan.Read(key, typ.Key.Size_) + } + if asan.Enabled && m != nil { + asan.Read(key, typ.Key.Size_) + } + + if m == nil || m.Used() == 0 { + if err := mapKeyError(typ, key); err != nil { + panic(err) // see issue 23734 + } + return unsafe.Pointer(&zeroVal[0]), false + } + + if m.writing != 0 { + fatal("concurrent map read and map write") + } + + hash := typ.Hasher(key, m.seed) + + if m.dirLen == 0 { + _, elem, ok := m.getWithKeySmall(typ, hash, key) + if !ok { + return unsafe.Pointer(&zeroVal[0]), false + } + return elem, true + } + + // Select table. + idx := m.directoryIndex(hash) + t := m.directoryAt(idx) + + // Probe table. + seq := makeProbeSeq(h1(hash), t.groups.lengthMask) + for ; ; seq = seq.next() { + g := t.groups.group(typ, seq.offset) + + match := g.ctrls().matchH2(h2(hash)) + + for match != 0 { + i := match.first() + + slotKey := g.key(typ, i) + slotKeyOrig := slotKey + if typ.IndirectKey() { + slotKey = *((*unsafe.Pointer)(slotKey)) + } + if typ.Key.Equal(key, slotKey) { + slotElem := unsafe.Pointer(uintptr(slotKeyOrig) + typ.ElemOff) + if typ.IndirectElem() { + slotElem = *((*unsafe.Pointer)(slotElem)) + } + return slotElem, true + } + match = match.removeFirst() + } + + match = g.ctrls().matchEmpty() + if match != 0 { + // Finding an empty slot means we've reached the end of + // the probe sequence. + return unsafe.Pointer(&zeroVal[0]), false + } + } +} + +//go:linkname runtime_mapassign runtime.mapassign +func runtime_mapassign(typ *abi.MapType, m *Map, key unsafe.Pointer) unsafe.Pointer { + if m == nil { + panic(errNilAssign) + } + if race.Enabled { + callerpc := sys.GetCallerPC() + pc := abi.FuncPCABIInternal(runtime_mapassign) + race.WritePC(unsafe.Pointer(m), callerpc, pc) + race.ReadObjectPC(typ.Key, key, callerpc, pc) + } + if msan.Enabled { + msan.Read(key, typ.Key.Size_) + } + if asan.Enabled { + asan.Read(key, typ.Key.Size_) + } + if m.writing != 0 { + fatal("concurrent map writes") + } + + hash := typ.Hasher(key, m.seed) + + // Set writing after calling Hasher, since Hasher may panic, in which + // case we have not actually done a write. + m.writing ^= 1 // toggle, see comment on writing + + if m.dirPtr == nil { + m.growToSmall(typ) + } + + if m.dirLen == 0 { + if m.used < abi.MapGroupSlots { + elem := m.putSlotSmall(typ, hash, key) + + if m.writing == 0 { + fatal("concurrent map writes") + } + m.writing ^= 1 + + return elem + } + + // Can't fit another entry, grow to full size map. + m.growToTable(typ) + } + + var slotElem unsafe.Pointer +outer: + for { + // Select table. + idx := m.directoryIndex(hash) + t := m.directoryAt(idx) + + seq := makeProbeSeq(h1(hash), t.groups.lengthMask) + + // As we look for a match, keep track of the first deleted slot + // we find, which we'll use to insert the new entry if + // necessary. + var firstDeletedGroup groupReference + var firstDeletedSlot uintptr + + for ; ; seq = seq.next() { + g := t.groups.group(typ, seq.offset) + match := g.ctrls().matchH2(h2(hash)) + + // Look for an existing slot containing this key. + for match != 0 { + i := match.first() + + slotKey := g.key(typ, i) + slotKeyOrig := slotKey + if typ.IndirectKey() { + slotKey = *((*unsafe.Pointer)(slotKey)) + } + if typ.Key.Equal(key, slotKey) { + if typ.NeedKeyUpdate() { + typedmemmove(typ.Key, slotKey, key) + } + + slotElem = unsafe.Pointer(uintptr(slotKeyOrig) + typ.ElemOff) + if typ.IndirectElem() { + slotElem = *((*unsafe.Pointer)(slotElem)) + } + + t.checkInvariants(typ, m) + break outer + } + match = match.removeFirst() + } + + // No existing slot for this key in this group. Is this the end + // of the probe sequence? + match = g.ctrls().matchEmpty() + if match != 0 { + // Finding an empty slot means we've reached the end of + // the probe sequence. + + var i uintptr + + // If we found a deleted slot along the way, we + // can replace it without consuming growthLeft. + if firstDeletedGroup.data != nil { + g = firstDeletedGroup + i = firstDeletedSlot + t.growthLeft++ // will be decremented below to become a no-op. + } else { + // Otherwise, use the empty slot. + i = match.first() + } + + // If there is room left to grow, just insert the new entry. + if t.growthLeft > 0 { + slotKey := g.key(typ, i) + slotKeyOrig := slotKey + if typ.IndirectKey() { + kmem := newobject(typ.Key) + *(*unsafe.Pointer)(slotKey) = kmem + slotKey = kmem + } + typedmemmove(typ.Key, slotKey, key) + + slotElem = unsafe.Pointer(uintptr(slotKeyOrig) + typ.ElemOff) + if typ.IndirectElem() { + emem := newobject(typ.Elem) + *(*unsafe.Pointer)(slotElem) = emem + slotElem = emem + } + + g.ctrls().set(i, ctrl(h2(hash))) + t.growthLeft-- + t.used++ + m.used++ + + t.checkInvariants(typ, m) + break outer + } + + t.rehash(typ, m) + continue outer + } + + // No empty slots in this group. Check for a deleted + // slot, which we'll use if we don't find a match later + // in the probe sequence. + // + // We only need to remember a single deleted slot. + if firstDeletedGroup.data == nil { + // Since we already checked for empty slots + // above, matches here must be deleted slots. + match = g.ctrls().matchEmptyOrDeleted() + if match != 0 { + firstDeletedGroup = g + firstDeletedSlot = match.first() + } + } + } + } + + if m.writing == 0 { + fatal("concurrent map writes") + } + m.writing ^= 1 + + return slotElem +} diff --git a/src/internal/runtime/maps/runtime_fast32_swiss.go b/src/internal/runtime/maps/runtime_fast32.go index d57d042527..beed67ce28 100644 --- a/src/internal/runtime/maps/runtime_fast32_swiss.go +++ b/src/internal/runtime/maps/runtime_fast32.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.swissmap - package maps import ( @@ -14,7 +12,7 @@ import ( ) //go:linkname runtime_mapaccess1_fast32 runtime.mapaccess1_fast32 -func runtime_mapaccess1_fast32(typ *abi.SwissMapType, m *Map, key uint32) unsafe.Pointer { +func runtime_mapaccess1_fast32(typ *abi.MapType, m *Map, key uint32) unsafe.Pointer { if race.Enabled && m != nil { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(runtime_mapaccess1_fast32) @@ -83,7 +81,7 @@ func runtime_mapaccess1_fast32(typ *abi.SwissMapType, m *Map, key uint32) unsafe } //go:linkname runtime_mapaccess2_fast32 runtime.mapaccess2_fast32 -func runtime_mapaccess2_fast32(typ *abi.SwissMapType, m *Map, key uint32) (unsafe.Pointer, bool) { +func runtime_mapaccess2_fast32(typ *abi.MapType, m *Map, key uint32) (unsafe.Pointer, bool) { if race.Enabled && m != nil { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(runtime_mapaccess2_fast32) @@ -151,7 +149,7 @@ func runtime_mapaccess2_fast32(typ *abi.SwissMapType, m *Map, key uint32) (unsaf } } -func (m *Map) putSlotSmallFast32(typ *abi.SwissMapType, hash uintptr, key uint32) unsafe.Pointer { +func (m *Map) putSlotSmallFast32(typ *abi.MapType, hash uintptr, key uint32) unsafe.Pointer { g := groupReference{ data: m.dirPtr, } @@ -192,7 +190,7 @@ func (m *Map) putSlotSmallFast32(typ *abi.SwissMapType, hash uintptr, key uint32 } //go:linkname runtime_mapassign_fast32 runtime.mapassign_fast32 -func runtime_mapassign_fast32(typ *abi.SwissMapType, m *Map, key uint32) unsafe.Pointer { +func runtime_mapassign_fast32(typ *abi.MapType, m *Map, key uint32) unsafe.Pointer { if m == nil { panic(errNilAssign) } @@ -217,7 +215,7 @@ func runtime_mapassign_fast32(typ *abi.SwissMapType, m *Map, key uint32) unsafe. } if m.dirLen == 0 { - if m.used < abi.SwissMapGroupSlots { + if m.used < abi.MapGroupSlots { elem := m.putSlotSmallFast32(typ, hash, key) if m.writing == 0 { @@ -331,7 +329,7 @@ outer: // TODO(prattmic): With some compiler refactoring we could avoid duplication of this function. // //go:linkname runtime_mapassign_fast32ptr runtime.mapassign_fast32ptr -func runtime_mapassign_fast32ptr(typ *abi.SwissMapType, m *Map, key unsafe.Pointer) unsafe.Pointer { +func runtime_mapassign_fast32ptr(typ *abi.MapType, m *Map, key unsafe.Pointer) unsafe.Pointer { if m == nil { panic(errNilAssign) } @@ -356,7 +354,7 @@ func runtime_mapassign_fast32ptr(typ *abi.SwissMapType, m *Map, key unsafe.Point } if m.dirLen == 0 { - if m.used < abi.SwissMapGroupSlots { + if m.used < abi.MapGroupSlots { elem := m.putSlotSmallFastPtr(typ, hash, key) if m.writing == 0 { @@ -460,7 +458,7 @@ outer: } //go:linkname runtime_mapdelete_fast32 runtime.mapdelete_fast32 -func runtime_mapdelete_fast32(typ *abi.SwissMapType, m *Map, key uint32) { +func runtime_mapdelete_fast32(typ *abi.MapType, m *Map, key uint32) { if race.Enabled { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(runtime_mapdelete_fast32) diff --git a/src/internal/runtime/maps/runtime_fast64_swiss.go b/src/internal/runtime/maps/runtime_fast64.go index 461cb1d318..2f9cf28daa 100644 --- a/src/internal/runtime/maps/runtime_fast64_swiss.go +++ b/src/internal/runtime/maps/runtime_fast64.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.swissmap - package maps import ( @@ -14,7 +12,7 @@ import ( ) //go:linkname runtime_mapaccess1_fast64 runtime.mapaccess1_fast64 -func runtime_mapaccess1_fast64(typ *abi.SwissMapType, m *Map, key uint64) unsafe.Pointer { +func runtime_mapaccess1_fast64(typ *abi.MapType, m *Map, key uint64) unsafe.Pointer { if race.Enabled && m != nil { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(runtime_mapaccess1_fast64) @@ -83,7 +81,7 @@ func runtime_mapaccess1_fast64(typ *abi.SwissMapType, m *Map, key uint64) unsafe } //go:linkname runtime_mapaccess2_fast64 runtime.mapaccess2_fast64 -func runtime_mapaccess2_fast64(typ *abi.SwissMapType, m *Map, key uint64) (unsafe.Pointer, bool) { +func runtime_mapaccess2_fast64(typ *abi.MapType, m *Map, key uint64) (unsafe.Pointer, bool) { if race.Enabled && m != nil { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(runtime_mapaccess2_fast64) @@ -151,7 +149,7 @@ func runtime_mapaccess2_fast64(typ *abi.SwissMapType, m *Map, key uint64) (unsaf } } -func (m *Map) putSlotSmallFast64(typ *abi.SwissMapType, hash uintptr, key uint64) unsafe.Pointer { +func (m *Map) putSlotSmallFast64(typ *abi.MapType, hash uintptr, key uint64) unsafe.Pointer { g := groupReference{ data: m.dirPtr, } @@ -192,7 +190,7 @@ func (m *Map) putSlotSmallFast64(typ *abi.SwissMapType, hash uintptr, key uint64 } //go:linkname runtime_mapassign_fast64 runtime.mapassign_fast64 -func runtime_mapassign_fast64(typ *abi.SwissMapType, m *Map, key uint64) unsafe.Pointer { +func runtime_mapassign_fast64(typ *abi.MapType, m *Map, key uint64) unsafe.Pointer { if m == nil { panic(errNilAssign) } @@ -217,7 +215,7 @@ func runtime_mapassign_fast64(typ *abi.SwissMapType, m *Map, key uint64) unsafe. } if m.dirLen == 0 { - if m.used < abi.SwissMapGroupSlots { + if m.used < abi.MapGroupSlots { elem := m.putSlotSmallFast64(typ, hash, key) if m.writing == 0 { @@ -326,7 +324,7 @@ outer: return slotElem } -func (m *Map) putSlotSmallFastPtr(typ *abi.SwissMapType, hash uintptr, key unsafe.Pointer) unsafe.Pointer { +func (m *Map) putSlotSmallFastPtr(typ *abi.MapType, hash uintptr, key unsafe.Pointer) unsafe.Pointer { g := groupReference{ data: m.dirPtr, } @@ -369,7 +367,7 @@ func (m *Map) putSlotSmallFastPtr(typ *abi.SwissMapType, hash uintptr, key unsaf // Key is a 64-bit pointer (only called on 64-bit GOARCH). // //go:linkname runtime_mapassign_fast64ptr runtime.mapassign_fast64ptr -func runtime_mapassign_fast64ptr(typ *abi.SwissMapType, m *Map, key unsafe.Pointer) unsafe.Pointer { +func runtime_mapassign_fast64ptr(typ *abi.MapType, m *Map, key unsafe.Pointer) unsafe.Pointer { if m == nil { panic(errNilAssign) } @@ -394,7 +392,7 @@ func runtime_mapassign_fast64ptr(typ *abi.SwissMapType, m *Map, key unsafe.Point } if m.dirLen == 0 { - if m.used < abi.SwissMapGroupSlots { + if m.used < abi.MapGroupSlots { elem := m.putSlotSmallFastPtr(typ, hash, key) if m.writing == 0 { @@ -499,7 +497,7 @@ outer: } //go:linkname runtime_mapdelete_fast64 runtime.mapdelete_fast64 -func runtime_mapdelete_fast64(typ *abi.SwissMapType, m *Map, key uint64) { +func runtime_mapdelete_fast64(typ *abi.MapType, m *Map, key uint64) { if race.Enabled { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(runtime_mapdelete_fast64) diff --git a/src/internal/runtime/maps/runtime_faststr_swiss.go b/src/internal/runtime/maps/runtime_faststr.go index 0d7b02e20c..ddac7eacc5 100644 --- a/src/internal/runtime/maps/runtime_faststr_swiss.go +++ b/src/internal/runtime/maps/runtime_faststr.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.swissmap - package maps import ( @@ -14,7 +12,7 @@ import ( "unsafe" ) -func (m *Map) getWithoutKeySmallFastStr(typ *abi.SwissMapType, key string) unsafe.Pointer { +func (m *Map) getWithoutKeySmallFastStr(typ *abi.MapType, key string) unsafe.Pointer { g := groupReference{ data: m.dirPtr, } @@ -29,10 +27,10 @@ func (m *Map) getWithoutKeySmallFastStr(typ *abi.SwissMapType, key string) unsaf // for strings that are long enough that hashing is expensive. if len(key) > 64 { // String hashing and equality might be expensive. Do a quick check first. - j := abi.SwissMapGroupSlots - for i := range abi.SwissMapGroupSlots { + j := abi.MapGroupSlots + for i := range abi.MapGroupSlots { if ctrls&(1<<7) == 0 && longStringQuickEqualityTest(key, *(*string)(slotKey)) { - if j < abi.SwissMapGroupSlots { + if j < abi.MapGroupSlots { // 2 strings both passed the quick equality test. // Break out of this loop and do it the slow way. goto dohash @@ -42,7 +40,7 @@ func (m *Map) getWithoutKeySmallFastStr(typ *abi.SwissMapType, key string) unsaf slotKey = unsafe.Pointer(uintptr(slotKey) + slotSize) ctrls >>= 8 } - if j == abi.SwissMapGroupSlots { + if j == abi.MapGroupSlots { // No slot passed the quick test. return nil } @@ -61,7 +59,7 @@ dohash: ctrls = *g.ctrls() slotKey = g.key(typ, 0) - for range abi.SwissMapGroupSlots { + for range abi.MapGroupSlots { if uint8(ctrls) == h2 && key == *(*string)(slotKey) { return unsafe.Pointer(uintptr(slotKey) + 2*goarch.PtrSize) } @@ -100,7 +98,7 @@ func stringPtr(s string) unsafe.Pointer { } //go:linkname runtime_mapaccess1_faststr runtime.mapaccess1_faststr -func runtime_mapaccess1_faststr(typ *abi.SwissMapType, m *Map, key string) unsafe.Pointer { +func runtime_mapaccess1_faststr(typ *abi.MapType, m *Map, key string) unsafe.Pointer { if race.Enabled && m != nil { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(runtime_mapaccess1_faststr) @@ -159,7 +157,7 @@ func runtime_mapaccess1_faststr(typ *abi.SwissMapType, m *Map, key string) unsaf } //go:linkname runtime_mapaccess2_faststr runtime.mapaccess2_faststr -func runtime_mapaccess2_faststr(typ *abi.SwissMapType, m *Map, key string) (unsafe.Pointer, bool) { +func runtime_mapaccess2_faststr(typ *abi.MapType, m *Map, key string) (unsafe.Pointer, bool) { if race.Enabled && m != nil { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(runtime_mapaccess2_faststr) @@ -217,7 +215,7 @@ func runtime_mapaccess2_faststr(typ *abi.SwissMapType, m *Map, key string) (unsa } } -func (m *Map) putSlotSmallFastStr(typ *abi.SwissMapType, hash uintptr, key string) unsafe.Pointer { +func (m *Map) putSlotSmallFastStr(typ *abi.MapType, hash uintptr, key string) unsafe.Pointer { g := groupReference{ data: m.dirPtr, } @@ -260,7 +258,7 @@ func (m *Map) putSlotSmallFastStr(typ *abi.SwissMapType, hash uintptr, key strin } //go:linkname runtime_mapassign_faststr runtime.mapassign_faststr -func runtime_mapassign_faststr(typ *abi.SwissMapType, m *Map, key string) unsafe.Pointer { +func runtime_mapassign_faststr(typ *abi.MapType, m *Map, key string) unsafe.Pointer { if m == nil { panic(errNilAssign) } @@ -285,7 +283,7 @@ func runtime_mapassign_faststr(typ *abi.SwissMapType, m *Map, key string) unsafe } if m.dirLen == 0 { - if m.used < abi.SwissMapGroupSlots { + if m.used < abi.MapGroupSlots { elem := m.putSlotSmallFastStr(typ, hash, key) if m.writing == 0 { @@ -398,7 +396,7 @@ outer: } //go:linkname runtime_mapdelete_faststr runtime.mapdelete_faststr -func runtime_mapdelete_faststr(typ *abi.SwissMapType, m *Map, key string) { +func runtime_mapdelete_faststr(typ *abi.MapType, m *Map, key string) { if race.Enabled { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(runtime_mapdelete_faststr) diff --git a/src/internal/runtime/maps/runtime_swiss.go b/src/internal/runtime/maps/runtime_swiss.go deleted file mode 100644 index 3ea018185b..0000000000 --- a/src/internal/runtime/maps/runtime_swiss.go +++ /dev/null @@ -1,352 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build goexperiment.swissmap - -package maps - -import ( - "internal/abi" - "internal/asan" - "internal/msan" - "internal/race" - "internal/runtime/sys" - "unsafe" -) - -// Functions below pushed from runtime. - -// Pushed from runtime in order to use runtime.plainError -// -//go:linkname errNilAssign -var errNilAssign error - -// Pull from runtime. It is important that is this the exact same copy as the -// runtime because runtime.mapaccess1_fat compares the returned pointer with -// &runtime.zeroVal[0]. -// TODO: move zeroVal to internal/abi? -// -//go:linkname zeroVal runtime.zeroVal -var zeroVal [abi.ZeroValSize]byte - -// mapaccess1 returns a pointer to h[key]. Never returns nil, instead -// it will return a reference to the zero object for the elem type if -// the key is not in the map. -// NOTE: The returned pointer may keep the whole map live, so don't -// hold onto it for very long. -// -//go:linkname runtime_mapaccess1 runtime.mapaccess1 -func runtime_mapaccess1(typ *abi.SwissMapType, m *Map, key unsafe.Pointer) unsafe.Pointer { - if race.Enabled && m != nil { - callerpc := sys.GetCallerPC() - pc := abi.FuncPCABIInternal(runtime_mapaccess1) - race.ReadPC(unsafe.Pointer(m), callerpc, pc) - race.ReadObjectPC(typ.Key, key, callerpc, pc) - } - if msan.Enabled && m != nil { - msan.Read(key, typ.Key.Size_) - } - if asan.Enabled && m != nil { - asan.Read(key, typ.Key.Size_) - } - - if m == nil || m.Used() == 0 { - if err := mapKeyError(typ, key); err != nil { - panic(err) // see issue 23734 - } - return unsafe.Pointer(&zeroVal[0]) - } - - if m.writing != 0 { - fatal("concurrent map read and map write") - } - - hash := typ.Hasher(key, m.seed) - - if m.dirLen <= 0 { - _, elem, ok := m.getWithKeySmall(typ, hash, key) - if !ok { - return unsafe.Pointer(&zeroVal[0]) - } - return elem - } - - // Select table. - idx := m.directoryIndex(hash) - t := m.directoryAt(idx) - - // Probe table. - seq := makeProbeSeq(h1(hash), t.groups.lengthMask) - for ; ; seq = seq.next() { - g := t.groups.group(typ, seq.offset) - - match := g.ctrls().matchH2(h2(hash)) - - for match != 0 { - i := match.first() - - slotKey := g.key(typ, i) - slotKeyOrig := slotKey - if typ.IndirectKey() { - slotKey = *((*unsafe.Pointer)(slotKey)) - } - if typ.Key.Equal(key, slotKey) { - slotElem := unsafe.Pointer(uintptr(slotKeyOrig) + typ.ElemOff) - if typ.IndirectElem() { - slotElem = *((*unsafe.Pointer)(slotElem)) - } - return slotElem - } - match = match.removeFirst() - } - - match = g.ctrls().matchEmpty() - if match != 0 { - // Finding an empty slot means we've reached the end of - // the probe sequence. - return unsafe.Pointer(&zeroVal[0]) - } - } -} - -//go:linkname runtime_mapaccess2 runtime.mapaccess2 -func runtime_mapaccess2(typ *abi.SwissMapType, m *Map, key unsafe.Pointer) (unsafe.Pointer, bool) { - if race.Enabled && m != nil { - callerpc := sys.GetCallerPC() - pc := abi.FuncPCABIInternal(runtime_mapaccess1) - race.ReadPC(unsafe.Pointer(m), callerpc, pc) - race.ReadObjectPC(typ.Key, key, callerpc, pc) - } - if msan.Enabled && m != nil { - msan.Read(key, typ.Key.Size_) - } - if asan.Enabled && m != nil { - asan.Read(key, typ.Key.Size_) - } - - if m == nil || m.Used() == 0 { - if err := mapKeyError(typ, key); err != nil { - panic(err) // see issue 23734 - } - return unsafe.Pointer(&zeroVal[0]), false - } - - if m.writing != 0 { - fatal("concurrent map read and map write") - } - - hash := typ.Hasher(key, m.seed) - - if m.dirLen == 0 { - _, elem, ok := m.getWithKeySmall(typ, hash, key) - if !ok { - return unsafe.Pointer(&zeroVal[0]), false - } - return elem, true - } - - // Select table. - idx := m.directoryIndex(hash) - t := m.directoryAt(idx) - - // Probe table. - seq := makeProbeSeq(h1(hash), t.groups.lengthMask) - for ; ; seq = seq.next() { - g := t.groups.group(typ, seq.offset) - - match := g.ctrls().matchH2(h2(hash)) - - for match != 0 { - i := match.first() - - slotKey := g.key(typ, i) - slotKeyOrig := slotKey - if typ.IndirectKey() { - slotKey = *((*unsafe.Pointer)(slotKey)) - } - if typ.Key.Equal(key, slotKey) { - slotElem := unsafe.Pointer(uintptr(slotKeyOrig) + typ.ElemOff) - if typ.IndirectElem() { - slotElem = *((*unsafe.Pointer)(slotElem)) - } - return slotElem, true - } - match = match.removeFirst() - } - - match = g.ctrls().matchEmpty() - if match != 0 { - // Finding an empty slot means we've reached the end of - // the probe sequence. - return unsafe.Pointer(&zeroVal[0]), false - } - } -} - -//go:linkname runtime_mapassign runtime.mapassign -func runtime_mapassign(typ *abi.SwissMapType, m *Map, key unsafe.Pointer) unsafe.Pointer { - if m == nil { - panic(errNilAssign) - } - if race.Enabled { - callerpc := sys.GetCallerPC() - pc := abi.FuncPCABIInternal(runtime_mapassign) - race.WritePC(unsafe.Pointer(m), callerpc, pc) - race.ReadObjectPC(typ.Key, key, callerpc, pc) - } - if msan.Enabled { - msan.Read(key, typ.Key.Size_) - } - if asan.Enabled { - asan.Read(key, typ.Key.Size_) - } - if m.writing != 0 { - fatal("concurrent map writes") - } - - hash := typ.Hasher(key, m.seed) - - // Set writing after calling Hasher, since Hasher may panic, in which - // case we have not actually done a write. - m.writing ^= 1 // toggle, see comment on writing - - if m.dirPtr == nil { - m.growToSmall(typ) - } - - if m.dirLen == 0 { - if m.used < abi.SwissMapGroupSlots { - elem := m.putSlotSmall(typ, hash, key) - - if m.writing == 0 { - fatal("concurrent map writes") - } - m.writing ^= 1 - - return elem - } - - // Can't fit another entry, grow to full size map. - m.growToTable(typ) - } - - var slotElem unsafe.Pointer -outer: - for { - // Select table. - idx := m.directoryIndex(hash) - t := m.directoryAt(idx) - - seq := makeProbeSeq(h1(hash), t.groups.lengthMask) - - // As we look for a match, keep track of the first deleted slot - // we find, which we'll use to insert the new entry if - // necessary. - var firstDeletedGroup groupReference - var firstDeletedSlot uintptr - - for ; ; seq = seq.next() { - g := t.groups.group(typ, seq.offset) - match := g.ctrls().matchH2(h2(hash)) - - // Look for an existing slot containing this key. - for match != 0 { - i := match.first() - - slotKey := g.key(typ, i) - slotKeyOrig := slotKey - if typ.IndirectKey() { - slotKey = *((*unsafe.Pointer)(slotKey)) - } - if typ.Key.Equal(key, slotKey) { - if typ.NeedKeyUpdate() { - typedmemmove(typ.Key, slotKey, key) - } - - slotElem = unsafe.Pointer(uintptr(slotKeyOrig) + typ.ElemOff) - if typ.IndirectElem() { - slotElem = *((*unsafe.Pointer)(slotElem)) - } - - t.checkInvariants(typ, m) - break outer - } - match = match.removeFirst() - } - - // No existing slot for this key in this group. Is this the end - // of the probe sequence? - match = g.ctrls().matchEmpty() - if match != 0 { - // Finding an empty slot means we've reached the end of - // the probe sequence. - - var i uintptr - - // If we found a deleted slot along the way, we - // can replace it without consuming growthLeft. - if firstDeletedGroup.data != nil { - g = firstDeletedGroup - i = firstDeletedSlot - t.growthLeft++ // will be decremented below to become a no-op. - } else { - // Otherwise, use the empty slot. - i = match.first() - } - - // If there is room left to grow, just insert the new entry. - if t.growthLeft > 0 { - slotKey := g.key(typ, i) - slotKeyOrig := slotKey - if typ.IndirectKey() { - kmem := newobject(typ.Key) - *(*unsafe.Pointer)(slotKey) = kmem - slotKey = kmem - } - typedmemmove(typ.Key, slotKey, key) - - slotElem = unsafe.Pointer(uintptr(slotKeyOrig) + typ.ElemOff) - if typ.IndirectElem() { - emem := newobject(typ.Elem) - *(*unsafe.Pointer)(slotElem) = emem - slotElem = emem - } - - g.ctrls().set(i, ctrl(h2(hash))) - t.growthLeft-- - t.used++ - m.used++ - - t.checkInvariants(typ, m) - break outer - } - - t.rehash(typ, m) - continue outer - } - - // No empty slots in this group. Check for a deleted - // slot, which we'll use if we don't find a match later - // in the probe sequence. - // - // We only need to remember a single deleted slot. - if firstDeletedGroup.data == nil { - // Since we already checked for empty slots - // above, matches here must be deleted slots. - match = g.ctrls().matchEmptyOrDeleted() - if match != 0 { - firstDeletedGroup = g - firstDeletedSlot = match.first() - } - } - } - } - - if m.writing == 0 { - fatal("concurrent map writes") - } - m.writing ^= 1 - - return slotElem -} diff --git a/src/internal/runtime/maps/table.go b/src/internal/runtime/maps/table.go index 88f87187fe..d4b9276b57 100644 --- a/src/internal/runtime/maps/table.go +++ b/src/internal/runtime/maps/table.go @@ -36,7 +36,7 @@ type table struct { used uint16 // The total number of slots (always 2^N). Equal to - // `(groups.lengthMask+1)*abi.SwissMapGroupSlots`. + // `(groups.lengthMask+1)*abi.MapGroupSlots`. capacity uint16 // The number of slots we can still fill without needing to rehash. @@ -53,13 +53,13 @@ type table struct { // Index of this table in the Map directory. This is the index of the // _first_ location in the directory. The table may occur in multiple - // sequential indicies. + // sequential indices. // // index is -1 if the table is stale (no longer installed in the // directory). index int - // groups is an array of slot groups. Each group holds abi.SwissMapGroupSlots + // groups is an array of slot groups. Each group holds abi.MapGroupSlots // key/elem slots and their control bytes. A table has a fixed size // groups array. The table is replaced (in rehash) when more space is // required. @@ -71,9 +71,9 @@ type table struct { groups groupsReference } -func newTable(typ *abi.SwissMapType, capacity uint64, index int, localDepth uint8) *table { - if capacity < abi.SwissMapGroupSlots { - capacity = abi.SwissMapGroupSlots +func newTable(typ *abi.MapType, capacity uint64, index int, localDepth uint8) *table { + if capacity < abi.MapGroupSlots { + capacity = abi.MapGroupSlots } t := &table{ @@ -99,8 +99,8 @@ func newTable(typ *abi.SwissMapType, capacity uint64, index int, localDepth uint // reset resets the table with new, empty groups with the specified new total // capacity. -func (t *table) reset(typ *abi.SwissMapType, capacity uint16) { - groupCount := uint64(capacity) / abi.SwissMapGroupSlots +func (t *table) reset(typ *abi.MapType, capacity uint16) { + groupCount := uint64(capacity) / abi.MapGroupSlots t.groups = newGroups(typ, groupCount) t.capacity = capacity t.growthLeft = t.maxGrowthLeft() @@ -118,7 +118,7 @@ func (t *table) maxGrowthLeft() uint16 { // No real reason to support zero capacity table, since an // empty Map simply won't have a table. panic("table must have positive capacity") - } else if t.capacity <= abi.SwissMapGroupSlots { + } else if t.capacity <= abi.MapGroupSlots { // If the map fits in a single group then we're able to fill all of // the slots except 1 (an empty slot is needed to terminate find // operations). @@ -131,7 +131,7 @@ func (t *table) maxGrowthLeft() uint16 { // TODO(prattmic): Do something cleaner. panic("overflow") } - return (t.capacity * maxAvgGroupLoad) / abi.SwissMapGroupSlots + return (t.capacity * maxAvgGroupLoad) / abi.MapGroupSlots } } @@ -142,7 +142,7 @@ func (t *table) Used() uint64 { // Get performs a lookup of the key that key points to. It returns a pointer to // the element, or false if the key doesn't exist. -func (t *table) Get(typ *abi.SwissMapType, m *Map, key unsafe.Pointer) (unsafe.Pointer, bool) { +func (t *table) Get(typ *abi.MapType, m *Map, key unsafe.Pointer) (unsafe.Pointer, bool) { // TODO(prattmic): We could avoid hashing in a variety of special // cases. // @@ -163,7 +163,7 @@ func (t *table) Get(typ *abi.SwissMapType, m *Map, key unsafe.Pointer) (unsafe.P // expose updated elements. For NeedsKeyUpdate keys, iteration also must return // the new key value, not the old key value. // hash must be the hash of the key. -func (t *table) getWithKey(typ *abi.SwissMapType, hash uintptr, key unsafe.Pointer) (unsafe.Pointer, unsafe.Pointer, bool) { +func (t *table) getWithKey(typ *abi.MapType, hash uintptr, key unsafe.Pointer) (unsafe.Pointer, unsafe.Pointer, bool) { // To find the location of a key in the table, we compute hash(key). From // h1(hash(key)) and the capacity, we construct a probeSeq that visits // every group of slots in some interesting order. See [probeSeq]. @@ -223,7 +223,7 @@ func (t *table) getWithKey(typ *abi.SwissMapType, hash uintptr, key unsafe.Point } } -func (t *table) getWithoutKey(typ *abi.SwissMapType, hash uintptr, key unsafe.Pointer) (unsafe.Pointer, bool) { +func (t *table) getWithoutKey(typ *abi.MapType, hash uintptr, key unsafe.Pointer) (unsafe.Pointer, bool) { seq := makeProbeSeq(h1(hash), t.groups.lengthMask) for ; ; seq = seq.next() { g := t.groups.group(typ, seq.offset) @@ -263,7 +263,7 @@ func (t *table) getWithoutKey(typ *abi.SwissMapType, hash uintptr, key unsafe.Po // the new table. // // hash must be the hash of key. -func (t *table) PutSlot(typ *abi.SwissMapType, m *Map, hash uintptr, key unsafe.Pointer) (unsafe.Pointer, bool) { +func (t *table) PutSlot(typ *abi.MapType, m *Map, hash uintptr, key unsafe.Pointer) (unsafe.Pointer, bool) { seq := makeProbeSeq(h1(hash), t.groups.lengthMask) // As we look for a match, keep track of the first deleted slot we @@ -378,7 +378,7 @@ func (t *table) PutSlot(typ *abi.SwissMapType, m *Map, hash uintptr, key unsafe. // requires the caller to ensure that the referenced memory never // changes (by sourcing those pointers from another indirect key/elem // map). -func (t *table) uncheckedPutSlot(typ *abi.SwissMapType, hash uintptr, key, elem unsafe.Pointer) { +func (t *table) uncheckedPutSlot(typ *abi.MapType, hash uintptr, key, elem unsafe.Pointer) { if t.growthLeft == 0 { panic("invariant failed: growthLeft is unexpectedly 0") } @@ -418,7 +418,7 @@ func (t *table) uncheckedPutSlot(typ *abi.SwissMapType, hash uintptr, key, elem } // Delete returns true if it put a tombstone in t. -func (t *table) Delete(typ *abi.SwissMapType, m *Map, hash uintptr, key unsafe.Pointer) bool { +func (t *table) Delete(typ *abi.MapType, m *Map, hash uintptr, key unsafe.Pointer) bool { seq := makeProbeSeq(h1(hash), t.groups.lengthMask) for ; ; seq = seq.next() { g := t.groups.group(typ, seq.offset) @@ -505,14 +505,14 @@ func (t *table) Delete(typ *abi.SwissMapType, m *Map, hash uintptr, key unsafe.P // We really need to remove O(n) tombstones so we can pay for the cost // of finding them. If we can't, then we need to grow (which is also O(n), // but guarantees O(n) subsequent inserts can happen in constant time). -func (t *table) pruneTombstones(typ *abi.SwissMapType, m *Map) { +func (t *table) pruneTombstones(typ *abi.MapType, m *Map) { if t.tombstones()*10 < t.capacity { // 10% of capacity // Not enough tombstones to be worth the effort. return } // Bit set marking all the groups whose tombstones are needed. - var needed [(maxTableCapacity/abi.SwissMapGroupSlots + 31) / 32]uint32 + var needed [(maxTableCapacity/abi.MapGroupSlots + 31) / 32]uint32 // Trace the probe sequence of every full entry. for i := uint64(0); i <= t.groups.lengthMask; i++ { @@ -591,11 +591,11 @@ func (t *table) pruneTombstones(typ *abi.SwissMapType, m *Map) { // tombstone is a slot that has been deleted but is still considered occupied // so as not to violate the probing invariant. func (t *table) tombstones() uint16 { - return (t.capacity*maxAvgGroupLoad)/abi.SwissMapGroupSlots - t.used - t.growthLeft + return (t.capacity*maxAvgGroupLoad)/abi.MapGroupSlots - t.used - t.growthLeft } // Clear deletes all entries from the map resulting in an empty map. -func (t *table) Clear(typ *abi.SwissMapType) { +func (t *table) Clear(typ *abi.MapType) { mgl := t.maxGrowthLeft() if t.used == 0 && t.growthLeft == mgl { // no current entries and no tombstones return @@ -614,7 +614,7 @@ func (t *table) Clear(typ *abi.SwissMapType) { type Iter struct { key unsafe.Pointer // Must be in first position. Write nil to indicate iteration end (see cmd/compile/internal/walk/range.go). elem unsafe.Pointer // Must be in second position (see cmd/compile/internal/walk/range.go). - typ *abi.SwissMapType + typ *abi.MapType m *Map // Randomize iteration order by starting iteration at a random slot @@ -648,7 +648,7 @@ type Iter struct { } // Init initializes Iter for iteration. -func (it *Iter) Init(typ *abi.SwissMapType, m *Map) { +func (it *Iter) Init(typ *abi.MapType, m *Map) { it.typ = typ if m == nil || m.used == 0 { @@ -795,8 +795,8 @@ func (it *Iter) Next() { if it.dirIdx < 0 { // Map was small at Init. - for ; it.entryIdx < abi.SwissMapGroupSlots; it.entryIdx++ { - k := uintptr(it.entryIdx+it.entryOffset) % abi.SwissMapGroupSlots + for ; it.entryIdx < abi.MapGroupSlots; it.entryIdx++ { + k := uintptr(it.entryIdx+it.entryOffset) % abi.MapGroupSlots if (it.group.ctrls().get(k) & ctrlEmpty) == ctrlEmpty { // Empty or deleted. @@ -933,13 +933,13 @@ func (it *Iter) Next() { // match. entryIdx := (it.entryIdx + it.entryOffset) & entryMask - slotIdx := uintptr(entryIdx & (abi.SwissMapGroupSlots - 1)) + slotIdx := uintptr(entryIdx & (abi.MapGroupSlots - 1)) if slotIdx == 0 || it.group.data == nil { // Only compute the group (a) when we switch // groups (slotIdx rolls over) and (b) on the // first iteration in this table (slotIdx may // not be zero due to entryOffset). - groupIdx := entryIdx >> abi.SwissMapGroupSlotsBits + groupIdx := entryIdx >> abi.MapGroupSlotsBits it.group = it.tab.groups.group(it.typ, groupIdx) } @@ -1000,14 +1000,14 @@ func (it *Iter) Next() { var groupMatch bitset for it.entryIdx <= entryMask { entryIdx := (it.entryIdx + it.entryOffset) & entryMask - slotIdx := uintptr(entryIdx & (abi.SwissMapGroupSlots - 1)) + slotIdx := uintptr(entryIdx & (abi.MapGroupSlots - 1)) if slotIdx == 0 || it.group.data == nil { // Only compute the group (a) when we switch // groups (slotIdx rolls over) and (b) on the // first iteration in this table (slotIdx may // not be zero due to entryOffset). - groupIdx := entryIdx >> abi.SwissMapGroupSlotsBits + groupIdx := entryIdx >> abi.MapGroupSlotsBits it.group = it.tab.groups.group(it.typ, groupIdx) } @@ -1025,7 +1025,7 @@ func (it *Iter) Next() { if groupMatch == 0 { // Jump past remaining slots in this // group. - it.entryIdx += abi.SwissMapGroupSlots - uint64(slotIdx) + it.entryIdx += abi.MapGroupSlots - uint64(slotIdx) continue } @@ -1067,7 +1067,7 @@ func (it *Iter) Next() { // No more entries in this // group. Continue to next // group. - it.entryIdx += abi.SwissMapGroupSlots - uint64(slotIdx) + it.entryIdx += abi.MapGroupSlots - uint64(slotIdx) continue } @@ -1092,7 +1092,7 @@ func (it *Iter) Next() { // No more entries in // this group. Continue // to next group. - it.entryIdx += abi.SwissMapGroupSlots - uint64(slotIdx) + it.entryIdx += abi.MapGroupSlots - uint64(slotIdx) } else { // Next full slot. i := groupMatch.first() @@ -1115,7 +1115,7 @@ func (it *Iter) Next() { // Replaces the table with one larger table or two split tables to fit more // entries. Since the table is replaced, t is now stale and should not be // modified. -func (t *table) rehash(typ *abi.SwissMapType, m *Map) { +func (t *table) rehash(typ *abi.MapType, m *Map) { // TODO(prattmic): SwissTables typically perform a "rehash in place" // operation which recovers capacity consumed by tombstones without growing // the table by reordering slots as necessary to maintain the probe @@ -1149,7 +1149,7 @@ func localDepthMask(localDepth uint8) uintptr { } // split the table into two, installing the new tables in the map directory. -func (t *table) split(typ *abi.SwissMapType, m *Map) { +func (t *table) split(typ *abi.MapType, m *Map) { localDepth := t.localDepth localDepth++ @@ -1162,7 +1162,7 @@ func (t *table) split(typ *abi.SwissMapType, m *Map) { for i := uint64(0); i <= t.groups.lengthMask; i++ { g := t.groups.group(typ, i) - for j := uintptr(0); j < abi.SwissMapGroupSlots; j++ { + for j := uintptr(0); j < abi.MapGroupSlots; j++ { if (g.ctrls().get(j) & ctrlEmpty) == ctrlEmpty { // Empty or deleted continue @@ -1197,13 +1197,13 @@ func (t *table) split(typ *abi.SwissMapType, m *Map) { // and uncheckedPutting each element of the table into the new table (we know // that no insertion here will Put an already-present value), and discard the // old table. -func (t *table) grow(typ *abi.SwissMapType, m *Map, newCapacity uint16) { +func (t *table) grow(typ *abi.MapType, m *Map, newCapacity uint16) { newTable := newTable(typ, uint64(newCapacity), t.index, t.localDepth) if t.capacity > 0 { for i := uint64(0); i <= t.groups.lengthMask; i++ { g := t.groups.group(typ, i) - for j := uintptr(0); j < abi.SwissMapGroupSlots; j++ { + for j := uintptr(0); j < abi.MapGroupSlots; j++ { if (g.ctrls().get(j) & ctrlEmpty) == ctrlEmpty { // Empty or deleted continue @@ -1262,7 +1262,7 @@ func (s probeSeq) next() probeSeq { return s } -func (t *table) clone(typ *abi.SwissMapType) *table { +func (t *table) clone(typ *abi.MapType) *table { // Shallow copy the table structure. t2 := new(table) *t2 = *t diff --git a/src/internal/runtime/maps/table_debug.go b/src/internal/runtime/maps/table_debug.go index a754592f70..d7226251b0 100644 --- a/src/internal/runtime/maps/table_debug.go +++ b/src/internal/runtime/maps/table_debug.go @@ -12,7 +12,7 @@ import ( const debugLog = false -func (t *table) checkInvariants(typ *abi.SwissMapType, m *Map) { +func (t *table) checkInvariants(typ *abi.MapType, m *Map) { if !debugLog { return } @@ -24,7 +24,7 @@ func (t *table) checkInvariants(typ *abi.SwissMapType, m *Map) { var empty uint16 for i := uint64(0); i <= t.groups.lengthMask; i++ { g := t.groups.group(typ, i) - for j := uintptr(0); j < abi.SwissMapGroupSlots; j++ { + for j := uintptr(0); j < abi.MapGroupSlots; j++ { c := g.ctrls().get(j) switch { case c == ctrlDeleted: @@ -63,7 +63,7 @@ func (t *table) checkInvariants(typ *abi.SwissMapType, m *Map) { panic("invariant failed: found mismatched used slot count") } - growthLeft := (t.capacity*maxAvgGroupLoad)/abi.SwissMapGroupSlots - t.used - deleted + growthLeft := (t.capacity*maxAvgGroupLoad)/abi.MapGroupSlots - t.used - deleted if growthLeft != t.growthLeft { print("invariant failed: found ", t.growthLeft, " growthLeft, but expected ", growthLeft, "\n") t.Print(typ, m) @@ -81,7 +81,7 @@ func (t *table) checkInvariants(typ *abi.SwissMapType, m *Map) { panic("invariant failed: found no empty slots (violates probe invariant)") } } -func (t *table) Print(typ *abi.SwissMapType, m *Map) { +func (t *table) Print(typ *abi.MapType, m *Map) { print(`table{ index: `, t.index, ` localDepth: `, t.localDepth, ` @@ -96,7 +96,7 @@ func (t *table) Print(typ *abi.SwissMapType, m *Map) { g := t.groups.group(typ, i) ctrls := g.ctrls() - for j := uintptr(0); j < abi.SwissMapGroupSlots; j++ { + for j := uintptr(0); j < abi.MapGroupSlots; j++ { print("\t\t\tslot ", j, "\n") c := ctrls.get(j) diff --git a/src/internal/runtime/strconv/atoi.go b/src/internal/runtime/strconv/atoi.go index 87b3faf6d5..0308757c6f 100644 --- a/src/internal/runtime/strconv/atoi.go +++ b/src/internal/runtime/strconv/atoi.go @@ -73,4 +73,3 @@ func Atoi32(s string) (int32, bool) { } return 0, false } - diff --git a/src/internal/runtime/strconv/atoi_test.go b/src/internal/runtime/strconv/atoi_test.go index 49cd6f160a..71a8030b1d 100644 --- a/src/internal/runtime/strconv/atoi_test.go +++ b/src/internal/runtime/strconv/atoi_test.go @@ -102,4 +102,3 @@ func TestAtoi32(t *testing.T) { } } } - diff --git a/src/internal/runtime/syscall/asm_linux_386.s b/src/internal/runtime/syscall/linux/asm_linux_386.s index 15aae4d8bd..15aae4d8bd 100644 --- a/src/internal/runtime/syscall/asm_linux_386.s +++ b/src/internal/runtime/syscall/linux/asm_linux_386.s diff --git a/src/internal/runtime/syscall/asm_linux_amd64.s b/src/internal/runtime/syscall/linux/asm_linux_amd64.s index 3740ef1beb..3740ef1beb 100644 --- a/src/internal/runtime/syscall/asm_linux_amd64.s +++ b/src/internal/runtime/syscall/linux/asm_linux_amd64.s diff --git a/src/internal/runtime/syscall/asm_linux_arm.s b/src/internal/runtime/syscall/linux/asm_linux_arm.s index dbf1826d94..dbf1826d94 100644 --- a/src/internal/runtime/syscall/asm_linux_arm.s +++ b/src/internal/runtime/syscall/linux/asm_linux_arm.s diff --git a/src/internal/runtime/syscall/asm_linux_arm64.s b/src/internal/runtime/syscall/linux/asm_linux_arm64.s index 83e862ff72..83e862ff72 100644 --- a/src/internal/runtime/syscall/asm_linux_arm64.s +++ b/src/internal/runtime/syscall/linux/asm_linux_arm64.s diff --git a/src/internal/runtime/syscall/asm_linux_loong64.s b/src/internal/runtime/syscall/linux/asm_linux_loong64.s index ff8ad75b05..ff8ad75b05 100644 --- a/src/internal/runtime/syscall/asm_linux_loong64.s +++ b/src/internal/runtime/syscall/linux/asm_linux_loong64.s diff --git a/src/internal/runtime/syscall/asm_linux_mips64x.s b/src/internal/runtime/syscall/linux/asm_linux_mips64x.s index 6b7c524689..6b7c524689 100644 --- a/src/internal/runtime/syscall/asm_linux_mips64x.s +++ b/src/internal/runtime/syscall/linux/asm_linux_mips64x.s diff --git a/src/internal/runtime/syscall/asm_linux_mipsx.s b/src/internal/runtime/syscall/linux/asm_linux_mipsx.s index 561310f8a1..561310f8a1 100644 --- a/src/internal/runtime/syscall/asm_linux_mipsx.s +++ b/src/internal/runtime/syscall/linux/asm_linux_mipsx.s diff --git a/src/internal/runtime/syscall/asm_linux_ppc64x.s b/src/internal/runtime/syscall/linux/asm_linux_ppc64x.s index 3e985edea0..3e985edea0 100644 --- a/src/internal/runtime/syscall/asm_linux_ppc64x.s +++ b/src/internal/runtime/syscall/linux/asm_linux_ppc64x.s diff --git a/src/internal/runtime/syscall/asm_linux_riscv64.s b/src/internal/runtime/syscall/linux/asm_linux_riscv64.s index 15e50ec153..15e50ec153 100644 --- a/src/internal/runtime/syscall/asm_linux_riscv64.s +++ b/src/internal/runtime/syscall/linux/asm_linux_riscv64.s diff --git a/src/internal/runtime/syscall/asm_linux_s390x.s b/src/internal/runtime/syscall/linux/asm_linux_s390x.s index 1b27f29390..1b27f29390 100644 --- a/src/internal/runtime/syscall/asm_linux_s390x.s +++ b/src/internal/runtime/syscall/linux/asm_linux_s390x.s diff --git a/src/internal/runtime/syscall/defs_linux.go b/src/internal/runtime/syscall/linux/defs_linux.go index 4c131e23cf..1ca3c35238 100644 --- a/src/internal/runtime/syscall/defs_linux.go +++ b/src/internal/runtime/syscall/linux/defs_linux.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package syscall +package linux const ( AT_FDCWD = -0x64 diff --git a/src/internal/runtime/syscall/defs_linux_386.go b/src/internal/runtime/syscall/linux/defs_linux_386.go index 6f05fd7306..7fdf5d3f80 100644 --- a/src/internal/runtime/syscall/defs_linux_386.go +++ b/src/internal/runtime/syscall/linux/defs_linux_386.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package syscall +package linux const ( SYS_CLOSE = 6 diff --git a/src/internal/runtime/syscall/defs_linux_amd64.go b/src/internal/runtime/syscall/linux/defs_linux_amd64.go index 6c62818100..2c8676e6e9 100644 --- a/src/internal/runtime/syscall/defs_linux_amd64.go +++ b/src/internal/runtime/syscall/linux/defs_linux_amd64.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package syscall +package linux const ( SYS_CLOSE = 3 diff --git a/src/internal/runtime/syscall/defs_linux_arm.go b/src/internal/runtime/syscall/linux/defs_linux_arm.go index 2b6005a3da..a0b395d676 100644 --- a/src/internal/runtime/syscall/defs_linux_arm.go +++ b/src/internal/runtime/syscall/linux/defs_linux_arm.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package syscall +package linux const ( SYS_CLOSE = 6 diff --git a/src/internal/runtime/syscall/defs_linux_arm64.go b/src/internal/runtime/syscall/linux/defs_linux_arm64.go index 05922fbf7a..223dce0c5b 100644 --- a/src/internal/runtime/syscall/defs_linux_arm64.go +++ b/src/internal/runtime/syscall/linux/defs_linux_arm64.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package syscall +package linux const ( SYS_CLOSE = 57 diff --git a/src/internal/runtime/syscall/defs_linux_loong64.go b/src/internal/runtime/syscall/linux/defs_linux_loong64.go index 2501434ceb..8aa61c391d 100644 --- a/src/internal/runtime/syscall/defs_linux_loong64.go +++ b/src/internal/runtime/syscall/linux/defs_linux_loong64.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package syscall +package linux const ( SYS_CLOSE = 57 diff --git a/src/internal/runtime/syscall/defs_linux_mips64x.go b/src/internal/runtime/syscall/linux/defs_linux_mips64x.go index 92ba3f7398..84b760dc1b 100644 --- a/src/internal/runtime/syscall/defs_linux_mips64x.go +++ b/src/internal/runtime/syscall/linux/defs_linux_mips64x.go @@ -4,7 +4,7 @@ //go:build linux && (mips64 || mips64le) -package syscall +package linux const ( SYS_CLOSE = 5003 diff --git a/src/internal/runtime/syscall/defs_linux_mipsx.go b/src/internal/runtime/syscall/linux/defs_linux_mipsx.go index 7b4dee08af..a9be21414c 100644 --- a/src/internal/runtime/syscall/defs_linux_mipsx.go +++ b/src/internal/runtime/syscall/linux/defs_linux_mipsx.go @@ -4,7 +4,7 @@ //go:build linux && (mips || mipsle) -package syscall +package linux const ( SYS_CLOSE = 4006 diff --git a/src/internal/runtime/syscall/defs_linux_ppc64x.go b/src/internal/runtime/syscall/linux/defs_linux_ppc64x.go index 4656517628..63f4e5d786 100644 --- a/src/internal/runtime/syscall/defs_linux_ppc64x.go +++ b/src/internal/runtime/syscall/linux/defs_linux_ppc64x.go @@ -4,7 +4,7 @@ //go:build linux && (ppc64 || ppc64le) -package syscall +package linux const ( SYS_CLOSE = 6 diff --git a/src/internal/runtime/syscall/defs_linux_riscv64.go b/src/internal/runtime/syscall/linux/defs_linux_riscv64.go index 2501434ceb..8aa61c391d 100644 --- a/src/internal/runtime/syscall/defs_linux_riscv64.go +++ b/src/internal/runtime/syscall/linux/defs_linux_riscv64.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package syscall +package linux const ( SYS_CLOSE = 57 diff --git a/src/internal/runtime/syscall/defs_linux_s390x.go b/src/internal/runtime/syscall/linux/defs_linux_s390x.go index 8005890e45..52945db0e5 100644 --- a/src/internal/runtime/syscall/defs_linux_s390x.go +++ b/src/internal/runtime/syscall/linux/defs_linux_s390x.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package syscall +package linux const ( SYS_CLOSE = 6 diff --git a/src/internal/runtime/syscall/syscall_linux.go b/src/internal/runtime/syscall/linux/syscall_linux.go index 49e5f8de2c..8201e7d190 100644 --- a/src/internal/runtime/syscall/syscall_linux.go +++ b/src/internal/runtime/syscall/linux/syscall_linux.go @@ -2,16 +2,15 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// Package syscall provides the syscall primitives required for the runtime. -package syscall +// Package linux provides the syscall primitives required for the runtime. +package linux import ( "internal/goarch" "unsafe" ) -// TODO(https://go.dev/issue/51087): This package is incomplete and currently -// only contains very minimal support for Linux. +// TODO(https://go.dev/issue/51087): Move remaining syscalls to this package. // Syscall6 calls system call number 'num' with arguments a1-6. func Syscall6(num, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2, errno uintptr) diff --git a/src/internal/runtime/syscall/syscall_linux_test.go b/src/internal/runtime/syscall/linux/syscall_linux_test.go index 14bb31c4b8..10eb2d56bf 100644 --- a/src/internal/runtime/syscall/syscall_linux_test.go +++ b/src/internal/runtime/syscall/linux/syscall_linux_test.go @@ -2,15 +2,15 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -package syscall_test +package linux_test import ( - "internal/runtime/syscall" + "internal/runtime/syscall/linux" "testing" ) func TestEpollctlErrorSign(t *testing.T) { - v := syscall.EpollCtl(-1, 1, -1, &syscall.EpollEvent{}) + v := linux.EpollCtl(-1, 1, -1, &linux.EpollEvent{}) const EBADF = 0x09 if v != EBADF { diff --git a/src/internal/runtime/syscall/windows/asm_windows_386.s b/src/internal/runtime/syscall/windows/asm_windows_386.s new file mode 100644 index 0000000000..29cce00309 --- /dev/null +++ b/src/internal/runtime/syscall/windows/asm_windows_386.s @@ -0,0 +1,48 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +#include "go_asm.h" +#include "textflag.h" + +TEXT ·StdCall<ABIInternal>(SB),NOSPLIT,$0 + JMP ·asmstdcall(SB) + +TEXT ·asmstdcall(SB),NOSPLIT,$0 + MOVL fn+0(FP), BX + MOVL SP, BP // save stack pointer + + // SetLastError(0). + MOVL $0, 0x34(FS) + + MOVL StdCallInfo_N(BX), CX + + // Fast version, do not store args on the stack. + CMPL CX, $0 + JE docall + + // Copy args to the stack. + MOVL CX, AX + SALL $2, AX + SUBL AX, SP // room for args + MOVL SP, DI + MOVL StdCallInfo_Args(BX), SI + CLD + REP; MOVSL + +docall: + // Call stdcall or cdecl function. + // DI SI BP BX are preserved, SP is not + CALL StdCallInfo_Fn(BX) + MOVL BP, SP + + // Return result. + MOVL fn+0(FP), BX + MOVL AX, StdCallInfo_R1(BX) + MOVL DX, StdCallInfo_R2(BX) + + // GetLastError(). + MOVL 0x34(FS), AX + MOVL AX, StdCallInfo_Err(BX) + + RET diff --git a/src/internal/runtime/syscall/windows/asm_windows_amd64.s b/src/internal/runtime/syscall/windows/asm_windows_amd64.s new file mode 100644 index 0000000000..c31cbcdd14 --- /dev/null +++ b/src/internal/runtime/syscall/windows/asm_windows_amd64.s @@ -0,0 +1,84 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +#include "go_asm.h" +#include "textflag.h" + +TEXT ·StdCall<ABIInternal>(SB),NOSPLIT,$0 + MOVQ AX, CX + JMP ·asmstdcall(SB) + +TEXT ·asmstdcall(SB),NOSPLIT,$16 + MOVQ SP, AX + ANDQ $~15, SP // alignment as per Windows requirement + MOVQ AX, 8(SP) + MOVQ CX, 0(SP) // asmcgocall will put first argument into CX. + + MOVQ StdCallInfo_Fn(CX), AX + MOVQ StdCallInfo_Args(CX), SI + MOVQ StdCallInfo_N(CX), CX + + // SetLastError(0). + MOVQ 0x30(GS), DI + MOVL $0, 0x68(DI) + + SUBQ $(const_MaxArgs*8), SP // room for args + + // Fast version, do not store args on the stack. + CMPL CX, $0; JE _0args + CMPL CX, $1; JE _1args + CMPL CX, $2; JE _2args + CMPL CX, $3; JE _3args + CMPL CX, $4; JE _4args + + // Check we have enough room for args. + CMPL CX, $const_MaxArgs + JLE 2(PC) + INT $3 // not enough room -> crash + + // Copy args to the stack. + MOVQ SP, DI + CLD + REP; MOVSQ + MOVQ SP, SI + + // Load first 4 args into correspondent registers. + // Floating point arguments are passed in the XMM + // registers. Set them here in case any of the arguments + // are floating point values. For details see + // https://learn.microsoft.com/en-us/cpp/build/x64-calling-convention?view=msvc-170 +_4args: + MOVQ 24(SI), R9 + MOVQ R9, X3 +_3args: + MOVQ 16(SI), R8 + MOVQ R8, X2 +_2args: + MOVQ 8(SI), DX + MOVQ DX, X1 +_1args: + MOVQ 0(SI), CX + MOVQ CX, X0 +_0args: + + // Call stdcall function. + CALL AX + + ADDQ $(const_MaxArgs*8), SP + + // Return result. + MOVQ 0(SP), CX + MOVQ 8(SP), SP + MOVQ AX, StdCallInfo_R1(CX) + // Floating point return values are returned in XMM0. Setting r2 to this + // value in case this call returned a floating point value. For details, + // see https://docs.microsoft.com/en-us/cpp/build/x64-calling-convention + MOVQ X0, StdCallInfo_R2(CX) + + // GetLastError(). + MOVQ 0x30(GS), DI + MOVL 0x68(DI), AX + MOVQ AX, StdCallInfo_Err(CX) + + RET diff --git a/src/internal/runtime/syscall/windows/asm_windows_arm.s b/src/internal/runtime/syscall/windows/asm_windows_arm.s new file mode 100644 index 0000000000..8cc4d5c9aa --- /dev/null +++ b/src/internal/runtime/syscall/windows/asm_windows_arm.s @@ -0,0 +1,77 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +#include "go_asm.h" +#include "go_tls.h" +#include "textflag.h" +#include "time_windows.h" + +TEXT ·StdCall<ABIInternal>(SB),NOSPLIT,$0 + B ·asmstdcall(SB) + +TEXT ·asmstdcall(SB),NOSPLIT|NOFRAME,$0 + MOVM.DB.W [R4, R5, R14], (R13) // push {r4, r5, lr} + MOVW R0, R4 // put fn * in r4 + MOVW R13, R5 // save stack pointer in r5 + + // SetLastError(0) + MOVW $0, R0 + MRC 15, 0, R1, C13, C0, 2 + MOVW R0, 0x34(R1) + + MOVW 8(R4), R12 // fn->Args + + // Do we have more than 4 arguments? + MOVW 4(R4), R0 // fn->n + SUB.S $4, R0, R2 + BLE loadregs + + // Reserve stack space for remaining args + SUB R2<<2, R13 + BIC $0x7, R13 // alignment for ABI + + // R0: count of arguments + // R1: + // R2: loop counter, from 0 to (n-4) + // R3: scratch + // R4: pointer to StdCallInfo struct + // R12: fn->args + MOVW $0, R2 +stackargs: + ADD $4, R2, R3 // r3 = args[4 + i] + MOVW R3<<2(R12), R3 + MOVW R3, R2<<2(R13) // stack[i] = r3 + + ADD $1, R2 // i++ + SUB $4, R0, R3 // while (i < (n - 4)) + CMP R3, R2 + BLT stackargs + +loadregs: + CMP $3, R0 + MOVW.GT 12(R12), R3 + + CMP $2, R0 + MOVW.GT 8(R12), R2 + + CMP $1, R0 + MOVW.GT 4(R12), R1 + + CMP $0, R0 + MOVW.GT 0(R12), R0 + + BIC $0x7, R13 // alignment for ABI + MOVW 0(R4), R12 // branch to fn->fn + BL (R12) + + MOVW R5, R13 // free stack space + MOVW R0, 12(R4) // save return value to fn->r1 + MOVW R1, 16(R4) + + // GetLastError + MRC 15, 0, R1, C13, C0, 2 + MOVW 0x34(R1), R0 + MOVW R0, 20(R4) // store in fn->err + + MOVM.IA.W (R13), [R4, R5, R15] diff --git a/src/internal/runtime/syscall/windows/asm_windows_arm64.s b/src/internal/runtime/syscall/windows/asm_windows_arm64.s new file mode 100644 index 0000000000..fb4cda0f83 --- /dev/null +++ b/src/internal/runtime/syscall/windows/asm_windows_arm64.s @@ -0,0 +1,90 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +#include "go_asm.h" +#include "textflag.h" + +// Offsets into Thread Environment Block (pointer in R18) +#define TEB_error 0x68 + +TEXT ·StdCall<ABIInternal>(SB),NOSPLIT,$0 + B ·asmstdcall(SB) + +TEXT ·asmstdcall(SB),NOSPLIT,$16 + STP (R19, R20), 16(RSP) // save old R19, R20 + MOVD R0, R19 // save fn pointer + MOVD RSP, R20 // save stack pointer + + // SetLastError(0) + MOVD $0, TEB_error(R18_PLATFORM) + MOVD StdCallInfo_Args(R19), R12 + + // Do we have more than 8 arguments? + MOVD StdCallInfo_N(R19), R0 + CMP $0, R0; BEQ _0args + CMP $1, R0; BEQ _1args + CMP $2, R0; BEQ _2args + CMP $3, R0; BEQ _3args + CMP $4, R0; BEQ _4args + CMP $5, R0; BEQ _5args + CMP $6, R0; BEQ _6args + CMP $7, R0; BEQ _7args + CMP $8, R0; BEQ _8args + + // Reserve stack space for remaining args + SUB $8, R0, R2 + ADD $1, R2, R3 // make even number of words for stack alignment + AND $~1, R3 + LSL $3, R3 + SUB R3, RSP + + // R4: size of stack arguments (n-8)*8 + // R5: &args[8] + // R6: loop counter, from 0 to (n-8)*8 + // R7: scratch + // R8: copy of RSP - (R2)(RSP) assembles as (R2)(ZR) + SUB $8, R0, R4 + LSL $3, R4 + ADD $(8*8), R12, R5 + MOVD $0, R6 + MOVD RSP, R8 +stackargs: + MOVD (R6)(R5), R7 + MOVD R7, (R6)(R8) + ADD $8, R6 + CMP R6, R4 + BNE stackargs + +_8args: + MOVD (7*8)(R12), R7 +_7args: + MOVD (6*8)(R12), R6 +_6args: + MOVD (5*8)(R12), R5 +_5args: + MOVD (4*8)(R12), R4 +_4args: + MOVD (3*8)(R12), R3 +_3args: + MOVD (2*8)(R12), R2 +_2args: + MOVD (1*8)(R12), R1 +_1args: + MOVD (0*8)(R12), R0 +_0args: + + MOVD StdCallInfo_Fn(R19), R12 + BL (R12) + + MOVD R20, RSP // free stack space + MOVD R0, StdCallInfo_R1(R19) // save return value + // TODO(rsc) floating point like amd64 in StdCallInfo_R2? + + // GetLastError + MOVD TEB_error(R18_PLATFORM), R0 + MOVD R0, StdCallInfo_Err(R19) + + // Restore callee-saved registers. + LDP 16(RSP), (R19, R20) + RET diff --git a/src/internal/runtime/syscall/windows/syscall_windows.go b/src/internal/runtime/syscall/windows/syscall_windows.go new file mode 100644 index 0000000000..0d350f0d7f --- /dev/null +++ b/src/internal/runtime/syscall/windows/syscall_windows.go @@ -0,0 +1,44 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package windows provides the syscall primitives required for the runtime. + +package windows + +import ( + "internal/abi" +) + +// MaxArgs should be divisible by 2, as Windows stack +// must be kept 16-byte aligned on syscall entry. +// +// Although it only permits maximum 42 parameters, it +// is arguably large enough. +const MaxArgs = 42 + +// StdCallInfo is a structure used to pass parameters to the system call. +type StdCallInfo struct { + Fn uintptr + N uintptr // number of parameters + Args uintptr // parameters + R1 uintptr // return values + R2 uintptr + Err uintptr // error number +} + +// StdCall calls a function using Windows' stdcall convention. +// +//go:noescape +func StdCall(fn *StdCallInfo) + +// asmstdcall is the function pointer for [AsmStdCallAddr]. +func asmstdcall(fn *StdCallInfo) + +// AsmStdCallAddr is the address of a function that accepts a pointer +// to [StdCallInfo] stored on the stack following the C calling convention, +// and calls the function using Windows' stdcall calling convention. +// Shouldn't be called directly from Go. +func AsmStdCallAddr() uintptr { + return abi.FuncPCABI0(asmstdcall) +} diff --git a/src/internal/syscall/windows/security_windows.go b/src/internal/syscall/windows/security_windows.go index f0ab52ac81..2c35ad31f4 100644 --- a/src/internal/syscall/windows/security_windows.go +++ b/src/internal/syscall/windows/security_windows.go @@ -262,3 +262,6 @@ func GetSidSubAuthorityCount(sid *syscall.SID) uint8 { defer runtime.KeepAlive(sid) return *(*uint8)(unsafe.Pointer(getSidSubAuthorityCount(sid))) } + +//sys InitializeAcl(acl *ACL, length uint32, revision uint32) (err error) = advapi32.InitializeAcl +//sys SetNamedSecurityInfo(objectName string, objectType SE_OBJECT_TYPE, securityInformation SECURITY_INFORMATION, owner *syscall.SID, group *syscall.SID, dacl *ACL, sacl *ACL) (ret error) = advapi32.SetNamedSecurityInfoW diff --git a/src/internal/syscall/windows/types_windows.go b/src/internal/syscall/windows/types_windows.go index 93664b4b7d..3855df393d 100644 --- a/src/internal/syscall/windows/types_windows.go +++ b/src/internal/syscall/windows/types_windows.go @@ -260,3 +260,21 @@ type FILE_COMPLETION_INFORMATION struct { // https://learn.microsoft.com/en-us/windows/win32/api/winnt/ns-winnt-osversioninfoexa // https://learn.microsoft.com/en-us/windows-hardware/drivers/ddi/wdm/ns-wdm-_osversioninfoexw const VER_NT_WORKSTATION = 0x0000001 + +// https://learn.microsoft.com/en-us/windows/win32/api/accctrl/ne-accctrl-se_object_type +type SE_OBJECT_TYPE uint32 + +const ( + SE_UNKNOWN_OBJECT_TYPE SE_OBJECT_TYPE = 0 + SE_FILE_OBJECT SE_OBJECT_TYPE = 1 +) + +// https://learn.microsoft.com/en-us/windows/win32/secauthz/security-information +type SECURITY_INFORMATION uint32 + +const ( + DACL_SECURITY_INFORMATION SECURITY_INFORMATION = 0x00000004 + UNPROTECTED_DACL_SECURITY_INFORMATION SECURITY_INFORMATION = 0x20000000 +) + +const ACL_REVISION = 2 diff --git a/src/internal/syscall/windows/zsyscall_windows.go b/src/internal/syscall/windows/zsyscall_windows.go index 90cf0b92a4..c08b2ccdba 100644 --- a/src/internal/syscall/windows/zsyscall_windows.go +++ b/src/internal/syscall/windows/zsyscall_windows.go @@ -54,6 +54,7 @@ var ( procGetSidSubAuthorityCount = modadvapi32.NewProc("GetSidSubAuthorityCount") procImpersonateLoggedOnUser = modadvapi32.NewProc("ImpersonateLoggedOnUser") procImpersonateSelf = modadvapi32.NewProc("ImpersonateSelf") + procInitializeAcl = modadvapi32.NewProc("InitializeAcl") procIsValidSid = modadvapi32.NewProc("IsValidSid") procLogonUserW = modadvapi32.NewProc("LogonUserW") procLookupPrivilegeValueW = modadvapi32.NewProc("LookupPrivilegeValueW") @@ -62,6 +63,7 @@ var ( procOpenThreadToken = modadvapi32.NewProc("OpenThreadToken") procQueryServiceStatus = modadvapi32.NewProc("QueryServiceStatus") procRevertToSelf = modadvapi32.NewProc("RevertToSelf") + procSetNamedSecurityInfoW = modadvapi32.NewProc("SetNamedSecurityInfoW") procSetTokenInformation = modadvapi32.NewProc("SetTokenInformation") procProcessPrng = modbcryptprimitives.NewProc("ProcessPrng") procGetAdaptersAddresses = modiphlpapi.NewProc("GetAdaptersAddresses") @@ -166,6 +168,14 @@ func ImpersonateSelf(impersonationlevel uint32) (err error) { return } +func InitializeAcl(acl *ACL, length uint32, revision uint32) (err error) { + r1, _, e1 := syscall.Syscall(procInitializeAcl.Addr(), 3, uintptr(unsafe.Pointer(acl)), uintptr(length), uintptr(revision)) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func IsValidSid(sid *syscall.SID) (valid bool) { r0, _, _ := syscall.Syscall(procIsValidSid.Addr(), 1, uintptr(unsafe.Pointer(sid)), 0, 0) valid = r0 != 0 @@ -234,6 +244,23 @@ func RevertToSelf() (err error) { return } +func SetNamedSecurityInfo(objectName string, objectType SE_OBJECT_TYPE, securityInformation SECURITY_INFORMATION, owner *syscall.SID, group *syscall.SID, dacl *ACL, sacl *ACL) (ret error) { + var _p0 *uint16 + _p0, ret = syscall.UTF16PtrFromString(objectName) + if ret != nil { + return + } + return _SetNamedSecurityInfo(_p0, objectType, securityInformation, owner, group, dacl, sacl) +} + +func _SetNamedSecurityInfo(objectName *uint16, objectType SE_OBJECT_TYPE, securityInformation SECURITY_INFORMATION, owner *syscall.SID, group *syscall.SID, dacl *ACL, sacl *ACL) (ret error) { + r0, _, _ := syscall.Syscall9(procSetNamedSecurityInfoW.Addr(), 7, uintptr(unsafe.Pointer(objectName)), uintptr(objectType), uintptr(securityInformation), uintptr(unsafe.Pointer(owner)), uintptr(unsafe.Pointer(group)), uintptr(unsafe.Pointer(dacl)), uintptr(unsafe.Pointer(sacl)), 0, 0) + if r0 != 0 { + ret = syscall.Errno(r0) + } + return +} + func SetTokenInformation(tokenHandle syscall.Token, tokenInformationClass uint32, tokenInformation unsafe.Pointer, tokenInformationLength uint32) (err error) { r1, _, e1 := syscall.Syscall6(procSetTokenInformation.Addr(), 4, uintptr(tokenHandle), uintptr(tokenInformationClass), uintptr(tokenInformation), uintptr(tokenInformationLength), 0, 0) if r1 == 0 { diff --git a/src/internal/trace/trace_test.go b/src/internal/trace/trace_test.go index bd3f078f05..ce79960065 100644 --- a/src/internal/trace/trace_test.go +++ b/src/internal/trace/trace_test.go @@ -610,7 +610,6 @@ func testTraceProg(t *testing.T, progName string, extra func(t *testing.T, trace buildCmd.Args = append(buildCmd.Args, "-race") } buildCmd.Args = append(buildCmd.Args, testPath) - buildCmd.Env = append(os.Environ(), "GOEXPERIMENT=rangefunc") buildOutput, err := buildCmd.CombinedOutput() if err != nil { t.Fatalf("failed to build %s: %v: output:\n%s", testPath, err, buildOutput) diff --git a/src/internal/types/errors/codes.go b/src/internal/types/errors/codes.go index f8c9eb920f..b0f7d2d446 100644 --- a/src/internal/types/errors/codes.go +++ b/src/internal/types/errors/codes.go @@ -881,7 +881,9 @@ const ( // context in which it is used. // // Example: - // var _ = 1 + []int{} + // func f[T ~int8 | ~int16 | ~int32 | ~int64](x T) T { + // return x + 1024 + // } InvalidUntypedConversion // BadOffsetofSyntax occurs when unsafe.Offsetof is called with an argument diff --git a/src/internal/types/testdata/check/builtins1.go b/src/internal/types/testdata/check/builtins1.go index 422a5462d1..341723ccb0 100644 --- a/src/internal/types/testdata/check/builtins1.go +++ b/src/internal/types/testdata/check/builtins1.go @@ -211,7 +211,7 @@ func _[ var x2 P2 _ = max(x2) _ = max(x2, x2) - _ = max(1, 2 /* ERROR "cannot convert 2 (untyped int constant) to type P2" */, x2) // error at 2 because max is 2 + _ = max(1, 2, x2 /* ERROR "mismatched types untyped int (previous argument) and P2 (type of x2)" */ ) _ = max(x1, x2 /* ERROR "mismatched types P1 (previous argument) and P2 (type of x2)" */ ) } @@ -232,7 +232,7 @@ func _[ var x2 P2 _ = min(x2) _ = min(x2, x2) - _ = min(1 /* ERROR "cannot convert 1 (untyped int constant) to type P2" */ , 2, x2) // error at 1 because min is 1 + _ = min(1, 2, x2 /* ERROR "mismatched types untyped int (previous argument) and P2 (type of x2)" */ ) _ = min(x1, x2 /* ERROR "mismatched types P1 (previous argument) and P2 (type of x2)" */ ) } diff --git a/src/internal/types/testdata/check/expr2.go b/src/internal/types/testdata/check/expr2.go index ebb85eb233..603f5ae190 100644 --- a/src/internal/types/testdata/check/expr2.go +++ b/src/internal/types/testdata/check/expr2.go @@ -201,7 +201,7 @@ func interfaces() { var s11 S11 var s2 S2 - _ = i == 0 /* ERROR "cannot convert" */ + _ = i == 0 /* ERROR "invalid operation: i == 0 (mismatched types interface{m() int} and untyped int)" */ _ = i == s1 /* ERROR "mismatched types" */ _ = i == &s1 _ = i == &s11 diff --git a/src/internal/types/testdata/fixedbugs/issue60434.go b/src/internal/types/testdata/fixedbugs/issue60434.go index e1d76527f3..68aa7c2fdf 100644 --- a/src/internal/types/testdata/fixedbugs/issue60434.go +++ b/src/internal/types/testdata/fixedbugs/issue60434.go @@ -13,5 +13,5 @@ var s struct{ x int } func _() { f(s.y /* ERROR "s.y undefined" */) - f(1 /* ERROR "cannot convert 1" */ / s) + f(1 /* ERROR "invalid operation: 1 / s (mismatched types untyped int and struct{x int})" */ / s) } diff --git a/src/internal/types/testdata/fixedbugs/issue73428.go b/src/internal/types/testdata/fixedbugs/issue73428.go new file mode 100644 index 0000000000..b452b90fe3 --- /dev/null +++ b/src/internal/types/testdata/fixedbugs/issue73428.go @@ -0,0 +1,13 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package p + +func f() {} + +const c = 0 + +var v int +var _ = f < c // ERROR "invalid operation: f < c (mismatched types func() and untyped int)" +var _ = f < v // ERROR "invalid operation: f < v (mismatched types func() and int)" diff --git a/src/net/dial.go b/src/net/dial.go index db0404c3f8..6264984cec 100644 --- a/src/net/dial.go +++ b/src/net/dial.go @@ -837,7 +837,7 @@ func (lc *ListenConfig) Listen(ctx context.Context, network, address string) (Li // parameters. // // The ctx argument is used while resolving the address on which to listen; -// it does not affect the returned Listener. +// it does not affect the returned PacketConn. func (lc *ListenConfig) ListenPacket(ctx context.Context, network, address string) (PacketConn, error) { addrs, err := DefaultResolver.resolveAddrList(ctx, "listen", network, address, nil) if err != nil { diff --git a/src/net/http/server.go b/src/net/http/server.go index 1ca5a227ef..cf0bd0a91d 100644 --- a/src/net/http/server.go +++ b/src/net/http/server.go @@ -1614,7 +1614,7 @@ func writeStatusLine(bw *bufio.Writer, is11 bool, code int, scratch []byte) { // It's illegal to call this before the header has been flushed. func (w *response) bodyAllowed() bool { if !w.wroteHeader { - panic("") + panic("net/http: bodyAllowed called before the header was written") } return bodyAllowedForStatus(w.status) } diff --git a/src/net/tcpconn_keepalive_test.go b/src/net/tcpconn_keepalive_test.go index 53d0be034f..4bf2f9ef20 100644 --- a/src/net/tcpconn_keepalive_test.go +++ b/src/net/tcpconn_keepalive_test.go @@ -22,7 +22,7 @@ func TestTCPConnKeepAliveConfigDialer(t *testing.T) { oldCfg KeepAliveConfig ) testPreHookSetKeepAlive = func(nfd *netFD) { - oldCfg, errHook = getCurrentKeepAliveSettings(fdType(nfd.pfd.Sysfd)) + oldCfg, errHook = getCurrentKeepAliveSettings(nfd.pfd.Sysfd) } handler := func(ls *localServer, ln Listener) { @@ -80,7 +80,7 @@ func TestTCPConnKeepAliveConfigListener(t *testing.T) { oldCfg KeepAliveConfig ) testPreHookSetKeepAlive = func(nfd *netFD) { - oldCfg, errHook = getCurrentKeepAliveSettings(fdType(nfd.pfd.Sysfd)) + oldCfg, errHook = getCurrentKeepAliveSettings(nfd.pfd.Sysfd) } ch := make(chan Conn, 1) diff --git a/src/os/exec/dot_test.go b/src/os/exec/dot_test.go index 1bf0d9c760..b95639e6c8 100644 --- a/src/os/exec/dot_test.go +++ b/src/os/exec/dot_test.go @@ -177,4 +177,48 @@ func TestLookPath(t *testing.T) { } } }) + + checker := func(test string) func(t *testing.T) { + return func(t *testing.T) { + t.Helper() + t.Logf("PATH=%s", os.Getenv("PATH")) + p, err := LookPath(test) + if err == nil { + t.Errorf("%q: error expected, got nil", test) + } + if p != "" { + t.Errorf("%q: path returned should be \"\". Got %q", test, p) + } + } + } + + // Reference behavior for the next test + t.Run(pathVar+"=$OTHER2", func(t *testing.T) { + t.Run("empty", checker("")) + t.Run("dot", checker(".")) + t.Run("dotdot1", checker("abc/..")) + t.Run("dotdot2", checker("..")) + }) + + // Test the behavior when PATH contains an executable file which is not a directory + t.Run(pathVar+"=exe", func(t *testing.T) { + // Inject an executable file (not a directory) in PATH. + // Use our own binary os.Args[0]. + t.Setenv(pathVar, testenv.Executable(t)) + t.Run("empty", checker("")) + t.Run("dot", checker(".")) + t.Run("dotdot1", checker("abc/..")) + t.Run("dotdot2", checker("..")) + }) + + // Test the behavior when PATH contains an executable file which is not a directory + t.Run(pathVar+"=exe/xx", func(t *testing.T) { + // Inject an executable file (not a directory) in PATH. + // Use our own binary os.Args[0]. + t.Setenv(pathVar, filepath.Join(testenv.Executable(t), "xx")) + t.Run("empty", checker("")) + t.Run("dot", checker(".")) + t.Run("dotdot1", checker("abc/..")) + t.Run("dotdot2", checker("..")) + }) } diff --git a/src/os/exec/exec.go b/src/os/exec/exec.go index 91a6831b04..38354a5244 100644 --- a/src/os/exec/exec.go +++ b/src/os/exec/exec.go @@ -1328,3 +1328,13 @@ func addCriticalEnv(env []string) []string { // Code should use errors.Is(err, ErrDot), not err == ErrDot, // to test whether a returned error err is due to this condition. var ErrDot = errors.New("cannot run executable found relative to current directory") + +// validateLookPath excludes paths that can't be valid +// executable names. See issue #74466 and CVE-2025-47906. +func validateLookPath(s string) error { + switch s { + case "", ".", "..": + return ErrNotFound + } + return nil +} diff --git a/src/os/exec/lp_plan9.go b/src/os/exec/lp_plan9.go index 87359b3551..0430af9eef 100644 --- a/src/os/exec/lp_plan9.go +++ b/src/os/exec/lp_plan9.go @@ -36,6 +36,10 @@ func findExecutable(file string) error { // As of Go 1.19, LookPath will instead return that path along with an error satisfying // [errors.Is](err, [ErrDot]). See the package documentation for more details. func LookPath(file string) (string, error) { + if err := validateLookPath(file); err != nil { + return "", &Error{file, err} + } + // skip the path lookup for these prefixes skip := []string{"/", "#", "./", "../"} diff --git a/src/os/exec/lp_unix.go b/src/os/exec/lp_unix.go index 8617d45e98..e5fddbafe2 100644 --- a/src/os/exec/lp_unix.go +++ b/src/os/exec/lp_unix.go @@ -54,6 +54,10 @@ func LookPath(file string) (string, error) { // (only bypass the path if file begins with / or ./ or ../) // but that would not match all the Unix shells. + if err := validateLookPath(file); err != nil { + return "", &Error{file, err} + } + if strings.Contains(file, "/") { err := findExecutable(file) if err == nil { diff --git a/src/os/exec/lp_windows.go b/src/os/exec/lp_windows.go index 1225674306..e01e7bbbba 100644 --- a/src/os/exec/lp_windows.go +++ b/src/os/exec/lp_windows.go @@ -67,6 +67,10 @@ func findExecutable(file string, exts []string) (string, error) { // As of Go 1.19, LookPath will instead return that path along with an error satisfying // [errors.Is](err, [ErrDot]). See the package documentation for more details. func LookPath(file string) (string, error) { + if err := validateLookPath(file); err != nil { + return "", &Error{file, err} + } + return lookPath(file, pathExt()) } @@ -80,6 +84,10 @@ func LookPath(file string) (string, error) { // "C:\foo\example.com" would be returned as-is even if the // program is actually "C:\foo\example.com.exe". func lookExtensions(path, dir string) (string, error) { + if err := validateLookPath(path); err != nil { + return "", &Error{path, err} + } + if filepath.Base(path) == path { path = "." + string(filepath.Separator) + path } diff --git a/src/os/file.go b/src/os/file.go index 9603ac61e6..66269c199e 100644 --- a/src/os/file.go +++ b/src/os/file.go @@ -707,9 +707,9 @@ func (f *File) SyscallConn() (syscall.RawConn, error) { // Fd returns the system file descriptor or handle referencing the open file. // If f is closed, the descriptor becomes invalid. -// If f is garbage collected, a cleanup may close the descriptor, -// making it invalid; see [runtime.AddCleanup] for more information on when -// a cleanup might be run. +// If f is garbage collected, a finalizer may close the descriptor, +// making it invalid; see [runtime.SetFinalizer] for more information on when +// a finalizer might be run. // // Do not close the returned descriptor; that could cause a later // close of f to close an unrelated descriptor. diff --git a/src/os/file_plan9.go b/src/os/file_plan9.go index 656a3e0bb0..17026409eb 100644 --- a/src/os/file_plan9.go +++ b/src/os/file_plan9.go @@ -23,7 +23,7 @@ func fixLongPath(path string) string { // file is the real representation of *File. // The extra level of indirection ensures that no clients of os -// can overwrite this data, which could cause the cleanup +// can overwrite this data, which could cause the finalizer // to close the wrong file descriptor. type file struct { fdmu poll.FDMutex @@ -31,7 +31,6 @@ type file struct { name string dirinfo atomic.Pointer[dirInfo] // nil unless directory being read appendMode bool // whether file is opened for appending - cleanup runtime.Cleanup // cleanup closes the file when no longer referenced } // fd is the Plan 9 implementation of Fd. @@ -49,7 +48,7 @@ func newFileFromNewFile(fd uintptr, name string) *File { return nil } f := &File{&file{sysfd: fdi, name: name}} - f.cleanup = runtime.AddCleanup(f, func(f *file) { f.close() }, f.file) + runtime.SetFinalizer(f.file, (*file).close) return f } @@ -160,9 +159,8 @@ func (file *file) close() error { err := file.decref() - // There is no need for a cleanup at this point. File must be alive at the point - // where cleanup.stop is called. - file.cleanup.Stop() + // no need for a finalizer anymore + runtime.SetFinalizer(file, nil) return err } diff --git a/src/os/file_unix.go b/src/os/file_unix.go index 721f08c911..2074df70fe 100644 --- a/src/os/file_unix.go +++ b/src/os/file_unix.go @@ -54,7 +54,7 @@ func rename(oldname, newname string) error { // file is the real representation of *File. // The extra level of indirection ensures that no clients of os -// can overwrite this data, which could cause the cleanup +// can overwrite this data, which could cause the finalizer // to close the wrong file descriptor. type file struct { pfd poll.FD @@ -63,7 +63,6 @@ type file struct { nonblock bool // whether we set nonblocking mode stdoutOrErr bool // whether this is stdout or stderr appendMode bool // whether file is opened for appending - cleanup runtime.Cleanup // cleanup closes the file when no longer referenced } // fd is the Unix implementation of Fd. @@ -222,8 +221,7 @@ func newFile(fd int, name string, kind newFileKind, nonBlocking bool) *File { } } - // Close the file when the File is not live. - f.cleanup = runtime.AddCleanup(f, func(f *file) { f.close() }, f.file) + runtime.SetFinalizer(f.file, (*file).close) return f } @@ -320,9 +318,8 @@ func (file *file) close() error { err = &PathError{Op: "close", Path: file.name, Err: e} } - // There is no need for a cleanup at this point. File must be alive at the point - // where cleanup.stop is called. - file.cleanup.Stop() + // no need for a finalizer anymore + runtime.SetFinalizer(file, nil) return err } diff --git a/src/os/file_windows.go b/src/os/file_windows.go index ee6735fe44..7e94328710 100644 --- a/src/os/file_windows.go +++ b/src/os/file_windows.go @@ -22,14 +22,13 @@ const _UTIME_OMIT = -1 // file is the real representation of *File. // The extra level of indirection ensures that no clients of os -// can overwrite this data, which could cause the cleanup +// can overwrite this data, which could cause the finalizer // to close the wrong file descriptor. type file struct { pfd poll.FD name string dirinfo atomic.Pointer[dirInfo] // nil unless directory being read appendMode bool // whether file is opened for appending - cleanup runtime.Cleanup // cleanup closes the file when no longer referenced } // fd is the Windows implementation of Fd. @@ -69,7 +68,7 @@ func newFile(h syscall.Handle, name string, kind string, nonBlocking bool) *File }, name: name, }} - f.cleanup = runtime.AddCleanup(f, func(f *file) { f.close() }, f.file) + runtime.SetFinalizer(f.file, (*file).close) // Ignore initialization errors. // Assume any problems will show up in later I/O. @@ -144,9 +143,8 @@ func (file *file) close() error { err = &PathError{Op: "close", Path: file.name, Err: e} } - // There is no need for a cleanup at this point. File must be alive at the point - // where cleanup.stop is called. - file.cleanup.Stop() + // no need for a finalizer anymore + runtime.SetFinalizer(file, nil) return err } diff --git a/src/os/os_windows_test.go b/src/os/os_windows_test.go index 89a61f0229..515d1c1359 100644 --- a/src/os/os_windows_test.go +++ b/src/os/os_windows_test.go @@ -64,9 +64,6 @@ func TestSameWindowsFile(t *testing.T) { } p := filepath.VolumeName(path) + filepath.Base(path) - if err != nil { - t.Fatal(err) - } ia3, err := os.Stat(p) if err != nil { t.Fatal(err) diff --git a/src/os/root_openat.go b/src/os/root_openat.go index 192c29e319..e433bd5093 100644 --- a/src/os/root_openat.go +++ b/src/os/root_openat.go @@ -22,11 +22,10 @@ type root struct { // refs is incremented while an operation is using fd. // closed is set when Close is called. // fd is closed when closed is true and refs is 0. - mu sync.Mutex - fd sysfdType - refs int // number of active operations - closed bool // set when closed - cleanup runtime.Cleanup // cleanup closes the file when no longer referenced + mu sync.Mutex + fd sysfdType + refs int // number of active operations + closed bool // set when closed } func (r *root) Close() error { @@ -36,9 +35,7 @@ func (r *root) Close() error { syscall.Close(r.fd) } r.closed = true - // There is no need for a cleanup at this point. Root must be alive at the point - // where cleanup.stop is called. - r.cleanup.Stop() + runtime.SetFinalizer(r, nil) // no need for a finalizer any more return nil } diff --git a/src/os/root_unix.go b/src/os/root_unix.go index ed21afffb5..4d6fc19a08 100644 --- a/src/os/root_unix.go +++ b/src/os/root_unix.go @@ -56,7 +56,7 @@ func newRoot(fd int, name string) (*Root, error) { fd: fd, name: name, }} - r.root.cleanup = runtime.AddCleanup(r, func(f *root) { f.Close() }, r.root) + runtime.SetFinalizer(r.root, (*root).Close) return r, nil } diff --git a/src/os/root_windows.go b/src/os/root_windows.go index a918606806..523ee48d13 100644 --- a/src/os/root_windows.go +++ b/src/os/root_windows.go @@ -113,7 +113,7 @@ func newRoot(fd syscall.Handle, name string) (*Root, error) { fd: fd, name: name, }} - r.root.cleanup = runtime.AddCleanup(r, func(f *root) { f.Close() }, r.root) + runtime.SetFinalizer(r.root, (*root).Close) return r, nil } diff --git a/src/os/user/user_windows_test.go b/src/os/user/user_windows_test.go index 7dca2fc5f9..c95811594d 100644 --- a/src/os/user/user_windows_test.go +++ b/src/os/user/user_windows_test.go @@ -7,6 +7,7 @@ package user import ( "crypto/rand" "encoding/base64" + "encoding/binary" "errors" "fmt" "internal/syscall/windows" @@ -16,11 +17,93 @@ import ( "runtime" "slices" "strconv" + "strings" + "sync" "syscall" "testing" + "unicode" + "unicode/utf8" "unsafe" ) +// addUserAccount creates a local user account. +// It returns the name and password of the new account. +// Multiple programs or goroutines calling addUserAccount simultaneously will not choose the same directory. +func addUserAccount(t *testing.T) (name, password string) { + t.TempDir() + pattern := t.Name() + // Windows limits the user name to 20 characters, + // leave space for a 4 digits random suffix. + const maxNameLen, suffixLen = 20, 4 + pattern = pattern[:min(len(pattern), maxNameLen-suffixLen)] + // Drop unusual characters from the account name. + mapper := func(r rune) rune { + if r < utf8.RuneSelf { + if '0' <= r && r <= '9' || + 'a' <= r && r <= 'z' || + 'A' <= r && r <= 'Z' { + return r + } + } else if unicode.IsLetter(r) || unicode.IsNumber(r) { + return r + } + return -1 + } + pattern = strings.Map(mapper, pattern) + + // Generate a long random password. + var pwd [33]byte + rand.Read(pwd[:]) + // Add special chars to ensure it satisfies password requirements. + password = base64.StdEncoding.EncodeToString(pwd[:]) + "_-As@!%*(1)4#2" + password16, err := syscall.UTF16PtrFromString(password) + if err != nil { + t.Fatal(err) + } + + try := 0 + for { + // Calculate a random suffix to append to the user name. + var suffix [2]byte + rand.Read(suffix[:]) + suffixStr := strconv.FormatUint(uint64(binary.LittleEndian.Uint16(suffix[:])), 10) + name := pattern + suffixStr[:min(len(suffixStr), suffixLen)] + name16, err := syscall.UTF16PtrFromString(name) + if err != nil { + t.Fatal(err) + } + // Create user. + userInfo := windows.UserInfo1{ + Name: name16, + Password: password16, + Priv: windows.USER_PRIV_USER, + } + err = windows.NetUserAdd(nil, 1, (*byte)(unsafe.Pointer(&userInfo)), nil) + if errors.Is(err, syscall.ERROR_ACCESS_DENIED) { + t.Skip("skipping test; don't have permission to create user") + } + // If the user already exists, try again with a different name. + if errors.Is(err, windows.NERR_UserExists) { + if try++; try < 1000 { + t.Log("user already exists, trying again with a different name") + continue + } + } + if err != nil { + t.Fatalf("NetUserAdd failed: %v", err) + } + // Delete the user when the test is done. + t.Cleanup(func() { + if err := windows.NetUserDel(nil, name16); err != nil { + if !errors.Is(err, windows.NERR_UserNotFound) { + t.Fatal(err) + } + } + }) + return name, password + } +} + // windowsTestAccount creates a test user and returns a token for that user. // If the user already exists, it will be deleted and recreated. // The caller is responsible for closing the token. @@ -32,47 +115,15 @@ func windowsTestAccount(t *testing.T) (syscall.Token, *User) { // See https://dev.go/issue/70396. t.Skip("skipping non-hermetic test outside of Go builders") } - const testUserName = "GoStdTestUser01" - var password [33]byte - rand.Read(password[:]) - // Add special chars to ensure it satisfies password requirements. - pwd := base64.StdEncoding.EncodeToString(password[:]) + "_-As@!%*(1)4#2" - name, err := syscall.UTF16PtrFromString(testUserName) + name, password := addUserAccount(t) + name16, err := syscall.UTF16PtrFromString(name) if err != nil { t.Fatal(err) } - pwd16, err := syscall.UTF16PtrFromString(pwd) + pwd16, err := syscall.UTF16PtrFromString(password) if err != nil { t.Fatal(err) } - userInfo := windows.UserInfo1{ - Name: name, - Password: pwd16, - Priv: windows.USER_PRIV_USER, - } - // Create user. - err = windows.NetUserAdd(nil, 1, (*byte)(unsafe.Pointer(&userInfo)), nil) - if errors.Is(err, syscall.ERROR_ACCESS_DENIED) { - t.Skip("skipping test; don't have permission to create user") - } - if errors.Is(err, windows.NERR_UserExists) { - // User already exists, delete and recreate. - if err = windows.NetUserDel(nil, name); err != nil { - t.Fatal(err) - } - if err = windows.NetUserAdd(nil, 1, (*byte)(unsafe.Pointer(&userInfo)), nil); err != nil { - t.Fatal(err) - } - } else if err != nil { - t.Fatal(err) - } - t.Cleanup(func() { - if err = windows.NetUserDel(nil, name); err != nil { - if !errors.Is(err, windows.NERR_UserNotFound) { - t.Fatal(err) - } - } - }) domain, err := syscall.UTF16PtrFromString(".") if err != nil { t.Fatal(err) @@ -80,13 +131,13 @@ func windowsTestAccount(t *testing.T) (syscall.Token, *User) { const LOGON32_PROVIDER_DEFAULT = 0 const LOGON32_LOGON_INTERACTIVE = 2 var token syscall.Token - if err = windows.LogonUser(name, domain, pwd16, LOGON32_LOGON_INTERACTIVE, LOGON32_PROVIDER_DEFAULT, &token); err != nil { + if err = windows.LogonUser(name16, domain, pwd16, LOGON32_LOGON_INTERACTIVE, LOGON32_PROVIDER_DEFAULT, &token); err != nil { t.Fatal(err) } t.Cleanup(func() { token.Close() }) - usr, err := Lookup(testUserName) + usr, err := Lookup(name) if err != nil { t.Fatal(err) } @@ -211,9 +262,21 @@ func TestGroupIdsTestUser(t *testing.T) { } } +var isSystemDefaultLCIDEnglish = sync.OnceValue(func() bool { + // GetSystemDefaultLCID() + // https://learn.microsoft.com/en-us/windows/win32/api/winnls/nf-winnls-getsystemdefaultlcid + r, _, _ := syscall.MustLoadDLL("kernel32.dll").MustFindProc("GetSystemDefaultLCID").Call() + lcid := uint32(r) + + lcidLow := lcid & 0xFF + // 0x0409 is en-US + // 0x1000 is "Locale without assigned LCID" + return lcidLow == 0x00 || lcidLow == 0x09 +}) + var serviceAccounts = []struct { sid string - name string + name string // name on english Windows }{ {"S-1-5-18", "NT AUTHORITY\\SYSTEM"}, {"S-1-5-19", "NT AUTHORITY\\LOCAL SERVICE"}, @@ -223,14 +286,21 @@ var serviceAccounts = []struct { func TestLookupServiceAccount(t *testing.T) { t.Parallel() for _, tt := range serviceAccounts { - u, err := Lookup(tt.name) - if err != nil { - t.Errorf("Lookup(%q): %v", tt.name, err) - continue - } - if u.Uid != tt.sid { - t.Errorf("unexpected uid for %q; got %q, want %q", u.Name, u.Uid, tt.sid) - } + t.Run(tt.name, func(t *testing.T) { + u, err := Lookup(tt.name) + if err != nil { + t.Logf("Lookup(%q): %v", tt.name, err) + if !isSystemDefaultLCIDEnglish() { + t.Skipf("test not supported on non-English Windows") + } + t.Fail() + return + } + if u.Uid != tt.sid { + t.Errorf("unexpected uid for %q; got %q, want %q", u.Name, u.Uid, tt.sid) + } + t.Logf("Lookup(%q): %q", tt.name, u.Username) + }) } } @@ -246,7 +316,11 @@ func TestLookupIdServiceAccount(t *testing.T) { t.Errorf("unexpected gid for %q; got %q, want %q", u.Name, u.Gid, tt.sid) } if u.Username != tt.name { - t.Errorf("unexpected user name for %q; got %q, want %q", u.Gid, u.Username, tt.name) + if isSystemDefaultLCIDEnglish() { + t.Errorf("unexpected user name for %q; got %q, want %q", u.Gid, u.Username, tt.name) + } else { + t.Logf("user name for %q: %q", u.Gid, u.Username) + } } } } @@ -254,14 +328,20 @@ func TestLookupIdServiceAccount(t *testing.T) { func TestLookupGroupServiceAccount(t *testing.T) { t.Parallel() for _, tt := range serviceAccounts { - u, err := LookupGroup(tt.name) - if err != nil { - t.Errorf("LookupGroup(%q): %v", tt.name, err) - continue - } - if u.Gid != tt.sid { - t.Errorf("unexpected gid for %q; got %q, want %q", u.Name, u.Gid, tt.sid) - } + t.Run(tt.name, func(t *testing.T) { + g, err := LookupGroup(tt.name) + if err != nil { + t.Logf("LookupGroup(%q): %v", tt.name, err) + if !isSystemDefaultLCIDEnglish() { + t.Skipf("test not supported on non-English Windows") + } + t.Fail() + return + } + if g.Gid != tt.sid { + t.Errorf("unexpected gid for %q; got %q, want %q", g.Name, g.Gid, tt.sid) + } + }) } } diff --git a/src/reflect/abi.go b/src/reflect/abi.go index b67d821743..bcd0a95f1b 100644 --- a/src/reflect/abi.go +++ b/src/reflect/abi.go @@ -166,7 +166,7 @@ func (a *abiSeq) addRcvr(rcvr *abi.Type) (*abiStep, bool) { // The receiver is always one word. a.valueStart = append(a.valueStart, len(a.steps)) var ok, ptr bool - if rcvr.IfaceIndir() || rcvr.Pointers() { + if !rcvr.IsDirectIface() || rcvr.Pointers() { ok = a.assignIntN(0, goarch.PtrSize, 1, 0b1) ptr = true } else { diff --git a/src/reflect/all_test.go b/src/reflect/all_test.go index cd3e306a57..da7b2d7764 100644 --- a/src/reflect/all_test.go +++ b/src/reflect/all_test.go @@ -12,7 +12,6 @@ import ( "go/token" "internal/asan" "internal/goarch" - "internal/goexperiment" "internal/msan" "internal/race" "internal/testenv" @@ -1277,10 +1276,6 @@ var deepEqualPerfTests = []struct { } func TestDeepEqualAllocs(t *testing.T) { - // TODO(prattmic): maps on stack - if goexperiment.SwissMap { - t.Skipf("Maps on stack not yet implemented") - } if asan.Enabled { t.Skip("test allocates more with -asan; see #70079") } @@ -7343,7 +7338,8 @@ func TestGCBits(t *testing.T) { verifyGCBits(t, TypeOf(([][10000]Xscalar)(nil)), lit(1)) verifyGCBits(t, SliceOf(ArrayOf(10000, Tscalar)), lit(1)) - testGCBitsMap(t) + // For maps, we don't manually construct GC data, instead using the + // public reflect API in groupAndSlotOf. } func rep(n int, b []byte) []byte { return bytes.Repeat(b, n) } diff --git a/src/reflect/badlinkname.go b/src/reflect/badlinkname.go index eb701bff03..8a9bea6721 100644 --- a/src/reflect/badlinkname.go +++ b/src/reflect/badlinkname.go @@ -27,7 +27,7 @@ import ( // //go:linkname unusedIfaceIndir reflect.ifaceIndir func unusedIfaceIndir(t *abi.Type) bool { - return t.Kind_&abi.KindDirectIface == 0 + return !t.IsDirectIface() } //go:linkname valueInterface diff --git a/src/reflect/export_noswiss_test.go b/src/reflect/export_noswiss_test.go deleted file mode 100644 index 34e5e92055..0000000000 --- a/src/reflect/export_noswiss_test.go +++ /dev/null @@ -1,25 +0,0 @@ -// Copyright 2024 Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -package reflect - -import ( - "internal/abi" - "unsafe" -) - -func MapBucketOf(x, y Type) Type { - return toType(bucketOf(x.common(), y.common())) -} - -func CachedBucketOf(m Type) Type { - t := m.(*rtype) - if Kind(t.t.Kind_&abi.KindMask) != Map { - panic("not map") - } - tt := (*mapType)(unsafe.Pointer(t)) - return toType(tt.Bucket) -} diff --git a/src/reflect/export_swiss_test.go b/src/reflect/export_swiss_test.go deleted file mode 100644 index ac3cd0adf7..0000000000 --- a/src/reflect/export_swiss_test.go +++ /dev/null @@ -1,12 +0,0 @@ -// Copyright 2024 Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build goexperiment.swissmap - -package reflect - -func MapGroupOf(x, y Type) Type { - grp, _ := groupAndSlotOf(x, y) - return grp -} diff --git a/src/reflect/export_test.go b/src/reflect/export_test.go index eedd063fcb..fc209fdfba 100644 --- a/src/reflect/export_test.go +++ b/src/reflect/export_test.go @@ -152,3 +152,8 @@ var MethodValueCallCodePtr = methodValueCallCodePtr var InternalIsZero = isZero var IsRegularMemory = isRegularMemory + +func MapGroupOf(x, y Type) Type { + grp, _ := groupAndSlotOf(x, y) + return grp +} diff --git a/src/reflect/makefunc.go b/src/reflect/makefunc.go index 5da6cd2ec7..d35c92a14c 100644 --- a/src/reflect/makefunc.go +++ b/src/reflect/makefunc.go @@ -8,6 +8,7 @@ package reflect import ( "internal/abi" + "internal/goarch" "unsafe" ) @@ -164,13 +165,18 @@ func moveMakeFuncArgPtrs(ctxt *makeFuncCtxt, args *abi.RegArgs) { for i, arg := range args.Ints { // Avoid write barriers! Because our write barrier enqueues what // was there before, we might enqueue garbage. + // Also avoid bounds checks, we don't have the stack space for it. + // (Normally the prove pass removes them, but for -N builds we + // use too much stack.) + // ptr := &args.Ptrs[i] (but cast from *unsafe.Pointer to *uintptr) + ptr := (*uintptr)(add(unsafe.Pointer(unsafe.SliceData(args.Ptrs[:])), uintptr(i)*goarch.PtrSize, "always in [0:IntArgRegs]")) if ctxt.regPtrs.Get(i) { - *(*uintptr)(unsafe.Pointer(&args.Ptrs[i])) = arg + *ptr = arg } else { // We *must* zero this space ourselves because it's defined in // assembly code and the GC will scan these pointers. Otherwise, // there will be garbage here. - *(*uintptr)(unsafe.Pointer(&args.Ptrs[i])) = 0 + *ptr = 0 } } } diff --git a/src/reflect/map_swiss.go b/src/reflect/map.go index 2eac51e57d..9d25b1818c 100644 --- a/src/reflect/map_swiss.go +++ b/src/reflect/map.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.swissmap - package reflect import ( @@ -14,16 +12,11 @@ import ( "unsafe" ) -// mapType represents a map type. -// -// TODO(prattmic): Only used within this file, could be cleaned up. -type mapType = abi.SwissMapType - func (t *rtype) Key() Type { if t.Kind() != Map { panic("reflect: Key of non-map type " + t.String()) } - tt := (*mapType)(unsafe.Pointer(t)) + tt := (*abi.MapType)(unsafe.Pointer(t)) return toType(tt.Key) } @@ -50,7 +43,7 @@ func MapOf(key, elem Type) Type { // Look in known types. s := "map[" + stringFor(ktyp) + "]" + stringFor(etyp) for _, tt := range typesByString(s) { - mt := (*mapType)(unsafe.Pointer(tt)) + mt := (*abi.MapType)(unsafe.Pointer(tt)) if mt.Key == ktyp && mt.Elem == etyp { ti, _ := lookupCache.LoadOrStore(ckey, toRType(tt)) return ti.(Type) @@ -63,9 +56,9 @@ func MapOf(key, elem Type) Type { // Note: flag values must match those used in the TMAP case // in ../cmd/compile/internal/reflectdata/reflect.go:writeType. var imap any = (map[unsafe.Pointer]unsafe.Pointer)(nil) - mt := **(**mapType)(unsafe.Pointer(&imap)) + mt := **(**abi.MapType)(unsafe.Pointer(&imap)) mt.Str = resolveReflectName(newName(s, "", false, false)) - mt.TFlag = 0 + mt.TFlag = abi.TFlagDirectIface mt.Hash = fnv1(etyp.Hash, 'm', byte(ktyp.Hash>>24), byte(ktyp.Hash>>16), byte(ktyp.Hash>>8), byte(ktyp.Hash)) mt.Key = ktyp mt.Elem = etyp @@ -78,16 +71,16 @@ func MapOf(key, elem Type) Type { mt.ElemOff = slot.Field(1).Offset mt.Flags = 0 if needKeyUpdate(ktyp) { - mt.Flags |= abi.SwissMapNeedKeyUpdate + mt.Flags |= abi.MapNeedKeyUpdate } if hashMightPanic(ktyp) { - mt.Flags |= abi.SwissMapHashMightPanic + mt.Flags |= abi.MapHashMightPanic } - if ktyp.Size_ > abi.SwissMapMaxKeyBytes { - mt.Flags |= abi.SwissMapIndirectKey + if ktyp.Size_ > abi.MapMaxKeyBytes { + mt.Flags |= abi.MapIndirectKey } - if etyp.Size_ > abi.SwissMapMaxKeyBytes { - mt.Flags |= abi.SwissMapIndirectElem + if etyp.Size_ > abi.MapMaxKeyBytes { + mt.Flags |= abi.MapIndirectElem } mt.PtrToThis = 0 @@ -98,16 +91,16 @@ func MapOf(key, elem Type) Type { func groupAndSlotOf(ktyp, etyp Type) (Type, Type) { // type group struct { // ctrl uint64 - // slots [abi.SwissMapGroupSlots]struct { + // slots [abi.MapGroupSlots]struct { // key keyType // elem elemType // } // } - if ktyp.Size() > abi.SwissMapMaxKeyBytes { + if ktyp.Size() > abi.MapMaxKeyBytes { ktyp = PointerTo(ktyp) } - if etyp.Size() > abi.SwissMapMaxElemBytes { + if etyp.Size() > abi.MapMaxElemBytes { etyp = PointerTo(etyp) } @@ -130,7 +123,7 @@ func groupAndSlotOf(ktyp, etyp Type) (Type, Type) { }, { Name: "Slots", - Type: ArrayOf(abi.SwissMapGroupSlots, slot), + Type: ArrayOf(abi.MapGroupSlots, slot), }, } group := StructOf(fields) @@ -145,7 +138,7 @@ var stringType = rtypeOf("") // As in Go, the key's value must be assignable to the map's key type. func (v Value) MapIndex(key Value) Value { v.mustBe(Map) - tt := (*mapType)(unsafe.Pointer(v.typ())) + tt := (*abi.MapType)(unsafe.Pointer(v.typ())) // Do not require key to be exported, so that DeepEqual // and other programs can use all the keys returned by @@ -156,7 +149,7 @@ func (v Value) MapIndex(key Value) Value { // of unexported fields. var e unsafe.Pointer - if (tt.Key == stringType || key.kind() == String) && tt.Key == key.typ() && tt.Elem.Size() <= abi.SwissMapMaxElemBytes { + if (tt.Key == stringType || key.kind() == String) && tt.Key == key.typ() && tt.Elem.Size() <= abi.MapMaxElemBytes { k := *(*string)(key.ptr) e = mapaccess_faststr(v.typ(), v.pointer(), k) } else { @@ -181,7 +174,7 @@ func (v Value) MapIndex(key Value) Value { // Equivalent to runtime.mapIterStart. // //go:noinline -func mapIterStart(t *abi.SwissMapType, m *maps.Map, it *maps.Iter) { +func mapIterStart(t *abi.MapType, m *maps.Map, it *maps.Iter) { if race.Enabled && m != nil { callerpc := sys.GetCallerPC() race.ReadPC(unsafe.Pointer(m), callerpc, abi.FuncPCABIInternal(mapIterStart)) @@ -209,7 +202,7 @@ func mapIterNext(it *maps.Iter) { // It returns an empty slice if v represents a nil map. func (v Value) MapKeys() []Value { v.mustBe(Map) - tt := (*mapType)(unsafe.Pointer(v.typ())) + tt := (*abi.MapType)(unsafe.Pointer(v.typ())) keyType := tt.Key fl := v.flag.ro() | flag(keyType.Kind()) @@ -248,10 +241,6 @@ type MapIter struct { hiter maps.Iter } -// TODO(prattmic): only for sharing the linkname declarations with old maps. -// Remove with old maps. -type hiter = maps.Iter - // Key returns the key of iter's current map entry. func (iter *MapIter) Key() Value { if !iter.hiter.Initialized() { @@ -262,7 +251,7 @@ func (iter *MapIter) Key() Value { panic("MapIter.Key called on exhausted iterator") } - t := (*mapType)(unsafe.Pointer(iter.m.typ())) + t := (*abi.MapType)(unsafe.Pointer(iter.m.typ())) ktype := t.Key return copyVal(ktype, iter.m.flag.ro()|flag(ktype.Kind()), iterkey) } @@ -287,7 +276,7 @@ func (v Value) SetIterKey(iter *MapIter) { target = v.ptr } - t := (*mapType)(unsafe.Pointer(iter.m.typ())) + t := (*abi.MapType)(unsafe.Pointer(iter.m.typ())) ktype := t.Key iter.m.mustBeExported() // do not let unexported m leak @@ -306,7 +295,7 @@ func (iter *MapIter) Value() Value { panic("MapIter.Value called on exhausted iterator") } - t := (*mapType)(unsafe.Pointer(iter.m.typ())) + t := (*abi.MapType)(unsafe.Pointer(iter.m.typ())) vtype := t.Elem return copyVal(vtype, iter.m.flag.ro()|flag(vtype.Kind()), iterelem) } @@ -331,7 +320,7 @@ func (v Value) SetIterValue(iter *MapIter) { target = v.ptr } - t := (*mapType)(unsafe.Pointer(iter.m.typ())) + t := (*abi.MapType)(unsafe.Pointer(iter.m.typ())) vtype := t.Elem iter.m.mustBeExported() // do not let unexported m leak @@ -348,7 +337,7 @@ func (iter *MapIter) Next() bool { panic("MapIter.Next called on an iterator that does not have an associated map Value") } if !iter.hiter.Initialized() { - t := (*mapType)(unsafe.Pointer(iter.m.typ())) + t := (*abi.MapType)(unsafe.Pointer(iter.m.typ())) m := (*maps.Map)(iter.m.pointer()) mapIterStart(t, m, &iter.hiter) } else { @@ -408,9 +397,9 @@ func (v Value) SetMapIndex(key, elem Value) { v.mustBe(Map) v.mustBeExported() key.mustBeExported() - tt := (*mapType)(unsafe.Pointer(v.typ())) + tt := (*abi.MapType)(unsafe.Pointer(v.typ())) - if (tt.Key == stringType || key.kind() == String) && tt.Key == key.typ() && tt.Elem.Size() <= abi.SwissMapMaxElemBytes { + if (tt.Key == stringType || key.kind() == String) && tt.Key == key.typ() && tt.Elem.Size() <= abi.MapMaxElemBytes { k := *(*string)(key.ptr) if elem.typ() == nil { mapdelete_faststr(v.typ(), v.pointer(), k) diff --git a/src/reflect/map_noswiss.go b/src/reflect/map_noswiss.go deleted file mode 100644 index 19696a4f4b..0000000000 --- a/src/reflect/map_noswiss.go +++ /dev/null @@ -1,484 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -package reflect - -import ( - "internal/abi" - "internal/goarch" - "unsafe" -) - -// mapType represents a map type. -type mapType struct { - abi.OldMapType -} - -// Pushed from runtime. - -//go:noescape -func mapiterinit(t *abi.Type, m unsafe.Pointer, it *hiter) - -//go:noescape -func mapiternext(it *hiter) - -func (t *rtype) Key() Type { - if t.Kind() != Map { - panic("reflect: Key of non-map type " + t.String()) - } - tt := (*mapType)(unsafe.Pointer(t)) - return toType(tt.Key) -} - -// MapOf returns the map type with the given key and element types. -// For example, if k represents int and e represents string, -// MapOf(k, e) represents map[int]string. -// -// If the key type is not a valid map key type (that is, if it does -// not implement Go's == operator), MapOf panics. -func MapOf(key, elem Type) Type { - ktyp := key.common() - etyp := elem.common() - - if ktyp.Equal == nil { - panic("reflect.MapOf: invalid key type " + stringFor(ktyp)) - } - - // Look in cache. - ckey := cacheKey{Map, ktyp, etyp, 0} - if mt, ok := lookupCache.Load(ckey); ok { - return mt.(Type) - } - - // Look in known types. - s := "map[" + stringFor(ktyp) + "]" + stringFor(etyp) - for _, tt := range typesByString(s) { - mt := (*mapType)(unsafe.Pointer(tt)) - if mt.Key == ktyp && mt.Elem == etyp { - ti, _ := lookupCache.LoadOrStore(ckey, toRType(tt)) - return ti.(Type) - } - } - - // Make a map type. - // Note: flag values must match those used in the TMAP case - // in ../cmd/compile/internal/reflectdata/reflect.go:writeType. - var imap any = (map[unsafe.Pointer]unsafe.Pointer)(nil) - mt := **(**mapType)(unsafe.Pointer(&imap)) - mt.Str = resolveReflectName(newName(s, "", false, false)) - mt.TFlag = 0 - mt.Hash = fnv1(etyp.Hash, 'm', byte(ktyp.Hash>>24), byte(ktyp.Hash>>16), byte(ktyp.Hash>>8), byte(ktyp.Hash)) - mt.Key = ktyp - mt.Elem = etyp - mt.Bucket = bucketOf(ktyp, etyp) - mt.Hasher = func(p unsafe.Pointer, seed uintptr) uintptr { - return typehash(ktyp, p, seed) - } - mt.Flags = 0 - if ktyp.Size_ > abi.OldMapMaxKeyBytes { - mt.KeySize = uint8(goarch.PtrSize) - mt.Flags |= 1 // indirect key - } else { - mt.KeySize = uint8(ktyp.Size_) - } - if etyp.Size_ > abi.OldMapMaxElemBytes { - mt.ValueSize = uint8(goarch.PtrSize) - mt.Flags |= 2 // indirect value - } else { - mt.ValueSize = uint8(etyp.Size_) - } - mt.BucketSize = uint16(mt.Bucket.Size_) - if isReflexive(ktyp) { - mt.Flags |= 4 - } - if needKeyUpdate(ktyp) { - mt.Flags |= 8 - } - if hashMightPanic(ktyp) { - mt.Flags |= 16 - } - mt.PtrToThis = 0 - - ti, _ := lookupCache.LoadOrStore(ckey, toRType(&mt.Type)) - return ti.(Type) -} - -func bucketOf(ktyp, etyp *abi.Type) *abi.Type { - if ktyp.Size_ > abi.OldMapMaxKeyBytes { - ktyp = ptrTo(ktyp) - } - if etyp.Size_ > abi.OldMapMaxElemBytes { - etyp = ptrTo(etyp) - } - - // Prepare GC data if any. - // A bucket is at most bucketSize*(1+maxKeySize+maxValSize)+ptrSize bytes, - // or 2064 bytes, or 258 pointer-size words, or 33 bytes of pointer bitmap. - // Note that since the key and value are known to be <= 128 bytes, - // they're guaranteed to have bitmaps instead of GC programs. - var gcdata *byte - var ptrdata uintptr - - size := abi.OldMapBucketCount*(1+ktyp.Size_+etyp.Size_) + goarch.PtrSize - if size&uintptr(ktyp.Align_-1) != 0 || size&uintptr(etyp.Align_-1) != 0 { - panic("reflect: bad size computation in MapOf") - } - - if ktyp.Pointers() || etyp.Pointers() { - nptr := (abi.OldMapBucketCount*(1+ktyp.Size_+etyp.Size_) + goarch.PtrSize) / goarch.PtrSize - n := (nptr + 7) / 8 - - // Runtime needs pointer masks to be a multiple of uintptr in size. - n = (n + goarch.PtrSize - 1) &^ (goarch.PtrSize - 1) - mask := make([]byte, n) - base := uintptr(abi.OldMapBucketCount / goarch.PtrSize) - - if ktyp.Pointers() { - emitGCMask(mask, base, ktyp, abi.OldMapBucketCount) - } - base += abi.OldMapBucketCount * ktyp.Size_ / goarch.PtrSize - - if etyp.Pointers() { - emitGCMask(mask, base, etyp, abi.OldMapBucketCount) - } - base += abi.OldMapBucketCount * etyp.Size_ / goarch.PtrSize - - word := base - mask[word/8] |= 1 << (word % 8) - gcdata = &mask[0] - ptrdata = (word + 1) * goarch.PtrSize - - // overflow word must be last - if ptrdata != size { - panic("reflect: bad layout computation in MapOf") - } - } - - b := &abi.Type{ - Align_: goarch.PtrSize, - Size_: size, - Kind_: abi.Struct, - PtrBytes: ptrdata, - GCData: gcdata, - } - s := "bucket(" + stringFor(ktyp) + "," + stringFor(etyp) + ")" - b.Str = resolveReflectName(newName(s, "", false, false)) - return b -} - -var stringType = rtypeOf("") - -// MapIndex returns the value associated with key in the map v. -// It panics if v's Kind is not [Map]. -// It returns the zero Value if key is not found in the map or if v represents a nil map. -// As in Go, the key's value must be assignable to the map's key type. -func (v Value) MapIndex(key Value) Value { - v.mustBe(Map) - tt := (*mapType)(unsafe.Pointer(v.typ())) - - // Do not require key to be exported, so that DeepEqual - // and other programs can use all the keys returned by - // MapKeys as arguments to MapIndex. If either the map - // or the key is unexported, though, the result will be - // considered unexported. This is consistent with the - // behavior for structs, which allow read but not write - // of unexported fields. - - var e unsafe.Pointer - if (tt.Key == stringType || key.kind() == String) && tt.Key == key.typ() && tt.Elem.Size() <= abi.OldMapMaxElemBytes { - k := *(*string)(key.ptr) - e = mapaccess_faststr(v.typ(), v.pointer(), k) - } else { - key = key.assignTo("reflect.Value.MapIndex", tt.Key, nil) - var k unsafe.Pointer - if key.flag&flagIndir != 0 { - k = key.ptr - } else { - k = unsafe.Pointer(&key.ptr) - } - e = mapaccess(v.typ(), v.pointer(), k) - } - if e == nil { - return Value{} - } - typ := tt.Elem - fl := (v.flag | key.flag).ro() - fl |= flag(typ.Kind()) - return copyVal(typ, fl, e) -} - -// MapKeys returns a slice containing all the keys present in the map, -// in unspecified order. -// It panics if v's Kind is not [Map]. -// It returns an empty slice if v represents a nil map. -func (v Value) MapKeys() []Value { - v.mustBe(Map) - tt := (*mapType)(unsafe.Pointer(v.typ())) - keyType := tt.Key - - fl := v.flag.ro() | flag(keyType.Kind()) - - m := v.pointer() - mlen := int(0) - if m != nil { - mlen = maplen(m) - } - var it hiter - mapiterinit(v.typ(), m, &it) - a := make([]Value, mlen) - var i int - for i = 0; i < len(a); i++ { - key := it.key - if key == nil { - // Someone deleted an entry from the map since we - // called maplen above. It's a data race, but nothing - // we can do about it. - break - } - a[i] = copyVal(keyType, fl, key) - mapiternext(&it) - } - return a[:i] -} - -// hiter's structure matches runtime.hiter's structure. -// Having a clone here allows us to embed a map iterator -// inside type MapIter so that MapIters can be re-used -// without doing any allocations. -type hiter struct { - key unsafe.Pointer - elem unsafe.Pointer - t unsafe.Pointer - h unsafe.Pointer - buckets unsafe.Pointer - bptr unsafe.Pointer - overflow *[]unsafe.Pointer - oldoverflow *[]unsafe.Pointer - startBucket uintptr - offset uint8 - wrapped bool - B uint8 - i uint8 - bucket uintptr - checkBucket uintptr - clearSeq uint64 -} - -func (h *hiter) initialized() bool { - return h.t != nil -} - -// A MapIter is an iterator for ranging over a map. -// See [Value.MapRange]. -type MapIter struct { - m Value - hiter hiter -} - -// Key returns the key of iter's current map entry. -func (iter *MapIter) Key() Value { - if !iter.hiter.initialized() { - panic("MapIter.Key called before Next") - } - iterkey := iter.hiter.key - if iterkey == nil { - panic("MapIter.Key called on exhausted iterator") - } - - t := (*mapType)(unsafe.Pointer(iter.m.typ())) - ktype := t.Key - return copyVal(ktype, iter.m.flag.ro()|flag(ktype.Kind()), iterkey) -} - -// SetIterKey assigns to v the key of iter's current map entry. -// It is equivalent to v.Set(iter.Key()), but it avoids allocating a new Value. -// As in Go, the key must be assignable to v's type and -// must not be derived from an unexported field. -// It panics if [Value.CanSet] returns false. -func (v Value) SetIterKey(iter *MapIter) { - if !iter.hiter.initialized() { - panic("reflect: Value.SetIterKey called before Next") - } - iterkey := iter.hiter.key - if iterkey == nil { - panic("reflect: Value.SetIterKey called on exhausted iterator") - } - - v.mustBeAssignable() - var target unsafe.Pointer - if v.kind() == Interface { - target = v.ptr - } - - t := (*mapType)(unsafe.Pointer(iter.m.typ())) - ktype := t.Key - - iter.m.mustBeExported() // do not let unexported m leak - key := Value{ktype, iterkey, iter.m.flag | flag(ktype.Kind()) | flagIndir} - key = key.assignTo("reflect.MapIter.SetKey", v.typ(), target) - typedmemmove(v.typ(), v.ptr, key.ptr) -} - -// Value returns the value of iter's current map entry. -func (iter *MapIter) Value() Value { - if !iter.hiter.initialized() { - panic("MapIter.Value called before Next") - } - iterelem := iter.hiter.elem - if iterelem == nil { - panic("MapIter.Value called on exhausted iterator") - } - - t := (*mapType)(unsafe.Pointer(iter.m.typ())) - vtype := t.Elem - return copyVal(vtype, iter.m.flag.ro()|flag(vtype.Kind()), iterelem) -} - -// SetIterValue assigns to v the value of iter's current map entry. -// It is equivalent to v.Set(iter.Value()), but it avoids allocating a new Value. -// As in Go, the value must be assignable to v's type and -// must not be derived from an unexported field. -// It panics if [Value.CanSet] returns false. -func (v Value) SetIterValue(iter *MapIter) { - if !iter.hiter.initialized() { - panic("reflect: Value.SetIterValue called before Next") - } - iterelem := iter.hiter.elem - if iterelem == nil { - panic("reflect: Value.SetIterValue called on exhausted iterator") - } - - v.mustBeAssignable() - var target unsafe.Pointer - if v.kind() == Interface { - target = v.ptr - } - - t := (*mapType)(unsafe.Pointer(iter.m.typ())) - vtype := t.Elem - - iter.m.mustBeExported() // do not let unexported m leak - elem := Value{vtype, iterelem, iter.m.flag | flag(vtype.Kind()) | flagIndir} - elem = elem.assignTo("reflect.MapIter.SetValue", v.typ(), target) - typedmemmove(v.typ(), v.ptr, elem.ptr) -} - -// Next advances the map iterator and reports whether there is another -// entry. It returns false when iter is exhausted; subsequent -// calls to [MapIter.Key], [MapIter.Value], or [MapIter.Next] will panic. -func (iter *MapIter) Next() bool { - if !iter.m.IsValid() { - panic("MapIter.Next called on an iterator that does not have an associated map Value") - } - if !iter.hiter.initialized() { - mapiterinit(iter.m.typ(), iter.m.pointer(), &iter.hiter) - } else { - if iter.hiter.key == nil { - panic("MapIter.Next called on exhausted iterator") - } - mapiternext(&iter.hiter) - } - return iter.hiter.key != nil -} - -// Reset modifies iter to iterate over v. -// It panics if v's Kind is not [Map] and v is not the zero Value. -// Reset(Value{}) causes iter to not to refer to any map, -// which may allow the previously iterated-over map to be garbage collected. -func (iter *MapIter) Reset(v Value) { - if v.IsValid() { - v.mustBe(Map) - } - iter.m = v - iter.hiter = hiter{} -} - -// MapRange returns a range iterator for a map. -// It panics if v's Kind is not [Map]. -// -// Call [MapIter.Next] to advance the iterator, and [MapIter.Key]/[MapIter.Value] to access each entry. -// [MapIter.Next] returns false when the iterator is exhausted. -// MapRange follows the same iteration semantics as a range statement. -// -// Example: -// -// iter := reflect.ValueOf(m).MapRange() -// for iter.Next() { -// k := iter.Key() -// v := iter.Value() -// ... -// } -func (v Value) MapRange() *MapIter { - // This is inlinable to take advantage of "function outlining". - // The allocation of MapIter can be stack allocated if the caller - // does not allow it to escape. - // See https://blog.filippo.io/efficient-go-apis-with-the-inliner/ - if v.kind() != Map { - v.panicNotMap() - } - return &MapIter{m: v} -} - -// SetMapIndex sets the element associated with key in the map v to elem. -// It panics if v's Kind is not [Map]. -// If elem is the zero Value, SetMapIndex deletes the key from the map. -// Otherwise if v holds a nil map, SetMapIndex will panic. -// As in Go, key's elem must be assignable to the map's key type, -// and elem's value must be assignable to the map's elem type. -func (v Value) SetMapIndex(key, elem Value) { - v.mustBe(Map) - v.mustBeExported() - key.mustBeExported() - tt := (*mapType)(unsafe.Pointer(v.typ())) - - if (tt.Key == stringType || key.kind() == String) && tt.Key == key.typ() && tt.Elem.Size() <= abi.OldMapMaxElemBytes { - k := *(*string)(key.ptr) - if elem.typ() == nil { - mapdelete_faststr(v.typ(), v.pointer(), k) - return - } - elem.mustBeExported() - elem = elem.assignTo("reflect.Value.SetMapIndex", tt.Elem, nil) - var e unsafe.Pointer - if elem.flag&flagIndir != 0 { - e = elem.ptr - } else { - e = unsafe.Pointer(&elem.ptr) - } - mapassign_faststr(v.typ(), v.pointer(), k, e) - return - } - - key = key.assignTo("reflect.Value.SetMapIndex", tt.Key, nil) - var k unsafe.Pointer - if key.flag&flagIndir != 0 { - k = key.ptr - } else { - k = unsafe.Pointer(&key.ptr) - } - if elem.typ() == nil { - mapdelete(v.typ(), v.pointer(), k) - return - } - elem.mustBeExported() - elem = elem.assignTo("reflect.Value.SetMapIndex", tt.Elem, nil) - var e unsafe.Pointer - if elem.flag&flagIndir != 0 { - e = elem.ptr - } else { - e = unsafe.Pointer(&elem.ptr) - } - mapassign(v.typ(), v.pointer(), k, e) -} - -// Force slow panicking path not inlined, so it won't add to the -// inlining budget of the caller. -// TODO: undo when the inliner is no longer bottom-up only. -// -//go:noinline -func (f flag) panicNotMap() { - f.mustBe(Map) -} diff --git a/src/reflect/map_noswiss_test.go b/src/reflect/map_noswiss_test.go deleted file mode 100644 index 52fcf89535..0000000000 --- a/src/reflect/map_noswiss_test.go +++ /dev/null @@ -1,60 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -package reflect_test - -import ( - "internal/abi" - "internal/goarch" - . "reflect" - "testing" -) - -func testGCBitsMap(t *testing.T) { - const bucketCount = abi.OldMapBucketCount - - hdr := make([]byte, bucketCount/goarch.PtrSize) - - verifyMapBucket := func(t *testing.T, k, e Type, m any, want []byte) { - verifyGCBits(t, MapBucketOf(k, e), want) - verifyGCBits(t, CachedBucketOf(TypeOf(m)), want) - } - verifyMapBucket(t, - Tscalar, Tptr, - map[Xscalar]Xptr(nil), - join(hdr, rep(bucketCount, lit(0)), rep(bucketCount, lit(1)), lit(1))) - verifyMapBucket(t, - Tscalarptr, Tptr, - map[Xscalarptr]Xptr(nil), - join(hdr, rep(bucketCount, lit(0, 1)), rep(bucketCount, lit(1)), lit(1))) - verifyMapBucket(t, Tint64, Tptr, - map[int64]Xptr(nil), - join(hdr, rep(bucketCount, rep(8/goarch.PtrSize, lit(0))), rep(bucketCount, lit(1)), lit(1))) - verifyMapBucket(t, - Tscalar, Tscalar, - map[Xscalar]Xscalar(nil), - empty) - verifyMapBucket(t, - ArrayOf(2, Tscalarptr), ArrayOf(3, Tptrscalar), - map[[2]Xscalarptr][3]Xptrscalar(nil), - join(hdr, rep(bucketCount*2, lit(0, 1)), rep(bucketCount*3, lit(1, 0)), lit(1))) - verifyMapBucket(t, - ArrayOf(64/goarch.PtrSize, Tscalarptr), ArrayOf(64/goarch.PtrSize, Tptrscalar), - map[[64 / goarch.PtrSize]Xscalarptr][64 / goarch.PtrSize]Xptrscalar(nil), - join(hdr, rep(bucketCount*64/goarch.PtrSize, lit(0, 1)), rep(bucketCount*64/goarch.PtrSize, lit(1, 0)), lit(1))) - verifyMapBucket(t, - ArrayOf(64/goarch.PtrSize+1, Tscalarptr), ArrayOf(64/goarch.PtrSize, Tptrscalar), - map[[64/goarch.PtrSize + 1]Xscalarptr][64 / goarch.PtrSize]Xptrscalar(nil), - join(hdr, rep(bucketCount, lit(1)), rep(bucketCount*64/goarch.PtrSize, lit(1, 0)), lit(1))) - verifyMapBucket(t, - ArrayOf(64/goarch.PtrSize, Tscalarptr), ArrayOf(64/goarch.PtrSize+1, Tptrscalar), - map[[64 / goarch.PtrSize]Xscalarptr][64/goarch.PtrSize + 1]Xptrscalar(nil), - join(hdr, rep(bucketCount*64/goarch.PtrSize, lit(0, 1)), rep(bucketCount, lit(1)), lit(1))) - verifyMapBucket(t, - ArrayOf(64/goarch.PtrSize+1, Tscalarptr), ArrayOf(64/goarch.PtrSize+1, Tptrscalar), - map[[64/goarch.PtrSize + 1]Xscalarptr][64/goarch.PtrSize + 1]Xptrscalar(nil), - join(hdr, rep(bucketCount, lit(1)), rep(bucketCount, lit(1)), lit(1))) -} diff --git a/src/reflect/map_swiss_test.go b/src/reflect/map_test.go index 621140aa60..621b5fdd73 100644 --- a/src/reflect/map_swiss_test.go +++ b/src/reflect/map_test.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.swissmap - package reflect_test import ( @@ -11,11 +9,6 @@ import ( "testing" ) -func testGCBitsMap(t *testing.T) { - // Unlike old maps, we don't manually construct GC data for swiss maps, - // instead using the public reflect API in groupAndSlotOf. -} - // See also runtime_test.TestGroupSizeZero. func TestGroupSizeZero(t *testing.T) { st := reflect.TypeFor[struct{}]() diff --git a/src/reflect/type.go b/src/reflect/type.go index 0004cab985..cec8662c01 100644 --- a/src/reflect/type.go +++ b/src/reflect/type.go @@ -1813,7 +1813,7 @@ func ChanOf(dir ChanDir, t Type) Type { var ichan any = (chan unsafe.Pointer)(nil) prototype := *(**chanType)(unsafe.Pointer(&ichan)) ch := *prototype - ch.TFlag = abi.TFlagRegularMemory + ch.TFlag = abi.TFlagRegularMemory | abi.TFlagDirectIface ch.Dir = abi.ChanDir(dir) ch.Str = resolveReflectName(newName(s, "", false, false)) ch.Hash = fnv1(typ.Hash, 'c', byte(dir)) @@ -1894,7 +1894,7 @@ func FuncOf(in, out []Type, variadic bool) Type { hash = fnv1(hash, byte(t.t.Hash>>24), byte(t.t.Hash>>16), byte(t.t.Hash>>8), byte(t.t.Hash)) } - ft.TFlag = 0 + ft.TFlag = abi.TFlagDirectIface ft.Hash = hash ft.InCount = uint16(len(in)) ft.OutCount = uint16(len(out)) @@ -2313,7 +2313,7 @@ func StructOf(fields []StructField) Type { // Issue 15924. panic("reflect: embedded type with methods not implemented if type is not first field") } - if len(fields) > 1 && ft.Kind_&abi.KindDirectIface != 0 { + if len(fields) > 1 && ft.IsDirectIface() { panic("reflect: embedded type with methods not implemented for non-pointer type") } for _, m := range unt.Methods() { @@ -2524,11 +2524,11 @@ func StructOf(fields []StructField) Type { } switch { - case len(fs) == 1 && !fs[0].Typ.IfaceIndir(): + case len(fs) == 1 && fs[0].Typ.IsDirectIface(): // structs of 1 direct iface type can be direct - typ.Kind_ |= abi.KindDirectIface + typ.TFlag |= abi.TFlagDirectIface default: - typ.Kind_ &^= abi.KindDirectIface + typ.TFlag &^= abi.TFlagDirectIface } return addToCache(toType(&typ.Type)) @@ -2694,11 +2694,11 @@ func ArrayOf(length int, elem Type) Type { } switch { - case length == 1 && !typ.IfaceIndir(): + case length == 1 && typ.IsDirectIface(): // array of 1 direct iface type can be direct - array.Kind_ |= abi.KindDirectIface + array.TFlag |= abi.TFlagDirectIface default: - array.Kind_ &^= abi.KindDirectIface + array.TFlag &^= abi.TFlagDirectIface } ti, _ := lookupCache.LoadOrStore(ckey, toRType(&array.Type)) @@ -2834,7 +2834,7 @@ func addTypeBits(bv *bitVector, offset uintptr, t *abi.Type) { return } - switch Kind(t.Kind_ & abi.KindMask) { + switch Kind(t.Kind()) { case Chan, Func, Map, Pointer, Slice, String, UnsafePointer: // 1 pointer at start of representation for bv.n < uint32(offset/goarch.PtrSize) { diff --git a/src/reflect/value.go b/src/reflect/value.go index ffdf789648..6f65ef81dc 100644 --- a/src/reflect/value.go +++ b/src/reflect/value.go @@ -55,7 +55,7 @@ type Value struct { // - flagIndir: val holds a pointer to the data // - flagAddr: v.CanAddr is true (implies flagIndir and ptr is non-nil) // - flagMethod: v is a method value. - // If ifaceIndir(typ), code can assume that flagIndir is set. + // If !typ.IsDirectIface(), code can assume that flagIndir is set. // // The remaining 22+ bits give a method number for method values. // If flag.kind() != Func, code can assume that flagMethod is unset. @@ -125,7 +125,7 @@ func packEface(v Value) any { e := abi.EmptyInterface{} // First, fill in the data portion of the interface. switch { - case t.IfaceIndir(): + case !t.IsDirectIface(): if v.flag&flagIndir == 0 { panic("bad indir") } @@ -159,7 +159,7 @@ func unpackEface(i any) Value { return Value{} } f := flag(t.Kind()) - if t.IfaceIndir() { + if !t.IsDirectIface() { f |= flagIndir } return Value{t, e.Data, f} @@ -624,7 +624,7 @@ func (v Value) call(op string, in []Value) []Value { } // Handle pointers passed in registers. - if !tv.IfaceIndir() { + if tv.IsDirectIface() { // Pointer-valued data gets put directly // into v.ptr. if steps[0].kind != abiStepPointer { @@ -714,7 +714,7 @@ func callReflect(ctxt *makeFuncImpl, frame unsafe.Pointer, retValid *bool, regs v := Value{typ, nil, flag(typ.Kind())} steps := abid.call.stepsForValue(i) if st := steps[0]; st.kind == abiStepStack { - if typ.IfaceIndir() { + if !typ.IsDirectIface() { // value cannot be inlined in interface data. // Must make a copy, because f might keep a reference to it, // and we cannot let f keep a reference to the stack frame @@ -728,7 +728,7 @@ func callReflect(ctxt *makeFuncImpl, frame unsafe.Pointer, retValid *bool, regs v.ptr = *(*unsafe.Pointer)(add(ptr, st.stkOff, "1-ptr")) } } else { - if typ.IfaceIndir() { + if !typ.IsDirectIface() { // All that's left is values passed in registers that we need to // create space for the values. v.flag |= flagIndir @@ -914,7 +914,7 @@ func storeRcvr(v Value, p unsafe.Pointer) { // the interface data word becomes the receiver word iface := (*nonEmptyInterface)(v.ptr) *(*unsafe.Pointer)(p) = iface.word - } else if v.flag&flagIndir != 0 && !t.IfaceIndir() { + } else if v.flag&flagIndir != 0 && t.IsDirectIface() { *(*unsafe.Pointer)(p) = *(*unsafe.Pointer)(v.ptr) } else { *(*unsafe.Pointer)(p) = v.ptr @@ -1224,7 +1224,7 @@ func (v Value) Elem() Value { case Pointer: ptr := v.ptr if v.flag&flagIndir != 0 { - if v.typ().IfaceIndir() { + if !v.typ().IsDirectIface() { // This is a pointer to a not-in-heap object. ptr points to a uintptr // in the heap. That uintptr is the address of a not-in-heap object. // In general, pointers to not-in-heap objects can be total junk. @@ -1852,7 +1852,7 @@ func (v Value) lenNonSlice() int { // copyVal returns a Value containing the map key or value at ptr, // allocating a new variable as needed. func copyVal(typ *abi.Type, fl flag, ptr unsafe.Pointer) Value { - if typ.IfaceIndir() { + if !typ.IsDirectIface() { // Copy result so future changes to the map // won't change the underlying value. c := unsafe_New(typ) @@ -2076,7 +2076,7 @@ func (v Value) recv(nb bool) (val Value, ok bool) { t := tt.Elem val = Value{t, nil, flag(t.Kind())} var p unsafe.Pointer - if t.IfaceIndir() { + if !t.IsDirectIface() { p = unsafe_New(t) val.ptr = p val.flag |= flagIndir @@ -2952,7 +2952,7 @@ func Select(cases []SelectCase) (chosen int, recv Value, recvOK bool) { t := tt.Elem p := runcases[chosen].val fl := flag(t.Kind()) - if t.IfaceIndir() { + if !t.IsDirectIface() { recv = Value{t, p, fl | flagIndir} } else { recv = Value{t, *(*unsafe.Pointer)(p), fl} @@ -3065,7 +3065,7 @@ func Zero(typ Type) Value { } t := &typ.(*rtype).t fl := flag(t.Kind()) - if t.IfaceIndir() { + if !t.IsDirectIface() { var p unsafe.Pointer if t.Size() <= abi.ZeroValSize { p = unsafe.Pointer(&zeroVal[0]) @@ -3088,7 +3088,7 @@ func New(typ Type) Value { } t := &typ.(*rtype).t pt := ptrTo(t) - if pt.IfaceIndir() { + if !pt.IsDirectIface() { // This is a pointer to a not-in-heap type. panic("reflect: New of type that may not be allocated in heap (possibly undefined cgo C type)") } diff --git a/src/regexp/find_test.go b/src/regexp/find_test.go index 2edbe9b86e..49e9619cef 100644 --- a/src/regexp/find_test.go +++ b/src/regexp/find_test.go @@ -98,6 +98,8 @@ var findTests = []FindTest{ {`\B`, "x y", nil}, {`\B`, "xx yy", build(2, 1, 1, 4, 4)}, {`(|a)*`, "aa", build(3, 0, 0, 0, 0, 1, 1, 1, 1, 2, 2, 2, 2)}, + {`0A|0[aA]`, "0a", build(1, 0, 2)}, + {`0[aA]|0A`, "0a", build(1, 0, 2)}, // RE2 tests {`[^\S\s]`, "abcd", nil}, diff --git a/src/regexp/syntax/regexp.go b/src/regexp/syntax/regexp.go index f15d205123..499492884e 100644 --- a/src/regexp/syntax/regexp.go +++ b/src/regexp/syntax/regexp.go @@ -76,7 +76,7 @@ func (x *Regexp) Equal(y *Regexp) bool { } case OpLiteral, OpCharClass: - return slices.Equal(x.Rune, y.Rune) + return x.Flags&FoldCase == y.Flags&FoldCase && slices.Equal(x.Rune, y.Rune) case OpAlternate, OpConcat: return slices.EqualFunc(x.Sub, y.Sub, (*Regexp).Equal) diff --git a/src/runtime/alg.go b/src/runtime/alg.go index df32bc7941..b956f9d05a 100644 --- a/src/runtime/alg.go +++ b/src/runtime/alg.go @@ -144,7 +144,7 @@ func interhash(p unsafe.Pointer, h uintptr) uintptr { // we want to report the struct, not the slice). panic(errorString("hash of unhashable type " + toRType(t).string())) } - if isDirectIface(t) { + if t.IsDirectIface() { return c1 * typehash(t, unsafe.Pointer(&a.data), h^c0) } else { return c1 * typehash(t, a.data, h^c0) @@ -171,7 +171,7 @@ func nilinterhash(p unsafe.Pointer, h uintptr) uintptr { // See comment in interhash above. panic(errorString("hash of unhashable type " + toRType(t).string())) } - if isDirectIface(t) { + if t.IsDirectIface() { return c1 * typehash(t, unsafe.Pointer(&a.data), h^c0) } else { return c1 * typehash(t, a.data, h^c0) @@ -211,7 +211,7 @@ func typehash(t *_type, p unsafe.Pointer, h uintptr) uintptr { return memhash(p, h, t.Size_) } } - switch t.Kind_ & abi.KindMask { + switch t.Kind() { case abi.Float32: return f32hash(p, h) case abi.Float64: @@ -306,7 +306,7 @@ func efaceeq(t *_type, x, y unsafe.Pointer) bool { if eq == nil { panic(errorString("comparing uncomparable type " + toRType(t).string())) } - if isDirectIface(t) { + if t.IsDirectIface() { // Direct interface types are ptr, chan, map, func, and single-element structs/arrays thereof. // Maps and funcs are not comparable, so they can't reach here. // Ptrs, chans, and single-element items can be compared directly using ==. @@ -323,7 +323,7 @@ func ifaceeq(tab *itab, x, y unsafe.Pointer) bool { if eq == nil { panic(errorString("comparing uncomparable type " + toRType(t).string())) } - if isDirectIface(t) { + if t.IsDirectIface() { // See comment in efaceeq. return x == y } diff --git a/src/runtime/arena.go b/src/runtime/arena.go index e807995810..52a2a99d6c 100644 --- a/src/runtime/arena.go +++ b/src/runtime/arena.go @@ -111,7 +111,7 @@ func arena_newArena() unsafe.Pointer { //go:linkname arena_arena_New arena.runtime_arena_arena_New func arena_arena_New(arena unsafe.Pointer, typ any) any { t := (*_type)(efaceOf(&typ).data) - if t.Kind_&abi.KindMask != abi.Pointer { + if t.Kind() != abi.Pointer { throw("arena_New: non-pointer type") } te := (*ptrtype)(unsafe.Pointer(t)).Elem @@ -145,7 +145,7 @@ func arena_heapify(s any) any { var v unsafe.Pointer e := efaceOf(&s) t := e._type - switch t.Kind_ & abi.KindMask { + switch t.Kind() { case abi.String: v = stringStructOf((*string)(e.data)).str case abi.Slice: @@ -162,7 +162,7 @@ func arena_heapify(s any) any { } // Heap-allocate storage for a copy. var x any - switch t.Kind_ & abi.KindMask { + switch t.Kind() { case abi.String: s1 := s.(string) s2, b := rawstring(len(s1)) @@ -293,11 +293,11 @@ func (a *userArena) slice(sl any, cap int) { } i := efaceOf(&sl) typ := i._type - if typ.Kind_&abi.KindMask != abi.Pointer { + if typ.Kind() != abi.Pointer { panic("slice result of non-ptr type") } typ = (*ptrtype)(unsafe.Pointer(typ)).Elem - if typ.Kind_&abi.KindMask != abi.Slice { + if typ.Kind() != abi.Slice { panic("slice of non-ptr-to-slice type") } typ = (*slicetype)(unsafe.Pointer(typ)).Elem @@ -745,7 +745,9 @@ func newUserArenaChunk() (unsafe.Pointer, *mspan) { // does represent additional work for the GC, but we also have no idea // what that looks like until we actually allocate things into the // arena). - deductAssistCredit(userArenaChunkBytes) + if gcBlackenEnabled != 0 { + deductAssistCredit(userArenaChunkBytes) + } // Set mp.mallocing to keep from being preempted by GC. mp := acquirem() diff --git a/src/runtime/asan_riscv64.s b/src/runtime/asan_riscv64.s index eb76e61ffb..5a333361dd 100644 --- a/src/runtime/asan_riscv64.s +++ b/src/runtime/asan_riscv64.s @@ -81,13 +81,13 @@ TEXT asancall<>(SB), NOSPLIT, $0-0 MOV g_m(g), X21 // Switch to g0 stack if we aren't already on g0 or gsignal. - MOV m_gsignal(X21), X21 - BEQ X21, g, call + MOV m_gsignal(X21), X22 + BEQ X22, g, call - MOV m_g0(X21), X21 - BEQ X21, g, call + MOV m_g0(X21), X22 + BEQ X22, g, call - MOV (g_sched+gobuf_sp)(X21), X2 + MOV (g_sched+gobuf_sp)(X22), X2 call: JALR RA, X14 diff --git a/src/runtime/asm_386.s b/src/runtime/asm_386.s index 62ab83985f..df32e90fda 100644 --- a/src/runtime/asm_386.s +++ b/src/runtime/asm_386.s @@ -1509,161 +1509,47 @@ TEXT runtime·gcWriteBarrier8<ABIInternal>(SB),NOSPLIT,$0 MOVL $32, DI JMP gcWriteBarrier<>(SB) -// Note: these functions use a special calling convention to save generated code space. -// Arguments are passed in registers, but the space for those arguments are allocated -// in the caller's stack frame. These stubs write the args into that stack space and -// then tail call to the corresponding runtime handler. -// The tail call makes these stubs disappear in backtraces. -TEXT runtime·panicIndex(SB),NOSPLIT,$0-8 - MOVL AX, x+0(FP) - MOVL CX, y+4(FP) - JMP runtime·goPanicIndex(SB) -TEXT runtime·panicIndexU(SB),NOSPLIT,$0-8 - MOVL AX, x+0(FP) - MOVL CX, y+4(FP) - JMP runtime·goPanicIndexU(SB) -TEXT runtime·panicSliceAlen(SB),NOSPLIT,$0-8 - MOVL CX, x+0(FP) - MOVL DX, y+4(FP) - JMP runtime·goPanicSliceAlen(SB) -TEXT runtime·panicSliceAlenU(SB),NOSPLIT,$0-8 - MOVL CX, x+0(FP) - MOVL DX, y+4(FP) - JMP runtime·goPanicSliceAlenU(SB) -TEXT runtime·panicSliceAcap(SB),NOSPLIT,$0-8 - MOVL CX, x+0(FP) - MOVL DX, y+4(FP) - JMP runtime·goPanicSliceAcap(SB) -TEXT runtime·panicSliceAcapU(SB),NOSPLIT,$0-8 - MOVL CX, x+0(FP) - MOVL DX, y+4(FP) - JMP runtime·goPanicSliceAcapU(SB) -TEXT runtime·panicSliceB(SB),NOSPLIT,$0-8 - MOVL AX, x+0(FP) - MOVL CX, y+4(FP) - JMP runtime·goPanicSliceB(SB) -TEXT runtime·panicSliceBU(SB),NOSPLIT,$0-8 - MOVL AX, x+0(FP) - MOVL CX, y+4(FP) - JMP runtime·goPanicSliceBU(SB) -TEXT runtime·panicSlice3Alen(SB),NOSPLIT,$0-8 - MOVL DX, x+0(FP) - MOVL BX, y+4(FP) - JMP runtime·goPanicSlice3Alen(SB) -TEXT runtime·panicSlice3AlenU(SB),NOSPLIT,$0-8 - MOVL DX, x+0(FP) - MOVL BX, y+4(FP) - JMP runtime·goPanicSlice3AlenU(SB) -TEXT runtime·panicSlice3Acap(SB),NOSPLIT,$0-8 - MOVL DX, x+0(FP) - MOVL BX, y+4(FP) - JMP runtime·goPanicSlice3Acap(SB) -TEXT runtime·panicSlice3AcapU(SB),NOSPLIT,$0-8 - MOVL DX, x+0(FP) - MOVL BX, y+4(FP) - JMP runtime·goPanicSlice3AcapU(SB) -TEXT runtime·panicSlice3B(SB),NOSPLIT,$0-8 - MOVL CX, x+0(FP) - MOVL DX, y+4(FP) - JMP runtime·goPanicSlice3B(SB) -TEXT runtime·panicSlice3BU(SB),NOSPLIT,$0-8 - MOVL CX, x+0(FP) - MOVL DX, y+4(FP) - JMP runtime·goPanicSlice3BU(SB) -TEXT runtime·panicSlice3C(SB),NOSPLIT,$0-8 - MOVL AX, x+0(FP) - MOVL CX, y+4(FP) - JMP runtime·goPanicSlice3C(SB) -TEXT runtime·panicSlice3CU(SB),NOSPLIT,$0-8 - MOVL AX, x+0(FP) - MOVL CX, y+4(FP) - JMP runtime·goPanicSlice3CU(SB) -TEXT runtime·panicSliceConvert(SB),NOSPLIT,$0-8 - MOVL DX, x+0(FP) - MOVL BX, y+4(FP) - JMP runtime·goPanicSliceConvert(SB) +TEXT runtime·panicBounds<ABIInternal>(SB),NOSPLIT,$40-0 + NO_LOCAL_POINTERS + // Save all int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + MOVL AX, 8(SP) + MOVL CX, 12(SP) + MOVL DX, 16(SP) + MOVL BX, 20(SP) + // skip SP @ 24(SP) + MOVL BP, 28(SP) + MOVL SI, 32(SP) + MOVL DI, 36(SP) + + MOVL SP, AX // hide SP read from vet + MOVL 40(AX), AX // PC immediately after call to panicBounds + MOVL AX, 0(SP) + LEAL 8(SP), AX + MOVL AX, 4(SP) + CALL runtime·panicBounds32<ABIInternal>(SB) + RET -// Extended versions for 64-bit indexes. -TEXT runtime·panicExtendIndex(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL AX, lo+4(FP) - MOVL CX, y+8(FP) - JMP runtime·goPanicExtendIndex(SB) -TEXT runtime·panicExtendIndexU(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL AX, lo+4(FP) - MOVL CX, y+8(FP) - JMP runtime·goPanicExtendIndexU(SB) -TEXT runtime·panicExtendSliceAlen(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL CX, lo+4(FP) - MOVL DX, y+8(FP) - JMP runtime·goPanicExtendSliceAlen(SB) -TEXT runtime·panicExtendSliceAlenU(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL CX, lo+4(FP) - MOVL DX, y+8(FP) - JMP runtime·goPanicExtendSliceAlenU(SB) -TEXT runtime·panicExtendSliceAcap(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL CX, lo+4(FP) - MOVL DX, y+8(FP) - JMP runtime·goPanicExtendSliceAcap(SB) -TEXT runtime·panicExtendSliceAcapU(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL CX, lo+4(FP) - MOVL DX, y+8(FP) - JMP runtime·goPanicExtendSliceAcapU(SB) -TEXT runtime·panicExtendSliceB(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL AX, lo+4(FP) - MOVL CX, y+8(FP) - JMP runtime·goPanicExtendSliceB(SB) -TEXT runtime·panicExtendSliceBU(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL AX, lo+4(FP) - MOVL CX, y+8(FP) - JMP runtime·goPanicExtendSliceBU(SB) -TEXT runtime·panicExtendSlice3Alen(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL DX, lo+4(FP) - MOVL BX, y+8(FP) - JMP runtime·goPanicExtendSlice3Alen(SB) -TEXT runtime·panicExtendSlice3AlenU(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL DX, lo+4(FP) - MOVL BX, y+8(FP) - JMP runtime·goPanicExtendSlice3AlenU(SB) -TEXT runtime·panicExtendSlice3Acap(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL DX, lo+4(FP) - MOVL BX, y+8(FP) - JMP runtime·goPanicExtendSlice3Acap(SB) -TEXT runtime·panicExtendSlice3AcapU(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL DX, lo+4(FP) - MOVL BX, y+8(FP) - JMP runtime·goPanicExtendSlice3AcapU(SB) -TEXT runtime·panicExtendSlice3B(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL CX, lo+4(FP) - MOVL DX, y+8(FP) - JMP runtime·goPanicExtendSlice3B(SB) -TEXT runtime·panicExtendSlice3BU(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL CX, lo+4(FP) - MOVL DX, y+8(FP) - JMP runtime·goPanicExtendSlice3BU(SB) -TEXT runtime·panicExtendSlice3C(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL AX, lo+4(FP) - MOVL CX, y+8(FP) - JMP runtime·goPanicExtendSlice3C(SB) -TEXT runtime·panicExtendSlice3CU(SB),NOSPLIT,$0-12 - MOVL SI, hi+0(FP) - MOVL AX, lo+4(FP) - MOVL CX, y+8(FP) - JMP runtime·goPanicExtendSlice3CU(SB) +TEXT runtime·panicExtend<ABIInternal>(SB),NOSPLIT,$40-0 + NO_LOCAL_POINTERS + // Save all int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + MOVL AX, 8(SP) + MOVL CX, 12(SP) + MOVL DX, 16(SP) + MOVL BX, 20(SP) + // skip SP @ 24(SP) + MOVL BP, 28(SP) + MOVL SI, 32(SP) + MOVL DI, 36(SP) + + MOVL SP, AX // hide SP read from vet + MOVL 40(AX), AX // PC immediately after call to panicExtend + MOVL AX, 0(SP) + LEAL 8(SP), AX + MOVL AX, 4(SP) + CALL runtime·panicBounds32X<ABIInternal>(SB) + RET #ifdef GOOS_android // Use the free TLS_SLOT_APP slot #2 on Android Q. diff --git a/src/runtime/asm_amd64.s b/src/runtime/asm_amd64.s index 8983eeafcb..cf1d49a4ad 100644 --- a/src/runtime/asm_amd64.s +++ b/src/runtime/asm_amd64.s @@ -2024,69 +2024,32 @@ TEXT runtime·debugCallPanicked(SB),NOSPLIT,$16-16 BYTE $0xcc RET -// Note: these functions use a special calling convention to save generated code space. -// Arguments are passed in registers, but the space for those arguments are allocated -// in the caller's stack frame. These stubs write the args into that stack space and -// then tail call to the corresponding runtime handler. -// The tail call makes these stubs disappear in backtraces. -// Defined as ABIInternal since they do not use the stack-based Go ABI. -TEXT runtime·panicIndex<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, BX - JMP runtime·goPanicIndex<ABIInternal>(SB) -TEXT runtime·panicIndexU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, BX - JMP runtime·goPanicIndexU<ABIInternal>(SB) -TEXT runtime·panicSliceAlen<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, AX - MOVQ DX, BX - JMP runtime·goPanicSliceAlen<ABIInternal>(SB) -TEXT runtime·panicSliceAlenU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, AX - MOVQ DX, BX - JMP runtime·goPanicSliceAlenU<ABIInternal>(SB) -TEXT runtime·panicSliceAcap<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, AX - MOVQ DX, BX - JMP runtime·goPanicSliceAcap<ABIInternal>(SB) -TEXT runtime·panicSliceAcapU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, AX - MOVQ DX, BX - JMP runtime·goPanicSliceAcapU<ABIInternal>(SB) -TEXT runtime·panicSliceB<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, BX - JMP runtime·goPanicSliceB<ABIInternal>(SB) -TEXT runtime·panicSliceBU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, BX - JMP runtime·goPanicSliceBU<ABIInternal>(SB) -TEXT runtime·panicSlice3Alen<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ DX, AX - JMP runtime·goPanicSlice3Alen<ABIInternal>(SB) -TEXT runtime·panicSlice3AlenU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ DX, AX - JMP runtime·goPanicSlice3AlenU<ABIInternal>(SB) -TEXT runtime·panicSlice3Acap<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ DX, AX - JMP runtime·goPanicSlice3Acap<ABIInternal>(SB) -TEXT runtime·panicSlice3AcapU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ DX, AX - JMP runtime·goPanicSlice3AcapU<ABIInternal>(SB) -TEXT runtime·panicSlice3B<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, AX - MOVQ DX, BX - JMP runtime·goPanicSlice3B<ABIInternal>(SB) -TEXT runtime·panicSlice3BU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, AX - MOVQ DX, BX - JMP runtime·goPanicSlice3BU<ABIInternal>(SB) -TEXT runtime·panicSlice3C<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, BX - JMP runtime·goPanicSlice3C<ABIInternal>(SB) -TEXT runtime·panicSlice3CU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ CX, BX - JMP runtime·goPanicSlice3CU<ABIInternal>(SB) -TEXT runtime·panicSliceConvert<ABIInternal>(SB),NOSPLIT,$0-16 - MOVQ DX, AX - JMP runtime·goPanicSliceConvert<ABIInternal>(SB) +TEXT runtime·panicBounds<ABIInternal>(SB),NOSPLIT,$144-0 + NO_LOCAL_POINTERS + // Save all 14 int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + MOVQ AX, 16(SP) + MOVQ CX, 24(SP) + MOVQ DX, 32(SP) + MOVQ BX, 40(SP) + // skip SP @ 48(SP) + MOVQ BP, 56(SP) + MOVQ SI, 64(SP) + MOVQ DI, 72(SP) + MOVQ R8, 80(SP) + MOVQ R9, 88(SP) + MOVQ R10, 96(SP) + MOVQ R11, 104(SP) + MOVQ R12, 112(SP) + MOVQ R13, 120(SP) + // skip R14 @ 128(SP) (aka G) + MOVQ R15, 136(SP) + + MOVQ SP, AX // hide SP read from vet + MOVQ 152(AX), AX // PC immediately after call to panicBounds + LEAQ 16(SP), BX + CALL runtime·panicBounds64<ABIInternal>(SB) + RET #ifdef GOOS_android // Use the free TLS_SLOT_APP slot #2 on Android Q. diff --git a/src/runtime/asm_arm.s b/src/runtime/asm_arm.s index ca9f0ced03..742b97f888 100644 --- a/src/runtime/asm_arm.s +++ b/src/runtime/asm_arm.s @@ -991,158 +991,56 @@ TEXT runtime·gcWriteBarrier8<ABIInternal>(SB),NOSPLIT,$0 MOVW $32, R8 JMP gcWriteBarrier<>(SB) -// Note: these functions use a special calling convention to save generated code space. -// Arguments are passed in registers, but the space for those arguments are allocated -// in the caller's stack frame. These stubs write the args into that stack space and -// then tail call to the corresponding runtime handler. -// The tail call makes these stubs disappear in backtraces. -TEXT runtime·panicIndex(SB),NOSPLIT,$0-8 - MOVW R0, x+0(FP) - MOVW R1, y+4(FP) - JMP runtime·goPanicIndex(SB) -TEXT runtime·panicIndexU(SB),NOSPLIT,$0-8 - MOVW R0, x+0(FP) - MOVW R1, y+4(FP) - JMP runtime·goPanicIndexU(SB) -TEXT runtime·panicSliceAlen(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicSliceAlen(SB) -TEXT runtime·panicSliceAlenU(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicSliceAlenU(SB) -TEXT runtime·panicSliceAcap(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicSliceAcap(SB) -TEXT runtime·panicSliceAcapU(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicSliceAcapU(SB) -TEXT runtime·panicSliceB(SB),NOSPLIT,$0-8 - MOVW R0, x+0(FP) - MOVW R1, y+4(FP) - JMP runtime·goPanicSliceB(SB) -TEXT runtime·panicSliceBU(SB),NOSPLIT,$0-8 - MOVW R0, x+0(FP) - MOVW R1, y+4(FP) - JMP runtime·goPanicSliceBU(SB) -TEXT runtime·panicSlice3Alen(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSlice3Alen(SB) -TEXT runtime·panicSlice3AlenU(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSlice3AlenU(SB) -TEXT runtime·panicSlice3Acap(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSlice3Acap(SB) -TEXT runtime·panicSlice3AcapU(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSlice3AcapU(SB) -TEXT runtime·panicSlice3B(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicSlice3B(SB) -TEXT runtime·panicSlice3BU(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicSlice3BU(SB) -TEXT runtime·panicSlice3C(SB),NOSPLIT,$0-8 - MOVW R0, x+0(FP) - MOVW R1, y+4(FP) - JMP runtime·goPanicSlice3C(SB) -TEXT runtime·panicSlice3CU(SB),NOSPLIT,$0-8 - MOVW R0, x+0(FP) - MOVW R1, y+4(FP) - JMP runtime·goPanicSlice3CU(SB) -TEXT runtime·panicSliceConvert(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSliceConvert(SB) +TEXT runtime·panicBounds<ABIInternal>(SB),NOSPLIT,$72-0 + NO_LOCAL_POINTERS + // Save all int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + MOVW R0, 12(R13) + MOVW R1, 16(R13) + MOVW R2, 20(R13) + MOVW R3, 24(R13) + MOVW R4, 28(R13) + MOVW R5, 32(R13) + MOVW R6, 36(R13) + MOVW R7, 40(R13) + MOVW R8, 44(R13) + MOVW R9, 48(R13) + // skip R10 aka G @ 52(R13) + // skip R11 aka tmp @ 56(R13) + MOVW R12, 60(R13) + // skip R13 aka SP @ 64(R13) + MOVW R14, 68(R13) + // skip R15 aka PC @ 72(R13) + + MOVW R14, 4(R13) // PC immediately after call to panicBounds + ADD $12, R13, R0 // pointer to save area + MOVW R0, 8(R13) + CALL runtime·panicBounds32<ABIInternal>(SB) + RET -// Extended versions for 64-bit indexes. -TEXT runtime·panicExtendIndex(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R0, lo+4(FP) - MOVW R1, y+8(FP) - JMP runtime·goPanicExtendIndex(SB) -TEXT runtime·panicExtendIndexU(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R0, lo+4(FP) - MOVW R1, y+8(FP) - JMP runtime·goPanicExtendIndexU(SB) -TEXT runtime·panicExtendSliceAlen(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendSliceAlen(SB) -TEXT runtime·panicExtendSliceAlenU(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendSliceAlenU(SB) -TEXT runtime·panicExtendSliceAcap(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendSliceAcap(SB) -TEXT runtime·panicExtendSliceAcapU(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendSliceAcapU(SB) -TEXT runtime·panicExtendSliceB(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R0, lo+4(FP) - MOVW R1, y+8(FP) - JMP runtime·goPanicExtendSliceB(SB) -TEXT runtime·panicExtendSliceBU(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R0, lo+4(FP) - MOVW R1, y+8(FP) - JMP runtime·goPanicExtendSliceBU(SB) -TEXT runtime·panicExtendSlice3Alen(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R2, lo+4(FP) - MOVW R3, y+8(FP) - JMP runtime·goPanicExtendSlice3Alen(SB) -TEXT runtime·panicExtendSlice3AlenU(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R2, lo+4(FP) - MOVW R3, y+8(FP) - JMP runtime·goPanicExtendSlice3AlenU(SB) -TEXT runtime·panicExtendSlice3Acap(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R2, lo+4(FP) - MOVW R3, y+8(FP) - JMP runtime·goPanicExtendSlice3Acap(SB) -TEXT runtime·panicExtendSlice3AcapU(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R2, lo+4(FP) - MOVW R3, y+8(FP) - JMP runtime·goPanicExtendSlice3AcapU(SB) -TEXT runtime·panicExtendSlice3B(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendSlice3B(SB) -TEXT runtime·panicExtendSlice3BU(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendSlice3BU(SB) -TEXT runtime·panicExtendSlice3C(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R0, lo+4(FP) - MOVW R1, y+8(FP) - JMP runtime·goPanicExtendSlice3C(SB) -TEXT runtime·panicExtendSlice3CU(SB),NOSPLIT,$0-12 - MOVW R4, hi+0(FP) - MOVW R0, lo+4(FP) - MOVW R1, y+8(FP) - JMP runtime·goPanicExtendSlice3CU(SB) +TEXT runtime·panicExtend<ABIInternal>(SB),NOSPLIT,$72-0 + NO_LOCAL_POINTERS + // Save all int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + MOVW R0, 12(R13) + MOVW R1, 16(R13) + MOVW R2, 20(R13) + MOVW R3, 24(R13) + MOVW R4, 28(R13) + MOVW R5, 32(R13) + MOVW R6, 36(R13) + MOVW R7, 40(R13) + MOVW R8, 44(R13) + MOVW R9, 48(R13) + // skip R10 aka G @ 52(R13) + // skip R11 aka tmp @ 56(R13) + MOVW R12, 60(R13) + // skip R13 aka SP @ 64(R13) + // skip R14 aka LR @ 68(R13) + // skip R15 aka PC @ 72(R13) + + MOVW R14, 4(R13) // PC immediately after call to panicExtend + ADD $12, R13, R0 // pointer to save area + MOVW R0, 8(R13) + CALL runtime·panicBounds32X<ABIInternal>(SB) + RET diff --git a/src/runtime/asm_arm64.s b/src/runtime/asm_arm64.s index d2261c5160..a0072a3931 100644 --- a/src/runtime/asm_arm64.s +++ b/src/runtime/asm_arm64.s @@ -1574,70 +1574,22 @@ TEXT runtime·debugCallPanicked(SB),NOSPLIT,$16-16 BREAK RET -// Note: these functions use a special calling convention to save generated code space. -// Arguments are passed in registers, but the space for those arguments are allocated -// in the caller's stack frame. These stubs write the args into that stack space and -// then tail call to the corresponding runtime handler. -// The tail call makes these stubs disappear in backtraces. -// -// Defined as ABIInternal since the compiler generates ABIInternal -// calls to it directly and it does not use the stack-based Go ABI. -TEXT runtime·panicIndex<ABIInternal>(SB),NOSPLIT,$0-16 - JMP runtime·goPanicIndex<ABIInternal>(SB) -TEXT runtime·panicIndexU<ABIInternal>(SB),NOSPLIT,$0-16 - JMP runtime·goPanicIndexU<ABIInternal>(SB) -TEXT runtime·panicSliceAlen<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R1, R0 - MOVD R2, R1 - JMP runtime·goPanicSliceAlen<ABIInternal>(SB) -TEXT runtime·panicSliceAlenU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R1, R0 - MOVD R2, R1 - JMP runtime·goPanicSliceAlenU<ABIInternal>(SB) -TEXT runtime·panicSliceAcap<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R1, R0 - MOVD R2, R1 - JMP runtime·goPanicSliceAcap<ABIInternal>(SB) -TEXT runtime·panicSliceAcapU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R1, R0 - MOVD R2, R1 - JMP runtime·goPanicSliceAcapU<ABIInternal>(SB) -TEXT runtime·panicSliceB<ABIInternal>(SB),NOSPLIT,$0-16 - JMP runtime·goPanicSliceB<ABIInternal>(SB) -TEXT runtime·panicSliceBU<ABIInternal>(SB),NOSPLIT,$0-16 - JMP runtime·goPanicSliceBU<ABIInternal>(SB) -TEXT runtime·panicSlice3Alen<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R2, R0 - MOVD R3, R1 - JMP runtime·goPanicSlice3Alen<ABIInternal>(SB) -TEXT runtime·panicSlice3AlenU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R2, R0 - MOVD R3, R1 - JMP runtime·goPanicSlice3AlenU<ABIInternal>(SB) -TEXT runtime·panicSlice3Acap<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R2, R0 - MOVD R3, R1 - JMP runtime·goPanicSlice3Acap<ABIInternal>(SB) -TEXT runtime·panicSlice3AcapU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R2, R0 - MOVD R3, R1 - JMP runtime·goPanicSlice3AcapU<ABIInternal>(SB) -TEXT runtime·panicSlice3B<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R1, R0 - MOVD R2, R1 - JMP runtime·goPanicSlice3B<ABIInternal>(SB) -TEXT runtime·panicSlice3BU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R1, R0 - MOVD R2, R1 - JMP runtime·goPanicSlice3BU<ABIInternal>(SB) -TEXT runtime·panicSlice3C<ABIInternal>(SB),NOSPLIT,$0-16 - JMP runtime·goPanicSlice3C<ABIInternal>(SB) -TEXT runtime·panicSlice3CU<ABIInternal>(SB),NOSPLIT,$0-16 - JMP runtime·goPanicSlice3CU<ABIInternal>(SB) -TEXT runtime·panicSliceConvert<ABIInternal>(SB),NOSPLIT,$0-16 - MOVD R2, R0 - MOVD R3, R1 - JMP runtime·goPanicSliceConvert<ABIInternal>(SB) +TEXT runtime·panicBounds<ABIInternal>(SB),NOSPLIT,$144-0 + NO_LOCAL_POINTERS + // Save all 16 int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + STP (R0, R1), 24(RSP) + STP (R2, R3), 40(RSP) + STP (R4, R5), 56(RSP) + STP (R6, R7), 72(RSP) + STP (R8, R9), 88(RSP) + STP (R10, R11), 104(RSP) + STP (R12, R13), 120(RSP) + STP (R14, R15), 136(RSP) + MOVD LR, R0 // PC immediately after call to panicBounds + ADD $24, RSP, R1 // pointer to save area + CALL runtime·panicBounds64<ABIInternal>(SB) + RET TEXT ·getfp<ABIInternal>(SB),NOSPLIT|NOFRAME,$0 MOVD R29, R0 diff --git a/src/runtime/asm_loong64.s b/src/runtime/asm_loong64.s index e3b593961a..ee7f825e1f 100644 --- a/src/runtime/asm_loong64.s +++ b/src/runtime/asm_loong64.s @@ -70,8 +70,9 @@ nocgo: // start this M JAL runtime·mstart(SB) - // Prevent dead-code elimination of debugCallV2, which is + // Prevent dead-code elimination of debugCallV2 and debugPinnerV1, which are // intended to be called by debuggers. + MOVV $runtime·debugPinnerV1<ABIInternal>(SB), R0 MOVV $runtime·debugCallV2<ABIInternal>(SB), R0 MOVV R0, 1(R0) @@ -1135,76 +1136,29 @@ TEXT runtime·debugCallPanicked(SB),NOSPLIT,$16-16 BREAK RET -// Note: these functions use a special calling convention to save generated code space. -// Arguments are passed in registers, but the space for those arguments are allocated -// in the caller's stack frame. These stubs write the args into that stack space and -// then tail call to the corresponding runtime handler. -// The tail call makes these stubs disappear in backtraces. -TEXT runtime·panicIndex<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R20, R4 - MOVV R21, R5 - JMP runtime·goPanicIndex<ABIInternal>(SB) -TEXT runtime·panicIndexU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R20, R4 - MOVV R21, R5 - JMP runtime·goPanicIndexU<ABIInternal>(SB) -TEXT runtime·panicSliceAlen<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R21, R4 - MOVV R23, R5 - JMP runtime·goPanicSliceAlen<ABIInternal>(SB) -TEXT runtime·panicSliceAlenU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R21, R4 - MOVV R23, R5 - JMP runtime·goPanicSliceAlenU<ABIInternal>(SB) -TEXT runtime·panicSliceAcap<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R21, R4 - MOVV R23, R5 - JMP runtime·goPanicSliceAcap<ABIInternal>(SB) -TEXT runtime·panicSliceAcapU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R21, R4 - MOVV R23, R5 - JMP runtime·goPanicSliceAcapU<ABIInternal>(SB) -TEXT runtime·panicSliceB<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R20, R4 - MOVV R21, R5 - JMP runtime·goPanicSliceB<ABIInternal>(SB) -TEXT runtime·panicSliceBU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R20, R4 - MOVV R21, R5 - JMP runtime·goPanicSliceBU<ABIInternal>(SB) -TEXT runtime·panicSlice3Alen<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R23, R4 - MOVV R24, R5 - JMP runtime·goPanicSlice3Alen<ABIInternal>(SB) -TEXT runtime·panicSlice3AlenU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R23, R4 - MOVV R24, R5 - JMP runtime·goPanicSlice3AlenU<ABIInternal>(SB) -TEXT runtime·panicSlice3Acap<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R23, R4 - MOVV R24, R5 - JMP runtime·goPanicSlice3Acap<ABIInternal>(SB) -TEXT runtime·panicSlice3AcapU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R23, R4 - MOVV R24, R5 - JMP runtime·goPanicSlice3AcapU<ABIInternal>(SB) -TEXT runtime·panicSlice3B<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R21, R4 - MOVV R23, R5 - JMP runtime·goPanicSlice3B<ABIInternal>(SB) -TEXT runtime·panicSlice3BU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R21, R4 - MOVV R23, R5 - JMP runtime·goPanicSlice3BU<ABIInternal>(SB) -TEXT runtime·panicSlice3C<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R20, R4 - MOVV R21, R5 - JMP runtime·goPanicSlice3C<ABIInternal>(SB) -TEXT runtime·panicSlice3CU<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R20, R4 - MOVV R21, R5 - JMP runtime·goPanicSlice3CU<ABIInternal>(SB) -TEXT runtime·panicSliceConvert<ABIInternal>(SB),NOSPLIT,$0-16 - MOVV R23, R4 - MOVV R24, R5 - JMP runtime·goPanicSliceConvert<ABIInternal>(SB) +TEXT runtime·panicBounds<ABIInternal>(SB),NOSPLIT,$144-0 + NO_LOCAL_POINTERS + // Save all 16 int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + // Skip R0 aka ZERO, R1 aka LR, R2 aka thread pointer, R3 aka SP. + MOVV R4, 24(R3) + MOVV R5, 32(R3) + MOVV R6, 40(R3) + MOVV R7, 48(R3) + MOVV R8, 56(R3) + MOVV R9, 64(R3) + MOVV R10, 72(R3) + MOVV R11, 80(R3) + MOVV R12, 88(R3) + MOVV R13, 96(R3) + MOVV R14, 104(R3) + MOVV R15, 112(R3) + MOVV R16, 120(R3) + MOVV R17, 128(R3) + MOVV R18, 136(R3) + MOVV R19, 144(R3) + + MOVV R1, R4 // PC immediately after call to panicBounds + ADDV $24, R3, R5 // pointer to save area + CALL runtime·panicBounds64<ABIInternal>(SB) + RET diff --git a/src/runtime/asm_mips64x.s b/src/runtime/asm_mips64x.s index 9509d5ba77..d4523b4a74 100644 --- a/src/runtime/asm_mips64x.s +++ b/src/runtime/asm_mips64x.s @@ -791,76 +791,30 @@ TEXT runtime·gcWriteBarrier8<ABIInternal>(SB),NOSPLIT,$0 MOVV $64, R25 JMP gcWriteBarrier<>(SB) -// Note: these functions use a special calling convention to save generated code space. -// Arguments are passed in registers, but the space for those arguments are allocated -// in the caller's stack frame. These stubs write the args into that stack space and -// then tail call to the corresponding runtime handler. -// The tail call makes these stubs disappear in backtraces. -TEXT runtime·panicIndex(SB),NOSPLIT,$0-16 - MOVV R1, x+0(FP) - MOVV R2, y+8(FP) - JMP runtime·goPanicIndex(SB) -TEXT runtime·panicIndexU(SB),NOSPLIT,$0-16 - MOVV R1, x+0(FP) - MOVV R2, y+8(FP) - JMP runtime·goPanicIndexU(SB) -TEXT runtime·panicSliceAlen(SB),NOSPLIT,$0-16 - MOVV R2, x+0(FP) - MOVV R3, y+8(FP) - JMP runtime·goPanicSliceAlen(SB) -TEXT runtime·panicSliceAlenU(SB),NOSPLIT,$0-16 - MOVV R2, x+0(FP) - MOVV R3, y+8(FP) - JMP runtime·goPanicSliceAlenU(SB) -TEXT runtime·panicSliceAcap(SB),NOSPLIT,$0-16 - MOVV R2, x+0(FP) - MOVV R3, y+8(FP) - JMP runtime·goPanicSliceAcap(SB) -TEXT runtime·panicSliceAcapU(SB),NOSPLIT,$0-16 - MOVV R2, x+0(FP) - MOVV R3, y+8(FP) - JMP runtime·goPanicSliceAcapU(SB) -TEXT runtime·panicSliceB(SB),NOSPLIT,$0-16 - MOVV R1, x+0(FP) - MOVV R2, y+8(FP) - JMP runtime·goPanicSliceB(SB) -TEXT runtime·panicSliceBU(SB),NOSPLIT,$0-16 - MOVV R1, x+0(FP) - MOVV R2, y+8(FP) - JMP runtime·goPanicSliceBU(SB) -TEXT runtime·panicSlice3Alen(SB),NOSPLIT,$0-16 - MOVV R3, x+0(FP) - MOVV R4, y+8(FP) - JMP runtime·goPanicSlice3Alen(SB) -TEXT runtime·panicSlice3AlenU(SB),NOSPLIT,$0-16 - MOVV R3, x+0(FP) - MOVV R4, y+8(FP) - JMP runtime·goPanicSlice3AlenU(SB) -TEXT runtime·panicSlice3Acap(SB),NOSPLIT,$0-16 - MOVV R3, x+0(FP) - MOVV R4, y+8(FP) - JMP runtime·goPanicSlice3Acap(SB) -TEXT runtime·panicSlice3AcapU(SB),NOSPLIT,$0-16 - MOVV R3, x+0(FP) - MOVV R4, y+8(FP) - JMP runtime·goPanicSlice3AcapU(SB) -TEXT runtime·panicSlice3B(SB),NOSPLIT,$0-16 - MOVV R2, x+0(FP) - MOVV R3, y+8(FP) - JMP runtime·goPanicSlice3B(SB) -TEXT runtime·panicSlice3BU(SB),NOSPLIT,$0-16 - MOVV R2, x+0(FP) - MOVV R3, y+8(FP) - JMP runtime·goPanicSlice3BU(SB) -TEXT runtime·panicSlice3C(SB),NOSPLIT,$0-16 - MOVV R1, x+0(FP) - MOVV R2, y+8(FP) - JMP runtime·goPanicSlice3C(SB) -TEXT runtime·panicSlice3CU(SB),NOSPLIT,$0-16 - MOVV R1, x+0(FP) - MOVV R2, y+8(FP) - JMP runtime·goPanicSlice3CU(SB) -TEXT runtime·panicSliceConvert(SB),NOSPLIT,$0-16 - MOVV R3, x+0(FP) - MOVV R4, y+8(FP) - JMP runtime·goPanicSliceConvert(SB) +TEXT runtime·panicBounds<ABIInternal>(SB),NOSPLIT,$144-0 + NO_LOCAL_POINTERS + // Save all 16 int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + // Skip R0 aka ZERO. + MOVV R1, 24(R29) + MOVV R2, 32(R29) + MOVV R3, 40(R29) + MOVV R4, 48(R29) + MOVV R5, 56(R29) + MOVV R6, 64(R29) + MOVV R7, 72(R29) + MOVV R8, 80(R29) + MOVV R9, 88(R29) + MOVV R10, 96(R29) + MOVV R11, 104(R29) + MOVV R12, 112(R29) + MOVV R13, 120(R29) + MOVV R14, 128(R29) + MOVV R15, 136(R29) + MOVV R16, 144(R29) + + MOVV R31, 8(R29) // PC immediately after call to panicBounds + ADDV $24, R29, R1 // pointer to save area + MOVV R1, 16(R29) + CALL runtime·panicBounds64<ABIInternal>(SB) + RET diff --git a/src/runtime/asm_mipsx.s b/src/runtime/asm_mipsx.s index 7245e8ac49..ec352f5828 100644 --- a/src/runtime/asm_mipsx.s +++ b/src/runtime/asm_mipsx.s @@ -787,158 +787,58 @@ TEXT runtime·gcWriteBarrier8<ABIInternal>(SB),NOSPLIT,$0 MOVW $32, R25 JMP gcWriteBarrier<>(SB) -// Note: these functions use a special calling convention to save generated code space. -// Arguments are passed in registers, but the space for those arguments are allocated -// in the caller's stack frame. These stubs write the args into that stack space and -// then tail call to the corresponding runtime handler. -// The tail call makes these stubs disappear in backtraces. -TEXT runtime·panicIndex(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicIndex(SB) -TEXT runtime·panicIndexU(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicIndexU(SB) -TEXT runtime·panicSliceAlen(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSliceAlen(SB) -TEXT runtime·panicSliceAlenU(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSliceAlenU(SB) -TEXT runtime·panicSliceAcap(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSliceAcap(SB) -TEXT runtime·panicSliceAcapU(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSliceAcapU(SB) -TEXT runtime·panicSliceB(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicSliceB(SB) -TEXT runtime·panicSliceBU(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicSliceBU(SB) -TEXT runtime·panicSlice3Alen(SB),NOSPLIT,$0-8 - MOVW R3, x+0(FP) - MOVW R4, y+4(FP) - JMP runtime·goPanicSlice3Alen(SB) -TEXT runtime·panicSlice3AlenU(SB),NOSPLIT,$0-8 - MOVW R3, x+0(FP) - MOVW R4, y+4(FP) - JMP runtime·goPanicSlice3AlenU(SB) -TEXT runtime·panicSlice3Acap(SB),NOSPLIT,$0-8 - MOVW R3, x+0(FP) - MOVW R4, y+4(FP) - JMP runtime·goPanicSlice3Acap(SB) -TEXT runtime·panicSlice3AcapU(SB),NOSPLIT,$0-8 - MOVW R3, x+0(FP) - MOVW R4, y+4(FP) - JMP runtime·goPanicSlice3AcapU(SB) -TEXT runtime·panicSlice3B(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSlice3B(SB) -TEXT runtime·panicSlice3BU(SB),NOSPLIT,$0-8 - MOVW R2, x+0(FP) - MOVW R3, y+4(FP) - JMP runtime·goPanicSlice3BU(SB) -TEXT runtime·panicSlice3C(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicSlice3C(SB) -TEXT runtime·panicSlice3CU(SB),NOSPLIT,$0-8 - MOVW R1, x+0(FP) - MOVW R2, y+4(FP) - JMP runtime·goPanicSlice3CU(SB) -TEXT runtime·panicSliceConvert(SB),NOSPLIT,$0-8 - MOVW R3, x+0(FP) - MOVW R4, y+4(FP) - JMP runtime·goPanicSliceConvert(SB) +TEXT runtime·panicBounds<ABIInternal>(SB),NOSPLIT,$72-0 + NO_LOCAL_POINTERS + // Save all 16 int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + // Skip R0 aka ZERO. + MOVW R1, 12(R29) + MOVW R2, 16(R29) + MOVW R3, 20(R29) + MOVW R4, 24(R29) + MOVW R5, 28(R29) + MOVW R6, 32(R29) + MOVW R7, 36(R29) + MOVW R8, 40(R29) + MOVW R9, 44(R29) + MOVW R10, 48(R29) + MOVW R11, 52(R29) + MOVW R12, 56(R29) + MOVW R13, 60(R29) + MOVW R14, 64(R29) + MOVW R15, 68(R29) + MOVW R16, 72(R29) + + MOVW R31, 4(R29) // PC immediately after call to panicBounds + ADD $12, R29, R1 // pointer to save area + MOVW R1, 8(R29) + CALL runtime·panicBounds32<ABIInternal>(SB) + RET -// Extended versions for 64-bit indexes. -TEXT runtime·panicExtendIndex(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendIndex(SB) -TEXT runtime·panicExtendIndexU(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendIndexU(SB) -TEXT runtime·panicExtendSliceAlen(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R2, lo+4(FP) - MOVW R3, y+8(FP) - JMP runtime·goPanicExtendSliceAlen(SB) -TEXT runtime·panicExtendSliceAlenU(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R2, lo+4(FP) - MOVW R3, y+8(FP) - JMP runtime·goPanicExtendSliceAlenU(SB) -TEXT runtime·panicExtendSliceAcap(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R2, lo+4(FP) - MOVW R3, y+8(FP) - JMP runtime·goPanicExtendSliceAcap(SB) -TEXT runtime·panicExtendSliceAcapU(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R2, lo+4(FP) - MOVW R3, y+8(FP) - JMP runtime·goPanicExtendSliceAcapU(SB) -TEXT runtime·panicExtendSliceB(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendSliceB(SB) -TEXT runtime·panicExtendSliceBU(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendSliceBU(SB) -TEXT runtime·panicExtendSlice3Alen(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R3, lo+4(FP) - MOVW R4, y+8(FP) - JMP runtime·goPanicExtendSlice3Alen(SB) -TEXT runtime·panicExtendSlice3AlenU(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R3, lo+4(FP) - MOVW R4, y+8(FP) - JMP runtime·goPanicExtendSlice3AlenU(SB) -TEXT runtime·panicExtendSlice3Acap(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R3, lo+4(FP) - MOVW R4, y+8(FP) - JMP runtime·goPanicExtendSlice3Acap(SB) -TEXT runtime·panicExtendSlice3AcapU(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R3, lo+4(FP) - MOVW R4, y+8(FP) - JMP runtime·goPanicExtendSlice3AcapU(SB) -TEXT runtime·panicExtendSlice3B(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R2, lo+4(FP) - MOVW R3, y+8(FP) - JMP runtime·goPanicExtendSlice3B(SB) -TEXT runtime·panicExtendSlice3BU(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R2, lo+4(FP) - MOVW R3, y+8(FP) - JMP runtime·goPanicExtendSlice3BU(SB) -TEXT runtime·panicExtendSlice3C(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendSlice3C(SB) -TEXT runtime·panicExtendSlice3CU(SB),NOSPLIT,$0-12 - MOVW R5, hi+0(FP) - MOVW R1, lo+4(FP) - MOVW R2, y+8(FP) - JMP runtime·goPanicExtendSlice3CU(SB) +TEXT runtime·panicExtend<ABIInternal>(SB),NOSPLIT,$72-0 + NO_LOCAL_POINTERS + // Save all 16 int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + // Skip R0 aka ZERO. + MOVW R1, 12(R29) + MOVW R2, 16(R29) + MOVW R3, 20(R29) + MOVW R4, 24(R29) + MOVW R5, 28(R29) + MOVW R6, 32(R29) + MOVW R7, 36(R29) + MOVW R8, 40(R29) + MOVW R9, 44(R29) + MOVW R10, 48(R29) + MOVW R11, 52(R29) + MOVW R12, 56(R29) + MOVW R13, 60(R29) + MOVW R14, 64(R29) + MOVW R15, 68(R29) + MOVW R16, 72(R29) + + MOVW R31, 4(R29) // PC immediately after call to panicBounds + ADD $12, R29, R1 // pointer to save area + MOVW R1, 8(R29) + CALL runtime·panicBounds32X<ABIInternal>(SB) + RET diff --git a/src/runtime/asm_riscv64.s b/src/runtime/asm_riscv64.s index 4031cdde9e..6b16d03c9a 100644 --- a/src/runtime/asm_riscv64.s +++ b/src/runtime/asm_riscv64.s @@ -884,80 +884,32 @@ TEXT runtime·gcWriteBarrier8<ABIInternal>(SB),NOSPLIT,$0 MOV $64, X24 JMP gcWriteBarrier<>(SB) -// Note: these functions use a special calling convention to save generated code space. -// Arguments are passed in registers (ssa/gen/RISCV64Ops.go), but the space for those -// arguments are allocated in the caller's stack frame. -// These stubs write the args into that stack space and then tail call to the -// corresponding runtime handler. -// The tail call makes these stubs disappear in backtraces. -TEXT runtime·panicIndex<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T0, X10 - MOV T1, X11 - JMP runtime·goPanicIndex<ABIInternal>(SB) -TEXT runtime·panicIndexU<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T0, X10 - MOV T1, X11 - JMP runtime·goPanicIndexU<ABIInternal>(SB) -TEXT runtime·panicSliceAlen<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T1, X10 - MOV T2, X11 - JMP runtime·goPanicSliceAlen<ABIInternal>(SB) -TEXT runtime·panicSliceAlenU<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T1, X10 - MOV T2, X11 - JMP runtime·goPanicSliceAlenU<ABIInternal>(SB) -TEXT runtime·panicSliceAcap<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T1, X10 - MOV T2, X11 - JMP runtime·goPanicSliceAcap<ABIInternal>(SB) -TEXT runtime·panicSliceAcapU<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T1, X10 - MOV T2, X11 - JMP runtime·goPanicSliceAcapU<ABIInternal>(SB) -TEXT runtime·panicSliceB<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T0, X10 - MOV T1, X11 - JMP runtime·goPanicSliceB<ABIInternal>(SB) -TEXT runtime·panicSliceBU<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T0, X10 - MOV T1, X11 - JMP runtime·goPanicSliceBU<ABIInternal>(SB) -TEXT runtime·panicSlice3Alen<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T2, X10 - MOV T3, X11 - JMP runtime·goPanicSlice3Alen<ABIInternal>(SB) -TEXT runtime·panicSlice3AlenU<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T2, X10 - MOV T3, X11 - JMP runtime·goPanicSlice3AlenU<ABIInternal>(SB) -TEXT runtime·panicSlice3Acap<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T2, X10 - MOV T3, X11 - JMP runtime·goPanicSlice3Acap<ABIInternal>(SB) -TEXT runtime·panicSlice3AcapU<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T2, X10 - MOV T3, X11 - JMP runtime·goPanicSlice3AcapU<ABIInternal>(SB) -TEXT runtime·panicSlice3B<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T1, X10 - MOV T2, X11 - JMP runtime·goPanicSlice3B<ABIInternal>(SB) -TEXT runtime·panicSlice3BU<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T1, X10 - MOV T2, X11 - JMP runtime·goPanicSlice3BU<ABIInternal>(SB) -TEXT runtime·panicSlice3C<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T0, X10 - MOV T1, X11 - JMP runtime·goPanicSlice3C<ABIInternal>(SB) -TEXT runtime·panicSlice3CU<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T0, X10 - MOV T1, X11 - JMP runtime·goPanicSlice3CU<ABIInternal>(SB) -TEXT runtime·panicSliceConvert<ABIInternal>(SB),NOSPLIT,$0-16 - MOV T2, X10 - MOV T3, X11 - JMP runtime·goPanicSliceConvert<ABIInternal>(SB) +TEXT runtime·panicBounds<ABIInternal>(SB),NOSPLIT,$144-0 + NO_LOCAL_POINTERS + // Save all 16 int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + // Skip X0 aka ZERO, X1 aka LR, X2 aka SP, X3 aka GP, X4 aka TP. + MOV X5, 24(X2) + MOV X6, 32(X2) + MOV X7, 40(X2) + MOV X8, 48(X2) + MOV X9, 56(X2) + MOV X10, 64(X2) + MOV X11, 72(X2) + MOV X12, 80(X2) + MOV X13, 88(X2) + MOV X14, 96(X2) + MOV X15, 104(X2) + MOV X16, 112(X2) + MOV X17, 120(X2) + MOV X18, 128(X2) + MOV X19, 136(X2) + MOV X20, 144(X2) + + MOV X1, X10 // PC immediately after call to panicBounds + ADD $24, X2, X11 // pointer to save area + CALL runtime·panicBounds64<ABIInternal>(SB) + RET DATA runtime·mainPC+0(SB)/8,$runtime·main<ABIInternal>(SB) GLOBL runtime·mainPC(SB),RODATA,$8 diff --git a/src/runtime/asm_s390x.s b/src/runtime/asm_s390x.s index 7fc88009e8..4cc1c0eb10 100644 --- a/src/runtime/asm_s390x.s +++ b/src/runtime/asm_s390x.s @@ -892,76 +892,18 @@ TEXT runtime·gcWriteBarrier8<ABIInternal>(SB),NOSPLIT,$0 MOVD $64, R9 JMP gcWriteBarrier<>(SB) -// Note: these functions use a special calling convention to save generated code space. -// Arguments are passed in registers, but the space for those arguments are allocated -// in the caller's stack frame. These stubs write the args into that stack space and -// then tail call to the corresponding runtime handler. -// The tail call makes these stubs disappear in backtraces. -TEXT runtime·panicIndex(SB),NOSPLIT,$0-16 - MOVD R0, x+0(FP) - MOVD R1, y+8(FP) - JMP runtime·goPanicIndex(SB) -TEXT runtime·panicIndexU(SB),NOSPLIT,$0-16 - MOVD R0, x+0(FP) - MOVD R1, y+8(FP) - JMP runtime·goPanicIndexU(SB) -TEXT runtime·panicSliceAlen(SB),NOSPLIT,$0-16 - MOVD R1, x+0(FP) - MOVD R2, y+8(FP) - JMP runtime·goPanicSliceAlen(SB) -TEXT runtime·panicSliceAlenU(SB),NOSPLIT,$0-16 - MOVD R1, x+0(FP) - MOVD R2, y+8(FP) - JMP runtime·goPanicSliceAlenU(SB) -TEXT runtime·panicSliceAcap(SB),NOSPLIT,$0-16 - MOVD R1, x+0(FP) - MOVD R2, y+8(FP) - JMP runtime·goPanicSliceAcap(SB) -TEXT runtime·panicSliceAcapU(SB),NOSPLIT,$0-16 - MOVD R1, x+0(FP) - MOVD R2, y+8(FP) - JMP runtime·goPanicSliceAcapU(SB) -TEXT runtime·panicSliceB(SB),NOSPLIT,$0-16 - MOVD R0, x+0(FP) - MOVD R1, y+8(FP) - JMP runtime·goPanicSliceB(SB) -TEXT runtime·panicSliceBU(SB),NOSPLIT,$0-16 - MOVD R0, x+0(FP) - MOVD R1, y+8(FP) - JMP runtime·goPanicSliceBU(SB) -TEXT runtime·panicSlice3Alen(SB),NOSPLIT,$0-16 - MOVD R2, x+0(FP) - MOVD R3, y+8(FP) - JMP runtime·goPanicSlice3Alen(SB) -TEXT runtime·panicSlice3AlenU(SB),NOSPLIT,$0-16 - MOVD R2, x+0(FP) - MOVD R3, y+8(FP) - JMP runtime·goPanicSlice3AlenU(SB) -TEXT runtime·panicSlice3Acap(SB),NOSPLIT,$0-16 - MOVD R2, x+0(FP) - MOVD R3, y+8(FP) - JMP runtime·goPanicSlice3Acap(SB) -TEXT runtime·panicSlice3AcapU(SB),NOSPLIT,$0-16 - MOVD R2, x+0(FP) - MOVD R3, y+8(FP) - JMP runtime·goPanicSlice3AcapU(SB) -TEXT runtime·panicSlice3B(SB),NOSPLIT,$0-16 - MOVD R1, x+0(FP) - MOVD R2, y+8(FP) - JMP runtime·goPanicSlice3B(SB) -TEXT runtime·panicSlice3BU(SB),NOSPLIT,$0-16 - MOVD R1, x+0(FP) - MOVD R2, y+8(FP) - JMP runtime·goPanicSlice3BU(SB) -TEXT runtime·panicSlice3C(SB),NOSPLIT,$0-16 - MOVD R0, x+0(FP) - MOVD R1, y+8(FP) - JMP runtime·goPanicSlice3C(SB) -TEXT runtime·panicSlice3CU(SB),NOSPLIT,$0-16 - MOVD R0, x+0(FP) - MOVD R1, y+8(FP) - JMP runtime·goPanicSlice3CU(SB) -TEXT runtime·panicSliceConvert(SB),NOSPLIT,$0-16 - MOVD R2, x+0(FP) - MOVD R3, y+8(FP) - JMP runtime·goPanicSliceConvert(SB) +TEXT runtime·panicBounds<ABIInternal>(SB),NOSPLIT,$144-0 + NO_LOCAL_POINTERS + // Save all 16 int registers that could have an index in them. + // They may be pointers, but if they are they are dead. + STMG R0, R12, 24(R15) + // Note that R10 @ 104 is not needed, it is an assembler temp + // skip R13 aka G @ 128 + // skip R14 aka LR @ 136 + // skip R15 aka SP @ 144 + + MOVD R14, 8(R15) // PC immediately after call to panicBounds + ADD $24, R15, R0 // pointer to save area + MOVD R0, 16(R15) + CALL runtime·panicBounds64<ABIInternal>(SB) + RET diff --git a/src/runtime/asm_wasm.s b/src/runtime/asm_wasm.s index 751bf0aec7..85aa52e0f7 100644 --- a/src/runtime/asm_wasm.s +++ b/src/runtime/asm_wasm.s @@ -532,7 +532,7 @@ TEXT wasm_pc_f_loop(SB),NOSPLIT,$0 Get SP I32Const $8 I32Sub - I32Load16U $2 // PC_F + I32Load $2 // PC_F CallIndirect $0 Drop @@ -568,7 +568,7 @@ outer: Get SP I32Const $8 I32Sub - I32Load16U $2 // PC_F + I32Load $2 // PC_F Tee R2 Get R0 diff --git a/src/runtime/cgocall.go b/src/runtime/cgocall.go index b046ab960f..18e1dc8baf 100644 --- a/src/runtime/cgocall.go +++ b/src/runtime/cgocall.go @@ -191,8 +191,8 @@ func cgocall(fn, arg unsafe.Pointer) int32 { osPreemptExtExit(mp) - // Save current syscall parameters, so m.winsyscall can be - // used again if callback decide to make syscall. + // After exitsyscall we can be rescheduled on a different M, + // so we need to restore the original M's winsyscall. winsyscall := mp.winsyscall exitsyscall() @@ -543,18 +543,18 @@ func cgoCheckPointer(ptr any, arg any) { t := ep._type top := true - if arg != nil && (t.Kind_&abi.KindMask == abi.Pointer || t.Kind_&abi.KindMask == abi.UnsafePointer) { + if arg != nil && (t.Kind() == abi.Pointer || t.Kind() == abi.UnsafePointer) { p := ep.data - if t.Kind_&abi.KindDirectIface == 0 { + if !t.IsDirectIface() { p = *(*unsafe.Pointer)(p) } if p == nil || !cgoIsGoPointer(p) { return } aep := efaceOf(&arg) - switch aep._type.Kind_ & abi.KindMask { + switch aep._type.Kind() { case abi.Bool: - if t.Kind_&abi.KindMask == abi.UnsafePointer { + if t.Kind() == abi.UnsafePointer { // We don't know the type of the element. break } @@ -578,7 +578,7 @@ func cgoCheckPointer(ptr any, arg any) { // Check the array rather than the pointer. pt := (*abi.PtrType)(unsafe.Pointer(aep._type)) t = pt.Elem - if t.Kind_&abi.KindMask != abi.Array { + if t.Kind() != abi.Array { throw("can't happen") } ep = aep @@ -588,7 +588,7 @@ func cgoCheckPointer(ptr any, arg any) { } } - cgoCheckArg(t, ep.data, t.Kind_&abi.KindDirectIface == 0, top, cgoCheckPointerFail) + cgoCheckArg(t, ep.data, !t.IsDirectIface(), top, cgoCheckPointerFail) } const cgoCheckPointerFail = "cgo argument has Go pointer to unpinned Go pointer" @@ -605,7 +605,7 @@ func cgoCheckArg(t *_type, p unsafe.Pointer, indir, top bool, msg string) { return } - switch t.Kind_ & abi.KindMask { + switch t.Kind() { default: throw("can't happen") case abi.Array: @@ -614,7 +614,7 @@ func cgoCheckArg(t *_type, p unsafe.Pointer, indir, top bool, msg string) { if at.Len != 1 { throw("can't happen") } - cgoCheckArg(at.Elem, p, at.Elem.Kind_&abi.KindDirectIface == 0, top, msg) + cgoCheckArg(at.Elem, p, !at.Elem.IsDirectIface(), top, msg) return } for i := uintptr(0); i < at.Len; i++ { @@ -652,7 +652,7 @@ func cgoCheckArg(t *_type, p unsafe.Pointer, indir, top bool, msg string) { if !top && !isPinned(p) { panic(errorString(msg)) } - cgoCheckArg(it, p, it.Kind_&abi.KindDirectIface == 0, false, msg) + cgoCheckArg(it, p, !it.IsDirectIface(), false, msg) case abi.Slice: st := (*slicetype)(unsafe.Pointer(t)) s := (*slice)(p) @@ -684,7 +684,7 @@ func cgoCheckArg(t *_type, p unsafe.Pointer, indir, top bool, msg string) { if len(st.Fields) != 1 { throw("can't happen") } - cgoCheckArg(st.Fields[0].Typ, p, st.Fields[0].Typ.Kind_&abi.KindDirectIface == 0, top, msg) + cgoCheckArg(st.Fields[0].Typ, p, !st.Fields[0].Typ.IsDirectIface(), top, msg) return } for _, f := range st.Fields { @@ -792,5 +792,5 @@ func cgoCheckResult(val any) { ep := efaceOf(&val) t := ep._type - cgoCheckArg(t, ep.data, t.Kind_&abi.KindDirectIface == 0, false, cgoResultFail) + cgoCheckArg(t, ep.data, !t.IsDirectIface(), false, cgoResultFail) } diff --git a/src/runtime/crash_test.go b/src/runtime/crash_test.go index 8696672065..2db86e0562 100644 --- a/src/runtime/crash_test.go +++ b/src/runtime/crash_test.go @@ -186,21 +186,6 @@ func buildTestProg(t *testing.T, binary string, flags ...string) (string, error) t.Logf("running %v", cmd) cmd.Dir = "testdata/" + binary cmd = testenv.CleanCmdEnv(cmd) - - // Add the rangefunc GOEXPERIMENT unconditionally since some tests depend on it. - // TODO(61405): Remove this once it's enabled by default. - edited := false - for i := range cmd.Env { - e := cmd.Env[i] - if _, vars, ok := strings.Cut(e, "GOEXPERIMENT="); ok { - cmd.Env[i] = "GOEXPERIMENT=" + vars + ",rangefunc" - edited = true - } - } - if !edited { - cmd.Env = append(cmd.Env, "GOEXPERIMENT=rangefunc") - } - out, err := cmd.CombinedOutput() if err != nil { target.err = fmt.Errorf("building %s %v: %v\n%s", binary, flags, err, out) diff --git a/src/runtime/crash_unix_test.go b/src/runtime/crash_unix_test.go index 101107d2f7..f9c12d5404 100644 --- a/src/runtime/crash_unix_test.go +++ b/src/runtime/crash_unix_test.go @@ -65,7 +65,7 @@ func TestCrashDumpsAllThreads(t *testing.T) { t.Skipf("skipping; not supported on %v", runtime.GOOS) } - if runtime.GOOS == "openbsd" && (runtime.GOARCH == "arm" || runtime.GOARCH == "mips64" || runtime.GOARCH == "ppc64") { + if runtime.GOOS == "openbsd" && (runtime.GOARCH == "arm" || runtime.GOARCH == "ppc64") { // This may be ncpu < 2 related... t.Skipf("skipping; test fails on %s/%s - see issue #42464", runtime.GOOS, runtime.GOARCH) } diff --git a/src/runtime/debug.go b/src/runtime/debug.go index c7592d3329..dacadd2721 100644 --- a/src/runtime/debug.go +++ b/src/runtime/debug.go @@ -13,13 +13,23 @@ import ( // simultaneously and returns the previous setting. If n < 1, it does not change // the current setting. // +// # Default +// // If the GOMAXPROCS environment variable is set to a positive whole number, // GOMAXPROCS defaults to that value. // -// Otherwise, the Go runtime selects an appropriate default value based on the -// number of logical CPUs on the machine, the process’s CPU affinity mask, and, -// on Linux, the process’s average CPU throughput limit based on cgroup CPU -// quota, if any. +// Otherwise, the Go runtime selects an appropriate default value from a combination of +// - the number of logical CPUs on the machine, +// - the process’s CPU affinity mask, +// - and, on Linux, the process’s average CPU throughput limit based on cgroup CPU +// quota, if any. +// +// If GODEBUG=containermaxprocs=0 is set and GOMAXPROCS is not set by the +// environment variable, then GOMAXPROCS instead defaults to the value of +// [runtime.NumCPU]. Note that GODEBUG=containermaxprocs=0 is [default] for +// language version 1.24 and below. +// +// # Updates // // The Go runtime periodically updates the default value based on changes to // the total logical CPU count, the CPU affinity mask, or cgroup quota. Setting @@ -27,11 +37,36 @@ import ( // GOMAXPROCS disables automatic updates. The default value and automatic // updates can be restored by calling [SetDefaultGOMAXPROCS]. // -// If GODEBUG=containermaxprocs=0 is set, GOMAXPROCS defaults to the value of -// [runtime.NumCPU]. If GODEBUG=updatemaxprocs=0 is set, the Go runtime does -// not perform automatic GOMAXPROCS updating. +// If GODEBUG=updatemaxprocs=0 is set, the Go runtime does not perform +// automatic GOMAXPROCS updating. Note that GODEBUG=updatemaxprocs=0 is +// [default] for language version 1.24 and below. +// +// # Compatibility +// +// Note that the default GOMAXPROCS behavior may change as the scheduler +// improves, especially the implementation detail below. +// +// # Implementation details +// +// When computing default GOMAXPROCS via cgroups, the Go runtime computes the +// "average CPU throughput limit" as the cgroup CPU quota / period. In cgroup +// v2, these values come from the cpu.max file. In cgroup v1, they come from +// cpu.cfs_quota_us and cpu.cfs_period_us, respectively. In container runtimes +// that allow configuring CPU limits, this value usually corresponds to the +// "CPU limit" option, not "CPU request". +// +// The Go runtime typically selects the default GOMAXPROCS as the minimum of +// the logical CPU count, the CPU affinity mask count, or the cgroup CPU +// throughput limit. However, it will never set GOMAXPROCS less than 2 unless +// the logical CPU count or CPU affinity mask count are below 2. +// +// If the cgroup CPU throughput limit is not a whole number, the Go runtime +// rounds up to the next whole number. +// +// GOMAXPROCS updates are performed up to once per second, or less if the +// application is idle. // -// The default GOMAXPROCS behavior may change as the scheduler improves. +// [default]: https://go.dev/doc/godebug#default func GOMAXPROCS(n int) int { if GOARCH == "wasm" && n > 1 { n = 1 // WebAssembly has no threads yet, so only one CPU is possible. diff --git a/src/runtime/debuglog.go b/src/runtime/debuglog.go index 50fba3568d..e993e396c1 100644 --- a/src/runtime/debuglog.go +++ b/src/runtime/debuglog.go @@ -327,7 +327,7 @@ func (l *dloggerImpl) p(x any) *dloggerImpl { l.w.uvarint(0) } else { v := efaceOf(&x) - switch v._type.Kind_ & abi.KindMask { + switch v._type.Kind() { case abi.Chan, abi.Func, abi.Map, abi.Pointer, abi.UnsafePointer: l.w.uvarint(uint64(uintptr(v.data))) default: diff --git a/src/runtime/defs_openbsd.go b/src/runtime/defs_openbsd.go index d93c087a81..9564a3354c 100644 --- a/src/runtime/defs_openbsd.go +++ b/src/runtime/defs_openbsd.go @@ -11,7 +11,6 @@ GOARCH=amd64 go tool cgo -godefs defs_openbsd.go GOARCH=386 go tool cgo -godefs defs_openbsd.go GOARCH=arm go tool cgo -godefs defs_openbsd.go GOARCH=arm64 go tool cgo -godefs defs_openbsd.go -GOARCH=mips64 go tool cgo -godefs defs_openbsd.go */ package runtime diff --git a/src/runtime/defs_openbsd_mips64.go b/src/runtime/defs_openbsd_mips64.go deleted file mode 100644 index 7958044d04..0000000000 --- a/src/runtime/defs_openbsd_mips64.go +++ /dev/null @@ -1,171 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Generated from: -// -// GOARCH=mips64 go tool cgo -godefs defs_openbsd.go -// -// Then converted to the form used by the runtime. - -package runtime - -import "unsafe" - -const ( - _EINTR = 0x4 - _EFAULT = 0xe - _EAGAIN = 0x23 - _ETIMEDOUT = 0x3c - - _O_WRONLY = 0x1 - _O_NONBLOCK = 0x4 - _O_CREAT = 0x200 - _O_TRUNC = 0x400 - _O_CLOEXEC = 0x10000 - - _PROT_NONE = 0x0 - _PROT_READ = 0x1 - _PROT_WRITE = 0x2 - _PROT_EXEC = 0x4 - - _MAP_ANON = 0x1000 - _MAP_PRIVATE = 0x2 - _MAP_FIXED = 0x10 - _MAP_STACK = 0x4000 - - _MADV_DONTNEED = 0x4 - _MADV_FREE = 0x6 - - _SA_SIGINFO = 0x40 - _SA_RESTART = 0x2 - _SA_ONSTACK = 0x1 - - _SIGHUP = 0x1 - _SIGINT = 0x2 - _SIGQUIT = 0x3 - _SIGILL = 0x4 - _SIGTRAP = 0x5 - _SIGABRT = 0x6 - _SIGEMT = 0x7 - _SIGFPE = 0x8 - _SIGKILL = 0x9 - _SIGBUS = 0xa - _SIGSEGV = 0xb - _SIGSYS = 0xc - _SIGPIPE = 0xd - _SIGALRM = 0xe - _SIGTERM = 0xf - _SIGURG = 0x10 - _SIGSTOP = 0x11 - _SIGTSTP = 0x12 - _SIGCONT = 0x13 - _SIGCHLD = 0x14 - _SIGTTIN = 0x15 - _SIGTTOU = 0x16 - _SIGIO = 0x17 - _SIGXCPU = 0x18 - _SIGXFSZ = 0x19 - _SIGVTALRM = 0x1a - _SIGPROF = 0x1b - _SIGWINCH = 0x1c - _SIGINFO = 0x1d - _SIGUSR1 = 0x1e - _SIGUSR2 = 0x1f - - _FPE_INTDIV = 0x1 - _FPE_INTOVF = 0x2 - _FPE_FLTDIV = 0x3 - _FPE_FLTOVF = 0x4 - _FPE_FLTUND = 0x5 - _FPE_FLTRES = 0x6 - _FPE_FLTINV = 0x7 - _FPE_FLTSUB = 0x8 - - _BUS_ADRALN = 0x1 - _BUS_ADRERR = 0x2 - _BUS_OBJERR = 0x3 - - _SEGV_MAPERR = 0x1 - _SEGV_ACCERR = 0x2 - - _ITIMER_REAL = 0x0 - _ITIMER_VIRTUAL = 0x1 - _ITIMER_PROF = 0x2 - - _EV_ADD = 0x1 - _EV_DELETE = 0x2 - _EV_CLEAR = 0x20 - _EV_ERROR = 0x4000 - _EV_EOF = 0x8000 - _EVFILT_READ = -0x1 - _EVFILT_WRITE = -0x2 -) - -type tforkt struct { - tf_tcb unsafe.Pointer - tf_tid *int32 - tf_stack uintptr -} - -type sigcontext struct { - sc_cookie uint64 - sc_mask uint64 - sc_pc uint64 - sc_regs [32]uint64 - mullo uint64 - mulhi uint64 - sc_fpregs [33]uint64 - sc_fpused uint64 - sc_fpc_eir uint64 - _xxx [8]int64 -} - -type siginfo struct { - si_signo int32 - si_code int32 - si_errno int32 - pad_cgo_0 [4]byte - _data [120]byte -} - -type stackt struct { - ss_sp uintptr - ss_size uintptr - ss_flags int32 - pad_cgo_0 [4]byte -} - -type timespec struct { - tv_sec int64 - tv_nsec int64 -} - -//go:nosplit -func (ts *timespec) setNsec(ns int64) { - ts.tv_sec = ns / 1e9 - ts.tv_nsec = ns % 1e9 -} - -type timeval struct { - tv_sec int64 - tv_usec int64 -} - -func (tv *timeval) set_usec(x int32) { - tv.tv_usec = int64(x) -} - -type itimerval struct { - it_interval timeval - it_value timeval -} - -type keventt struct { - ident uint64 - filter int16 - flags uint16 - fflags uint32 - data int64 - udata *byte -} diff --git a/src/runtime/ehooks_test.go b/src/runtime/ehooks_test.go index c7f51740fb..380d709876 100644 --- a/src/runtime/ehooks_test.go +++ b/src/runtime/ehooks_test.go @@ -63,12 +63,12 @@ func TestExitHooks(t *testing.T) { outs = strings.TrimSpace(outs) if s.expected != "" && s.expected != outs { t.Fatalf("failed %s: wanted %q\noutput:\n%s", - s.mode, s.expected, outs) + s.mode, s.expected, outs) } for _, need := range s.musthave { if !strings.Contains(outs, need) { t.Fatalf("failed mode %s: output does not contain %q\noutput:\n%s", - s.mode, need, outs) + s.mode, need, outs) } } if s.expected == "" && s.musthave == nil && outs != "" { diff --git a/src/runtime/error.go b/src/runtime/error.go index 8e50c0fea4..f95b14d780 100644 --- a/src/runtime/error.go +++ b/src/runtime/error.go @@ -132,52 +132,34 @@ type boundsError struct { // Instead, we keep track of whether x should be interpreted as signed or unsigned. // y is known to be nonnegative and to fit in an int. signed bool - code boundsErrorCode + code abi.BoundsErrorCode } -type boundsErrorCode uint8 - -const ( - boundsIndex boundsErrorCode = iota // s[x], 0 <= x < len(s) failed - - boundsSliceAlen // s[?:x], 0 <= x <= len(s) failed - boundsSliceAcap // s[?:x], 0 <= x <= cap(s) failed - boundsSliceB // s[x:y], 0 <= x <= y failed (but boundsSliceA didn't happen) - - boundsSlice3Alen // s[?:?:x], 0 <= x <= len(s) failed - boundsSlice3Acap // s[?:?:x], 0 <= x <= cap(s) failed - boundsSlice3B // s[?:x:y], 0 <= x <= y failed (but boundsSlice3A didn't happen) - boundsSlice3C // s[x:y:?], 0 <= x <= y failed (but boundsSlice3A/B didn't happen) - - boundsConvert // (*[x]T)(s), 0 <= x <= len(s) failed - // Note: in the above, len(s) and cap(s) are stored in y -) - // boundsErrorFmts provide error text for various out-of-bounds panics. // Note: if you change these strings, you should adjust the size of the buffer // in boundsError.Error below as well. var boundsErrorFmts = [...]string{ - boundsIndex: "index out of range [%x] with length %y", - boundsSliceAlen: "slice bounds out of range [:%x] with length %y", - boundsSliceAcap: "slice bounds out of range [:%x] with capacity %y", - boundsSliceB: "slice bounds out of range [%x:%y]", - boundsSlice3Alen: "slice bounds out of range [::%x] with length %y", - boundsSlice3Acap: "slice bounds out of range [::%x] with capacity %y", - boundsSlice3B: "slice bounds out of range [:%x:%y]", - boundsSlice3C: "slice bounds out of range [%x:%y:]", - boundsConvert: "cannot convert slice with length %y to array or pointer to array with length %x", + abi.BoundsIndex: "index out of range [%x] with length %y", + abi.BoundsSliceAlen: "slice bounds out of range [:%x] with length %y", + abi.BoundsSliceAcap: "slice bounds out of range [:%x] with capacity %y", + abi.BoundsSliceB: "slice bounds out of range [%x:%y]", + abi.BoundsSlice3Alen: "slice bounds out of range [::%x] with length %y", + abi.BoundsSlice3Acap: "slice bounds out of range [::%x] with capacity %y", + abi.BoundsSlice3B: "slice bounds out of range [:%x:%y]", + abi.BoundsSlice3C: "slice bounds out of range [%x:%y:]", + abi.BoundsConvert: "cannot convert slice with length %y to array or pointer to array with length %x", } // boundsNegErrorFmts are overriding formats if x is negative. In this case there's no need to report y. var boundsNegErrorFmts = [...]string{ - boundsIndex: "index out of range [%x]", - boundsSliceAlen: "slice bounds out of range [:%x]", - boundsSliceAcap: "slice bounds out of range [:%x]", - boundsSliceB: "slice bounds out of range [%x:]", - boundsSlice3Alen: "slice bounds out of range [::%x]", - boundsSlice3Acap: "slice bounds out of range [::%x]", - boundsSlice3B: "slice bounds out of range [:%x:]", - boundsSlice3C: "slice bounds out of range [%x::]", + abi.BoundsIndex: "index out of range [%x]", + abi.BoundsSliceAlen: "slice bounds out of range [:%x]", + abi.BoundsSliceAcap: "slice bounds out of range [:%x]", + abi.BoundsSliceB: "slice bounds out of range [%x:]", + abi.BoundsSlice3Alen: "slice bounds out of range [::%x]", + abi.BoundsSlice3Acap: "slice bounds out of range [::%x]", + abi.BoundsSlice3B: "slice bounds out of range [:%x:]", + abi.BoundsSlice3C: "slice bounds out of range [%x::]", } func (e boundsError) RuntimeError() {} @@ -278,7 +260,7 @@ func printanycustomtype(i any) { eface := efaceOf(&i) typestring := toRType(eface._type).string() - switch eface._type.Kind_ { + switch eface._type.Kind() { case abi.String: print(typestring, `("`) printindented(*(*string)(eface.data)) diff --git a/src/runtime/export_debug_test.go b/src/runtime/export_debug_test.go index 96f6fd9eea..94dc974804 100644 --- a/src/runtime/export_debug_test.go +++ b/src/runtime/export_debug_test.go @@ -33,13 +33,13 @@ func InjectDebugCall(gp *g, fn any, regArgs *abi.RegArgs, stackArgs any, tkill f } f := efaceOf(&fn) - if f._type == nil || f._type.Kind_&abi.KindMask != abi.Func { + if f._type == nil || f._type.Kind() != abi.Func { return nil, plainError("fn must be a function") } fv := (*funcval)(f.data) a := efaceOf(&stackArgs) - if a._type != nil && a._type.Kind_&abi.KindMask != abi.Pointer { + if a._type != nil && a._type.Kind() != abi.Pointer { return nil, plainError("args must be a pointer or nil") } argp := a.data diff --git a/src/runtime/export_map_noswiss_test.go b/src/runtime/export_map_noswiss_test.go deleted file mode 100644 index 4638afa6b8..0000000000 --- a/src/runtime/export_map_noswiss_test.go +++ /dev/null @@ -1,64 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -package runtime - -import ( - "internal/abi" - "unsafe" -) - -const RuntimeHmapSize = unsafe.Sizeof(hmap{}) - -func OverLoadFactor(count int, B uint8) bool { - return overLoadFactor(count, B) -} - -func MapBucketsCount(m map[int]int) int { - h := *(**hmap)(unsafe.Pointer(&m)) - return 1 << h.B -} - -func MapBucketsPointerIsNil(m map[int]int) bool { - h := *(**hmap)(unsafe.Pointer(&m)) - return h.buckets == nil -} - -func MapTombstoneCheck(m map[int]int) { - // Make sure emptyOne and emptyRest are distributed correctly. - // We should have a series of filled and emptyOne cells, followed by - // a series of emptyRest cells. - h := *(**hmap)(unsafe.Pointer(&m)) - i := any(m) - t := *(**maptype)(unsafe.Pointer(&i)) - - for x := 0; x < 1<<h.B; x++ { - b0 := (*bmap)(add(h.buckets, uintptr(x)*uintptr(t.BucketSize))) - n := 0 - for b := b0; b != nil; b = b.overflow(t) { - for i := 0; i < abi.OldMapBucketCount; i++ { - if b.tophash[i] != emptyRest { - n++ - } - } - } - k := 0 - for b := b0; b != nil; b = b.overflow(t) { - for i := 0; i < abi.OldMapBucketCount; i++ { - if k < n && b.tophash[i] == emptyRest { - panic("early emptyRest") - } - if k >= n && b.tophash[i] != emptyRest { - panic("late non-emptyRest") - } - if k == n-1 && b.tophash[i] == emptyOne { - panic("last non-emptyRest entry is emptyOne") - } - k++ - } - } - } -} diff --git a/src/runtime/export_map_swiss_test.go b/src/runtime/export_map_swiss_test.go deleted file mode 100644 index 55a7d6ff04..0000000000 --- a/src/runtime/export_map_swiss_test.go +++ /dev/null @@ -1,11 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build goexperiment.swissmap - -package runtime - -func MapTombstoneCheck(m map[int]int) { - // TODO -} diff --git a/src/runtime/export_test.go b/src/runtime/export_test.go index 81542deb59..1f55717f0a 100644 --- a/src/runtime/export_test.go +++ b/src/runtime/export_test.go @@ -9,6 +9,7 @@ package runtime import ( "internal/abi" "internal/goarch" + "internal/goexperiment" "internal/goos" "internal/runtime/atomic" "internal/runtime/gc" @@ -58,9 +59,6 @@ const CrashStackImplemented = crashStackImplemented const TracebackInnerFrames = tracebackInnerFrames const TracebackOuterFrames = tracebackOuterFrames -var MapKeys = keys -var MapValues = values - var LockPartialOrder = lockPartialOrder type TimeTimer = timeTimer @@ -417,7 +415,8 @@ func ReadMemStatsSlow() (base, slow MemStats) { slow.HeapReleased += uint64(pg) * pageSize } for _, p := range allp { - pg := sys.OnesCount64(p.pcache.scav) + // Only count scav bits for pages in the cache + pg := sys.OnesCount64(p.pcache.cache & p.pcache.scav) slow.HeapReleased += uint64(pg) * pageSize } @@ -1122,12 +1121,16 @@ func CheckScavengedBitsCleared(mismatches []BitsMismatch) (n int, ok bool) { // Lock so that we can safely access the bitmap. lock(&mheap_.lock) + + heapBase := mheap_.pages.inUse.ranges[0].base.addr() + secondArenaBase := arenaBase(arenaIndex(heapBase) + 1) chunkLoop: for i := mheap_.pages.start; i < mheap_.pages.end; i++ { chunk := mheap_.pages.tryChunkOf(i) if chunk == nil { continue } + cb := chunkBase(i) for j := 0; j < pallocChunkPages/64; j++ { // Run over each 64-bit bitmap section and ensure // scavenged is being cleared properly on allocation. @@ -1137,12 +1140,20 @@ func CheckScavengedBitsCleared(mismatches []BitsMismatch) (n int, ok bool) { want := chunk.scavenged[j] &^ chunk.pallocBits[j] got := chunk.scavenged[j] if want != got { + // When goexperiment.RandomizedHeapBase64 is set we use a + // series of padding pages to generate randomized heap base + // address which have both the alloc and scav bits set. If + // we see this for a chunk between the address of the heap + // base, and the address of the second arena continue. + if goexperiment.RandomizedHeapBase64 && (cb >= heapBase && cb < secondArenaBase) { + continue + } ok = false if n >= len(mismatches) { break chunkLoop } mismatches[n] = BitsMismatch{ - Base: chunkBase(i) + uintptr(j)*64*pageSize, + Base: cb + uintptr(j)*64*pageSize, Got: got, Want: want, } @@ -1761,7 +1772,7 @@ func NewUserArena() *UserArena { func (a *UserArena) New(out *any) { i := efaceOf(out) typ := i._type - if typ.Kind_&abi.KindMask != abi.Pointer { + if typ.Kind() != abi.Pointer { panic("new result of non-ptr type") } typ = (*ptrtype)(unsafe.Pointer(typ)).Elem diff --git a/src/runtime/export_windows_test.go b/src/runtime/export_windows_test.go index 13d30d4bc4..caaf2dae51 100644 --- a/src/runtime/export_windows_test.go +++ b/src/runtime/export_windows_test.go @@ -11,8 +11,6 @@ import ( "unsafe" ) -const MaxArgs = maxArgs - var ( OsYield = osyield TimeBeginPeriodRetValue = &timeBeginPeriodRetValue @@ -20,7 +18,7 @@ var ( func NumberOfProcessors() int32 { var info systeminfo - stdcall1(_GetSystemInfo, uintptr(unsafe.Pointer(&info))) + stdcall(_GetSystemInfo, uintptr(unsafe.Pointer(&info))) return int32(info.dwnumberofprocessors) } diff --git a/src/runtime/heapdump.go b/src/runtime/heapdump.go index 5476035b2e..d9474034c2 100644 --- a/src/runtime/heapdump.go +++ b/src/runtime/heapdump.go @@ -206,7 +206,7 @@ func dumptype(t *_type) { dwritebyte('.') dwrite(unsafe.Pointer(unsafe.StringData(name)), uintptr(len(name))) } - dumpbool(t.Kind_&abi.KindDirectIface == 0 || t.Pointers()) + dumpbool(!t.IsDirectIface() || t.Pointers()) } // dump an object. @@ -460,7 +460,7 @@ func dumproots() { continue } spf := (*specialfinalizer)(unsafe.Pointer(sp)) - p := unsafe.Pointer(s.base() + uintptr(spf.special.offset)) + p := unsafe.Pointer(s.base() + spf.special.offset) dumpfinalizer(p, spf.fn, spf.fint, spf.ot) } } @@ -659,7 +659,7 @@ func dumpmemprof() { continue } spp := (*specialprofile)(unsafe.Pointer(sp)) - p := s.base() + uintptr(spp.special.offset) + p := s.base() + spp.special.offset dumpint(tagAllocSample) dumpint(uint64(p)) dumpint(uint64(uintptr(unsafe.Pointer(spp.b)))) diff --git a/src/runtime/linkname_swiss.go b/src/runtime/linkname_shim.go index 1be724477e..4ba3d1fb78 100644 --- a/src/runtime/linkname_swiss.go +++ b/src/runtime/linkname_shim.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.swissmap - package runtime import ( @@ -16,8 +14,7 @@ import ( // Legacy //go:linkname compatibility shims // // The functions below are unused by the toolchain, and exist only for -// compatibility with existing //go:linkname use in the ecosystem (and in -// map_noswiss.go for normal use via GOEXPERIMENT=noswissmap). +// compatibility with existing //go:linkname use in the ecosystem. // linknameIter is the it argument to mapiterinit and mapiternext. // @@ -27,7 +24,7 @@ import ( // type hiter struct { // key unsafe.Pointer // elem unsafe.Pointer -// t *maptype +// t *maptype // old map abi.Type // h *hmap // buckets unsafe.Pointer // bptr *bmap @@ -64,7 +61,7 @@ type linknameIter struct { // Fields from hiter. key unsafe.Pointer elem unsafe.Pointer - typ *abi.SwissMapType + typ *abi.MapType // The real iterator. it *maps.Iter @@ -88,7 +85,7 @@ type linknameIter struct { // See go.dev/issue/67401. // //go:linkname mapiterinit -func mapiterinit(t *abi.SwissMapType, m *maps.Map, it *linknameIter) { +func mapiterinit(t *abi.MapType, m *maps.Map, it *linknameIter) { if raceenabled && m != nil { callerpc := sys.GetCallerPC() racereadpc(unsafe.Pointer(m), callerpc, abi.FuncPCABIInternal(mapiterinit)) @@ -120,7 +117,7 @@ func mapiterinit(t *abi.SwissMapType, m *maps.Map, it *linknameIter) { // See go.dev/issue/67401. // //go:linkname reflect_mapiterinit reflect.mapiterinit -func reflect_mapiterinit(t *abi.SwissMapType, m *maps.Map, it *linknameIter) { +func reflect_mapiterinit(t *abi.MapType, m *maps.Map, it *linknameIter) { mapiterinit(t, m, it) } diff --git a/src/runtime/malloc.go b/src/runtime/malloc.go index bc7dab9d20..d21b2c49b5 100644 --- a/src/runtime/malloc.go +++ b/src/runtime/malloc.go @@ -102,6 +102,7 @@ package runtime import ( "internal/goarch" + "internal/goexperiment" "internal/goos" "internal/runtime/atomic" "internal/runtime/gc" @@ -345,6 +346,14 @@ const ( // metadata mappings back to the OS. That would be quite complex to do in general // as the heap is likely fragmented after a reduction in heap size. minHeapForMetadataHugePages = 1 << 30 + + // randomizeHeapBase indicates if the heap base address should be randomized. + // See comment in mallocinit for how the randomization is performed. + randomizeHeapBase = goexperiment.RandomizedHeapBase64 && goarch.PtrSize == 8 && !isSbrkPlatform + + // randHeapBasePrefixMask is used to extract the top byte of the randomized + // heap base address. + randHeapBasePrefixMask = ^uintptr(0xff << (heapAddrBits - 8)) ) // physPageSize is the size in bytes of the OS's physical pages. @@ -372,6 +381,24 @@ var ( physHugePageShift uint ) +var ( + // heapRandSeed is a random value that is populated in mallocinit if + // randomizeHeapBase is set. It is used in mallocinit, and mheap.grow, to + // randomize the base heap address. + heapRandSeed uintptr + heapRandSeedBitsRemaining int +) + +func nextHeapRandBits(bits int) uintptr { + if bits > heapRandSeedBitsRemaining { + throw("not enough heapRandSeed bits remaining") + } + r := heapRandSeed >> (64 - bits) + heapRandSeed <<= bits + heapRandSeedBitsRemaining -= bits + return r +} + func mallocinit() { if gc.SizeClassToSize[tinySizeClass] != maxTinySize { throw("bad TinySizeClass") @@ -517,6 +544,42 @@ func mallocinit() { // // In race mode we have no choice but to just use the same hints because // the race detector requires that the heap be mapped contiguously. + // + // If randomizeHeapBase is set, we attempt to randomize the base address + // as much as possible. We do this by generating a random uint64 via + // bootstrapRand and using it's bits to randomize portions of the base + // address as follows: + // * We first generate a random heapArenaBytes aligned address that we use for + // generating the hints. + // * On the first call to mheap.grow, we then generate a random PallocChunkBytes + // aligned offset into the mmap'd heap region, which we use as the base for + // the heap region. + // * We then select a page offset in that PallocChunkBytes region to start the + // heap at, and mark all the pages up to that offset as allocated. + // + // Our final randomized "heap base address" becomes the first byte of + // the first available page returned by the page allocator. This results + // in an address with at least heapAddrBits-gc.PageShift-2-(1*goarch.IsAmd64) + // bits of entropy. + + var randHeapBase uintptr + var randHeapBasePrefix byte + // heapAddrBits is 48 on most platforms, but we only use 47 of those + // bits in order to provide a good amount of room for the heap to grow + // contiguously. On amd64, there are 48 bits, but the top bit is sign + // extended, so we throw away another bit, just to be safe. + randHeapAddrBits := heapAddrBits - 1 - (goarch.IsAmd64 * 1) + if randomizeHeapBase { + // Generate a random value, and take the bottom heapAddrBits-logHeapArenaBytes + // bits, using them as the top bits for randHeapBase. + heapRandSeed, heapRandSeedBitsRemaining = uintptr(bootstrapRand()), 64 + + topBits := (randHeapAddrBits - logHeapArenaBytes) + randHeapBase = nextHeapRandBits(topBits) << (randHeapAddrBits - topBits) + randHeapBase = alignUp(randHeapBase, heapArenaBytes) + randHeapBasePrefix = byte(randHeapBase >> (randHeapAddrBits - 8)) + } + for i := 0x7f; i >= 0; i-- { var p uintptr switch { @@ -528,6 +591,9 @@ func mallocinit() { if p >= uintptrMask&0x00e000000000 { continue } + case randomizeHeapBase: + prefix := uintptr(randHeapBasePrefix+byte(i)) << (randHeapAddrBits - 8) + p = prefix | (randHeapBase & randHeapBasePrefixMask) case GOARCH == "arm64" && GOOS == "ios": p = uintptr(i)<<40 | uintptrMask&(0x0013<<28) case GOARCH == "arm64": diff --git a/src/runtime/map_swiss.go b/src/runtime/map.go index c2cf08fcaa..4a0713cfc4 100644 --- a/src/runtime/map_swiss.go +++ b/src/runtime/map.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.swissmap - package runtime import ( @@ -19,12 +17,10 @@ const ( loadFactorDen = 8 ) -type maptype = abi.SwissMapType - //go:linkname maps_errNilAssign internal/runtime/maps.errNilAssign var maps_errNilAssign error = plainError("assignment to entry in nil map") -func makemap64(t *abi.SwissMapType, hint int64, m *maps.Map) *maps.Map { +func makemap64(t *abi.MapType, hint int64, m *maps.Map) *maps.Map { if int64(int(hint)) != hint { hint = 0 } @@ -32,7 +28,7 @@ func makemap64(t *abi.SwissMapType, hint int64, m *maps.Map) *maps.Map { } // makemap_small implements Go map creation for make(map[k]v) and -// make(map[k]v, hint) when hint is known to be at most abi.SwissMapGroupSlots +// make(map[k]v, hint) when hint is known to be at most abi.MapGroupSlots // at compile time and the map needs to be allocated on the heap. // // makemap_small should be an internal detail, @@ -63,7 +59,7 @@ func makemap_small() *maps.Map { // See go.dev/issue/67401. // //go:linkname makemap -func makemap(t *abi.SwissMapType, hint int, m *maps.Map) *maps.Map { +func makemap(t *abi.MapType, hint int, m *maps.Map) *maps.Map { if hint < 0 { hint = 0 } @@ -81,7 +77,7 @@ func makemap(t *abi.SwissMapType, hint int, m *maps.Map) *maps.Map { // we want to avoid one layer of call. // //go:linkname mapaccess1 -func mapaccess1(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) unsafe.Pointer +func mapaccess1(t *abi.MapType, m *maps.Map, key unsafe.Pointer) unsafe.Pointer // mapaccess2 should be an internal detail, // but widely used packages access it using linkname. @@ -92,9 +88,9 @@ func mapaccess1(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) unsafe.Poi // See go.dev/issue/67401. // //go:linkname mapaccess2 -func mapaccess2(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) (unsafe.Pointer, bool) +func mapaccess2(t *abi.MapType, m *maps.Map, key unsafe.Pointer) (unsafe.Pointer, bool) -func mapaccess1_fat(t *abi.SwissMapType, m *maps.Map, key, zero unsafe.Pointer) unsafe.Pointer { +func mapaccess1_fat(t *abi.MapType, m *maps.Map, key, zero unsafe.Pointer) unsafe.Pointer { e := mapaccess1(t, m, key) if e == unsafe.Pointer(&zeroVal[0]) { return zero @@ -102,7 +98,7 @@ func mapaccess1_fat(t *abi.SwissMapType, m *maps.Map, key, zero unsafe.Pointer) return e } -func mapaccess2_fat(t *abi.SwissMapType, m *maps.Map, key, zero unsafe.Pointer) (unsafe.Pointer, bool) { +func mapaccess2_fat(t *abi.MapType, m *maps.Map, key, zero unsafe.Pointer) (unsafe.Pointer, bool) { e := mapaccess1(t, m, key) if e == unsafe.Pointer(&zeroVal[0]) { return zero, false @@ -125,7 +121,7 @@ func mapaccess2_fat(t *abi.SwissMapType, m *maps.Map, key, zero unsafe.Pointer) // See go.dev/issue/67401. // //go:linkname mapassign -func mapassign(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) unsafe.Pointer +func mapassign(t *abi.MapType, m *maps.Map, key unsafe.Pointer) unsafe.Pointer // mapdelete should be an internal detail, // but widely used packages access it using linkname. @@ -136,7 +132,7 @@ func mapassign(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) unsafe.Poin // See go.dev/issue/67401. // //go:linkname mapdelete -func mapdelete(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) { +func mapdelete(t *abi.MapType, m *maps.Map, key unsafe.Pointer) { if raceenabled && m != nil { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(mapdelete) @@ -157,7 +153,7 @@ func mapdelete(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) { // performs the first step of iteration. The Iter struct pointed to by 'it' is // allocated on the stack by the compilers order pass or on the heap by // reflect. Both need to have zeroed it since the struct contains pointers. -func mapIterStart(t *abi.SwissMapType, m *maps.Map, it *maps.Iter) { +func mapIterStart(t *abi.MapType, m *maps.Map, it *maps.Iter) { if raceenabled && m != nil { callerpc := sys.GetCallerPC() racereadpc(unsafe.Pointer(m), callerpc, abi.FuncPCABIInternal(mapIterStart)) @@ -179,7 +175,7 @@ func mapIterNext(it *maps.Iter) { } // mapclear deletes all keys from a map. -func mapclear(t *abi.SwissMapType, m *maps.Map) { +func mapclear(t *abi.MapType, m *maps.Map) { if raceenabled && m != nil { callerpc := sys.GetCallerPC() pc := abi.FuncPCABIInternal(mapclear) @@ -205,7 +201,7 @@ func mapclear(t *abi.SwissMapType, m *maps.Map) { // See go.dev/issue/67401. // //go:linkname reflect_makemap reflect.makemap -func reflect_makemap(t *abi.SwissMapType, cap int) *maps.Map { +func reflect_makemap(t *abi.MapType, cap int) *maps.Map { // Check invariants and reflects math. if t.Key.Equal == nil { throw("runtime.reflect_makemap: unsupported map key type") @@ -226,7 +222,7 @@ func reflect_makemap(t *abi.SwissMapType, cap int) *maps.Map { // See go.dev/issue/67401. // //go:linkname reflect_mapaccess reflect.mapaccess -func reflect_mapaccess(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) unsafe.Pointer { +func reflect_mapaccess(t *abi.MapType, m *maps.Map, key unsafe.Pointer) unsafe.Pointer { elem, ok := mapaccess2(t, m, key) if !ok { // reflect wants nil for a missing element @@ -236,7 +232,7 @@ func reflect_mapaccess(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) uns } //go:linkname reflect_mapaccess_faststr reflect.mapaccess_faststr -func reflect_mapaccess_faststr(t *abi.SwissMapType, m *maps.Map, key string) unsafe.Pointer { +func reflect_mapaccess_faststr(t *abi.MapType, m *maps.Map, key string) unsafe.Pointer { elem, ok := mapaccess2_faststr(t, m, key) if !ok { // reflect wants nil for a missing element @@ -254,24 +250,24 @@ func reflect_mapaccess_faststr(t *abi.SwissMapType, m *maps.Map, key string) uns // Do not remove or change the type signature. // //go:linkname reflect_mapassign reflect.mapassign0 -func reflect_mapassign(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer, elem unsafe.Pointer) { +func reflect_mapassign(t *abi.MapType, m *maps.Map, key unsafe.Pointer, elem unsafe.Pointer) { p := mapassign(t, m, key) typedmemmove(t.Elem, p, elem) } //go:linkname reflect_mapassign_faststr reflect.mapassign_faststr0 -func reflect_mapassign_faststr(t *abi.SwissMapType, m *maps.Map, key string, elem unsafe.Pointer) { +func reflect_mapassign_faststr(t *abi.MapType, m *maps.Map, key string, elem unsafe.Pointer) { p := mapassign_faststr(t, m, key) typedmemmove(t.Elem, p, elem) } //go:linkname reflect_mapdelete reflect.mapdelete -func reflect_mapdelete(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) { +func reflect_mapdelete(t *abi.MapType, m *maps.Map, key unsafe.Pointer) { mapdelete(t, m, key) } //go:linkname reflect_mapdelete_faststr reflect.mapdelete_faststr -func reflect_mapdelete_faststr(t *abi.SwissMapType, m *maps.Map, key string) { +func reflect_mapdelete_faststr(t *abi.MapType, m *maps.Map, key string) { mapdelete_faststr(t, m, key) } @@ -297,7 +293,7 @@ func reflect_maplen(m *maps.Map) int { } //go:linkname reflect_mapclear reflect.mapclear -func reflect_mapclear(t *abi.SwissMapType, m *maps.Map) { +func reflect_mapclear(t *abi.MapType, m *maps.Map) { mapclear(t, m) } @@ -325,25 +321,9 @@ func mapinitnoop() //go:linkname mapclone maps.clone func mapclone(m any) any { e := efaceOf(&m) - typ := (*abi.SwissMapType)(unsafe.Pointer(e._type)) + typ := (*abi.MapType)(unsafe.Pointer(e._type)) map_ := (*maps.Map)(e.data) map_ = map_.Clone(typ) e.data = (unsafe.Pointer)(map_) return m } - -// keys for implementing maps.keys -// -//go:linkname keys maps.keys -func keys(m any, p unsafe.Pointer) { - // Currently unused in the maps package. - panic("unimplemented") -} - -// values for implementing maps.values -// -//go:linkname values maps.values -func values(m any, p unsafe.Pointer) { - // Currently unused in the maps package. - panic("unimplemented") -} diff --git a/src/runtime/map_fast32_swiss.go b/src/runtime/map_fast32.go index 0a241d3793..17b4c31d02 100644 --- a/src/runtime/map_fast32_swiss.go +++ b/src/runtime/map_fast32.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.swissmap - package runtime import ( @@ -15,7 +13,7 @@ import ( // Functions below pushed from internal/runtime/maps. //go:linkname mapaccess1_fast32 -func mapaccess1_fast32(t *abi.SwissMapType, m *maps.Map, key uint32) unsafe.Pointer +func mapaccess1_fast32(t *abi.MapType, m *maps.Map, key uint32) unsafe.Pointer // mapaccess2_fast32 should be an internal detail, // but widely used packages access it using linkname. @@ -26,7 +24,7 @@ func mapaccess1_fast32(t *abi.SwissMapType, m *maps.Map, key uint32) unsafe.Poin // See go.dev/issue/67401. // //go:linkname mapaccess2_fast32 -func mapaccess2_fast32(t *abi.SwissMapType, m *maps.Map, key uint32) (unsafe.Pointer, bool) +func mapaccess2_fast32(t *abi.MapType, m *maps.Map, key uint32) (unsafe.Pointer, bool) // mapassign_fast32 should be an internal detail, // but widely used packages access it using linkname. @@ -38,7 +36,7 @@ func mapaccess2_fast32(t *abi.SwissMapType, m *maps.Map, key uint32) (unsafe.Poi // See go.dev/issue/67401. // //go:linkname mapassign_fast32 -func mapassign_fast32(t *abi.SwissMapType, m *maps.Map, key uint32) unsafe.Pointer +func mapassign_fast32(t *abi.MapType, m *maps.Map, key uint32) unsafe.Pointer // mapassign_fast32ptr should be an internal detail, // but widely used packages access it using linkname. @@ -49,7 +47,7 @@ func mapassign_fast32(t *abi.SwissMapType, m *maps.Map, key uint32) unsafe.Point // See go.dev/issue/67401. // //go:linkname mapassign_fast32ptr -func mapassign_fast32ptr(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) unsafe.Pointer +func mapassign_fast32ptr(t *abi.MapType, m *maps.Map, key unsafe.Pointer) unsafe.Pointer //go:linkname mapdelete_fast32 -func mapdelete_fast32(t *abi.SwissMapType, m *maps.Map, key uint32) +func mapdelete_fast32(t *abi.MapType, m *maps.Map, key uint32) diff --git a/src/runtime/map_fast32_noswiss.go b/src/runtime/map_fast32_noswiss.go deleted file mode 100644 index 751717b6cd..0000000000 --- a/src/runtime/map_fast32_noswiss.go +++ /dev/null @@ -1,493 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -package runtime - -import ( - "internal/abi" - "internal/goarch" - "internal/runtime/sys" - "unsafe" -) - -func mapaccess1_fast32(t *maptype, h *hmap, key uint32) unsafe.Pointer { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - racereadpc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapaccess1_fast32)) - } - if h == nil || h.count == 0 { - return unsafe.Pointer(&zeroVal[0]) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map read and map write") - } - var b *bmap - if h.B == 0 { - // One-bucket table. No need to hash. - b = (*bmap)(h.buckets) - } else { - hash := t.Hasher(noescape(unsafe.Pointer(&key)), uintptr(h.hash0)) - m := bucketMask(h.B) - b = (*bmap)(add(h.buckets, (hash&m)*uintptr(t.BucketSize))) - if c := h.oldbuckets; c != nil { - if !h.sameSizeGrow() { - // There used to be half as many buckets; mask down one more power of two. - m >>= 1 - } - oldb := (*bmap)(add(c, (hash&m)*uintptr(t.BucketSize))) - if !evacuated(oldb) { - b = oldb - } - } - } - for ; b != nil; b = b.overflow(t) { - for i, k := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, k = i+1, add(k, 4) { - if *(*uint32)(k) == key && !isEmpty(b.tophash[i]) { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*4+i*uintptr(t.ValueSize)) - } - } - } - return unsafe.Pointer(&zeroVal[0]) -} - -// mapaccess2_fast32 should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapaccess2_fast32 -func mapaccess2_fast32(t *maptype, h *hmap, key uint32) (unsafe.Pointer, bool) { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - racereadpc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapaccess2_fast32)) - } - if h == nil || h.count == 0 { - return unsafe.Pointer(&zeroVal[0]), false - } - if h.flags&hashWriting != 0 { - fatal("concurrent map read and map write") - } - var b *bmap - if h.B == 0 { - // One-bucket table. No need to hash. - b = (*bmap)(h.buckets) - } else { - hash := t.Hasher(noescape(unsafe.Pointer(&key)), uintptr(h.hash0)) - m := bucketMask(h.B) - b = (*bmap)(add(h.buckets, (hash&m)*uintptr(t.BucketSize))) - if c := h.oldbuckets; c != nil { - if !h.sameSizeGrow() { - // There used to be half as many buckets; mask down one more power of two. - m >>= 1 - } - oldb := (*bmap)(add(c, (hash&m)*uintptr(t.BucketSize))) - if !evacuated(oldb) { - b = oldb - } - } - } - for ; b != nil; b = b.overflow(t) { - for i, k := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, k = i+1, add(k, 4) { - if *(*uint32)(k) == key && !isEmpty(b.tophash[i]) { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*4+i*uintptr(t.ValueSize)), true - } - } - } - return unsafe.Pointer(&zeroVal[0]), false -} - -// mapassign_fast32 should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/bytedance/sonic -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapassign_fast32 -func mapassign_fast32(t *maptype, h *hmap, key uint32) unsafe.Pointer { - if h == nil { - panic(plainError("assignment to entry in nil map")) - } - if raceenabled { - callerpc := sys.GetCallerPC() - racewritepc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapassign_fast32)) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - hash := t.Hasher(noescape(unsafe.Pointer(&key)), uintptr(h.hash0)) - - // Set hashWriting after calling t.hasher for consistency with mapassign. - h.flags ^= hashWriting - - if h.buckets == nil { - h.buckets = newobject(t.Bucket) // newarray(t.bucket, 1) - } - -again: - bucket := hash & bucketMask(h.B) - if h.growing() { - growWork_fast32(t, h, bucket) - } - b := (*bmap)(add(h.buckets, bucket*uintptr(t.BucketSize))) - - var insertb *bmap - var inserti uintptr - var insertk unsafe.Pointer - -bucketloop: - for { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if isEmpty(b.tophash[i]) { - if insertb == nil { - inserti = i - insertb = b - } - if b.tophash[i] == emptyRest { - break bucketloop - } - continue - } - k := *((*uint32)(add(unsafe.Pointer(b), dataOffset+i*4))) - if k != key { - continue - } - inserti = i - insertb = b - goto done - } - ovf := b.overflow(t) - if ovf == nil { - break - } - b = ovf - } - - // Did not find mapping for key. Allocate new cell & add entry. - - // If we hit the max load factor or we have too many overflow buckets, - // and we're not already in the middle of growing, start growing. - if !h.growing() && (overLoadFactor(h.count+1, h.B) || tooManyOverflowBuckets(h.noverflow, h.B)) { - hashGrow(t, h) - goto again // Growing the table invalidates everything, so try again - } - - if insertb == nil { - // The current bucket and all the overflow buckets connected to it are full, allocate a new one. - insertb = h.newoverflow(t, b) - inserti = 0 // not necessary, but avoids needlessly spilling inserti - } - insertb.tophash[inserti&(abi.OldMapBucketCount-1)] = tophash(hash) // mask inserti to avoid bounds checks - - insertk = add(unsafe.Pointer(insertb), dataOffset+inserti*4) - // store new key at insert position - *(*uint32)(insertk) = key - - h.count++ - -done: - elem := add(unsafe.Pointer(insertb), dataOffset+abi.OldMapBucketCount*4+inserti*uintptr(t.ValueSize)) - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting - return elem -} - -// mapassign_fast32ptr should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapassign_fast32ptr -func mapassign_fast32ptr(t *maptype, h *hmap, key unsafe.Pointer) unsafe.Pointer { - if h == nil { - panic(plainError("assignment to entry in nil map")) - } - if raceenabled { - callerpc := sys.GetCallerPC() - racewritepc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapassign_fast32)) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - hash := t.Hasher(noescape(unsafe.Pointer(&key)), uintptr(h.hash0)) - - // Set hashWriting after calling t.hasher for consistency with mapassign. - h.flags ^= hashWriting - - if h.buckets == nil { - h.buckets = newobject(t.Bucket) // newarray(t.bucket, 1) - } - -again: - bucket := hash & bucketMask(h.B) - if h.growing() { - growWork_fast32(t, h, bucket) - } - b := (*bmap)(add(h.buckets, bucket*uintptr(t.BucketSize))) - - var insertb *bmap - var inserti uintptr - var insertk unsafe.Pointer - -bucketloop: - for { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if isEmpty(b.tophash[i]) { - if insertb == nil { - inserti = i - insertb = b - } - if b.tophash[i] == emptyRest { - break bucketloop - } - continue - } - k := *((*unsafe.Pointer)(add(unsafe.Pointer(b), dataOffset+i*4))) - if k != key { - continue - } - inserti = i - insertb = b - goto done - } - ovf := b.overflow(t) - if ovf == nil { - break - } - b = ovf - } - - // Did not find mapping for key. Allocate new cell & add entry. - - // If we hit the max load factor or we have too many overflow buckets, - // and we're not already in the middle of growing, start growing. - if !h.growing() && (overLoadFactor(h.count+1, h.B) || tooManyOverflowBuckets(h.noverflow, h.B)) { - hashGrow(t, h) - goto again // Growing the table invalidates everything, so try again - } - - if insertb == nil { - // The current bucket and all the overflow buckets connected to it are full, allocate a new one. - insertb = h.newoverflow(t, b) - inserti = 0 // not necessary, but avoids needlessly spilling inserti - } - insertb.tophash[inserti&(abi.OldMapBucketCount-1)] = tophash(hash) // mask inserti to avoid bounds checks - - insertk = add(unsafe.Pointer(insertb), dataOffset+inserti*4) - // store new key at insert position - *(*unsafe.Pointer)(insertk) = key - - h.count++ - -done: - elem := add(unsafe.Pointer(insertb), dataOffset+abi.OldMapBucketCount*4+inserti*uintptr(t.ValueSize)) - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting - return elem -} - -func mapdelete_fast32(t *maptype, h *hmap, key uint32) { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - racewritepc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapdelete_fast32)) - } - if h == nil || h.count == 0 { - return - } - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - - hash := t.Hasher(noescape(unsafe.Pointer(&key)), uintptr(h.hash0)) - - // Set hashWriting after calling t.hasher for consistency with mapdelete - h.flags ^= hashWriting - - bucket := hash & bucketMask(h.B) - if h.growing() { - growWork_fast32(t, h, bucket) - } - b := (*bmap)(add(h.buckets, bucket*uintptr(t.BucketSize))) - bOrig := b -search: - for ; b != nil; b = b.overflow(t) { - for i, k := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, k = i+1, add(k, 4) { - if key != *(*uint32)(k) || isEmpty(b.tophash[i]) { - continue - } - // Only clear key if there are pointers in it. - // This can only happen if pointers are 32 bit - // wide as 64 bit pointers do not fit into a 32 bit key. - if goarch.PtrSize == 4 && t.Key.Pointers() { - // The key must be a pointer as we checked pointers are - // 32 bits wide and the key is 32 bits wide also. - *(*unsafe.Pointer)(k) = nil - } - e := add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*4+i*uintptr(t.ValueSize)) - if t.Elem.Pointers() { - memclrHasPointers(e, t.Elem.Size_) - } else { - memclrNoHeapPointers(e, t.Elem.Size_) - } - b.tophash[i] = emptyOne - // If the bucket now ends in a bunch of emptyOne states, - // change those to emptyRest states. - if i == abi.OldMapBucketCount-1 { - if b.overflow(t) != nil && b.overflow(t).tophash[0] != emptyRest { - goto notLast - } - } else { - if b.tophash[i+1] != emptyRest { - goto notLast - } - } - for { - b.tophash[i] = emptyRest - if i == 0 { - if b == bOrig { - break // beginning of initial bucket, we're done. - } - // Find previous bucket, continue at its last entry. - c := b - for b = bOrig; b.overflow(t) != c; b = b.overflow(t) { - } - i = abi.OldMapBucketCount - 1 - } else { - i-- - } - if b.tophash[i] != emptyOne { - break - } - } - notLast: - h.count-- - // Reset the hash seed to make it more difficult for attackers to - // repeatedly trigger hash collisions. See issue 25237. - if h.count == 0 { - h.hash0 = uint32(rand()) - } - break search - } - } - - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting -} - -func growWork_fast32(t *maptype, h *hmap, bucket uintptr) { - // make sure we evacuate the oldbucket corresponding - // to the bucket we're about to use - evacuate_fast32(t, h, bucket&h.oldbucketmask()) - - // evacuate one more oldbucket to make progress on growing - if h.growing() { - evacuate_fast32(t, h, h.nevacuate) - } -} - -func evacuate_fast32(t *maptype, h *hmap, oldbucket uintptr) { - b := (*bmap)(add(h.oldbuckets, oldbucket*uintptr(t.BucketSize))) - newbit := h.noldbuckets() - if !evacuated(b) { - // TODO: reuse overflow buckets instead of using new ones, if there - // is no iterator using the old buckets. (If !oldIterator.) - - // xy contains the x and y (low and high) evacuation destinations. - var xy [2]evacDst - x := &xy[0] - x.b = (*bmap)(add(h.buckets, oldbucket*uintptr(t.BucketSize))) - x.k = add(unsafe.Pointer(x.b), dataOffset) - x.e = add(x.k, abi.OldMapBucketCount*4) - - if !h.sameSizeGrow() { - // Only calculate y pointers if we're growing bigger. - // Otherwise GC can see bad pointers. - y := &xy[1] - y.b = (*bmap)(add(h.buckets, (oldbucket+newbit)*uintptr(t.BucketSize))) - y.k = add(unsafe.Pointer(y.b), dataOffset) - y.e = add(y.k, abi.OldMapBucketCount*4) - } - - for ; b != nil; b = b.overflow(t) { - k := add(unsafe.Pointer(b), dataOffset) - e := add(k, abi.OldMapBucketCount*4) - for i := 0; i < abi.OldMapBucketCount; i, k, e = i+1, add(k, 4), add(e, uintptr(t.ValueSize)) { - top := b.tophash[i] - if isEmpty(top) { - b.tophash[i] = evacuatedEmpty - continue - } - if top < minTopHash { - throw("bad map state") - } - var useY uint8 - if !h.sameSizeGrow() { - // Compute hash to make our evacuation decision (whether we need - // to send this key/elem to bucket x or bucket y). - hash := t.Hasher(k, uintptr(h.hash0)) - if hash&newbit != 0 { - useY = 1 - } - } - - b.tophash[i] = evacuatedX + useY // evacuatedX + 1 == evacuatedY, enforced in makemap - dst := &xy[useY] // evacuation destination - - if dst.i == abi.OldMapBucketCount { - dst.b = h.newoverflow(t, dst.b) - dst.i = 0 - dst.k = add(unsafe.Pointer(dst.b), dataOffset) - dst.e = add(dst.k, abi.OldMapBucketCount*4) - } - dst.b.tophash[dst.i&(abi.OldMapBucketCount-1)] = top // mask dst.i as an optimization, to avoid a bounds check - - // Copy key. - if goarch.PtrSize == 4 && t.Key.Pointers() && writeBarrier.enabled { - // Write with a write barrier. - *(*unsafe.Pointer)(dst.k) = *(*unsafe.Pointer)(k) - } else { - *(*uint32)(dst.k) = *(*uint32)(k) - } - - typedmemmove(t.Elem, dst.e, e) - dst.i++ - // These updates might push these pointers past the end of the - // key or elem arrays. That's ok, as we have the overflow pointer - // at the end of the bucket to protect against pointing past the - // end of the bucket. - dst.k = add(dst.k, 4) - dst.e = add(dst.e, uintptr(t.ValueSize)) - } - } - // Unlink the overflow buckets & clear key/elem to help GC. - if h.flags&oldIterator == 0 && t.Bucket.Pointers() { - b := add(h.oldbuckets, oldbucket*uintptr(t.BucketSize)) - // Preserve b.tophash because the evacuation - // state is maintained there. - ptr := add(b, dataOffset) - n := uintptr(t.BucketSize) - dataOffset - memclrHasPointers(ptr, n) - } - } - - if oldbucket == h.nevacuate { - advanceEvacuationMark(h, t, newbit) - } -} diff --git a/src/runtime/map_fast64_swiss.go b/src/runtime/map_fast64.go index 8b7fcf88e8..8640acf6a6 100644 --- a/src/runtime/map_fast64_swiss.go +++ b/src/runtime/map_fast64.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.swissmap - package runtime import ( @@ -15,7 +13,7 @@ import ( // Functions below pushed from internal/runtime/maps. //go:linkname mapaccess1_fast64 -func mapaccess1_fast64(t *abi.SwissMapType, m *maps.Map, key uint64) unsafe.Pointer +func mapaccess1_fast64(t *abi.MapType, m *maps.Map, key uint64) unsafe.Pointer // mapaccess2_fast64 should be an internal detail, // but widely used packages access it using linkname. @@ -26,7 +24,7 @@ func mapaccess1_fast64(t *abi.SwissMapType, m *maps.Map, key uint64) unsafe.Poin // See go.dev/issue/67401. // //go:linkname mapaccess2_fast64 -func mapaccess2_fast64(t *abi.SwissMapType, m *maps.Map, key uint64) (unsafe.Pointer, bool) +func mapaccess2_fast64(t *abi.MapType, m *maps.Map, key uint64) (unsafe.Pointer, bool) // mapassign_fast64 should be an internal detail, // but widely used packages access it using linkname. @@ -38,7 +36,7 @@ func mapaccess2_fast64(t *abi.SwissMapType, m *maps.Map, key uint64) (unsafe.Poi // See go.dev/issue/67401. // //go:linkname mapassign_fast64 -func mapassign_fast64(t *abi.SwissMapType, m *maps.Map, key uint64) unsafe.Pointer +func mapassign_fast64(t *abi.MapType, m *maps.Map, key uint64) unsafe.Pointer // mapassign_fast64ptr should be an internal detail, // but widely used packages access it using linkname. @@ -50,7 +48,7 @@ func mapassign_fast64(t *abi.SwissMapType, m *maps.Map, key uint64) unsafe.Point // See go.dev/issue/67401. // //go:linkname mapassign_fast64ptr -func mapassign_fast64ptr(t *abi.SwissMapType, m *maps.Map, key unsafe.Pointer) unsafe.Pointer +func mapassign_fast64ptr(t *abi.MapType, m *maps.Map, key unsafe.Pointer) unsafe.Pointer //go:linkname mapdelete_fast64 -func mapdelete_fast64(t *abi.SwissMapType, m *maps.Map, key uint64) +func mapdelete_fast64(t *abi.MapType, m *maps.Map, key uint64) diff --git a/src/runtime/map_fast64_noswiss.go b/src/runtime/map_fast64_noswiss.go deleted file mode 100644 index abb272d2b6..0000000000 --- a/src/runtime/map_fast64_noswiss.go +++ /dev/null @@ -1,502 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -package runtime - -import ( - "internal/abi" - "internal/goarch" - "internal/runtime/sys" - "unsafe" -) - -func mapaccess1_fast64(t *maptype, h *hmap, key uint64) unsafe.Pointer { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - racereadpc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapaccess1_fast64)) - } - if h == nil || h.count == 0 { - return unsafe.Pointer(&zeroVal[0]) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map read and map write") - } - var b *bmap - if h.B == 0 { - // One-bucket table. No need to hash. - b = (*bmap)(h.buckets) - } else { - hash := t.Hasher(noescape(unsafe.Pointer(&key)), uintptr(h.hash0)) - m := bucketMask(h.B) - b = (*bmap)(add(h.buckets, (hash&m)*uintptr(t.BucketSize))) - if c := h.oldbuckets; c != nil { - if !h.sameSizeGrow() { - // There used to be half as many buckets; mask down one more power of two. - m >>= 1 - } - oldb := (*bmap)(add(c, (hash&m)*uintptr(t.BucketSize))) - if !evacuated(oldb) { - b = oldb - } - } - } - for ; b != nil; b = b.overflow(t) { - for i, k := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, k = i+1, add(k, 8) { - if *(*uint64)(k) == key && !isEmpty(b.tophash[i]) { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*8+i*uintptr(t.ValueSize)) - } - } - } - return unsafe.Pointer(&zeroVal[0]) -} - -// mapaccess2_fast64 should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapaccess2_fast64 -func mapaccess2_fast64(t *maptype, h *hmap, key uint64) (unsafe.Pointer, bool) { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - racereadpc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapaccess2_fast64)) - } - if h == nil || h.count == 0 { - return unsafe.Pointer(&zeroVal[0]), false - } - if h.flags&hashWriting != 0 { - fatal("concurrent map read and map write") - } - var b *bmap - if h.B == 0 { - // One-bucket table. No need to hash. - b = (*bmap)(h.buckets) - } else { - hash := t.Hasher(noescape(unsafe.Pointer(&key)), uintptr(h.hash0)) - m := bucketMask(h.B) - b = (*bmap)(add(h.buckets, (hash&m)*uintptr(t.BucketSize))) - if c := h.oldbuckets; c != nil { - if !h.sameSizeGrow() { - // There used to be half as many buckets; mask down one more power of two. - m >>= 1 - } - oldb := (*bmap)(add(c, (hash&m)*uintptr(t.BucketSize))) - if !evacuated(oldb) { - b = oldb - } - } - } - for ; b != nil; b = b.overflow(t) { - for i, k := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, k = i+1, add(k, 8) { - if *(*uint64)(k) == key && !isEmpty(b.tophash[i]) { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*8+i*uintptr(t.ValueSize)), true - } - } - } - return unsafe.Pointer(&zeroVal[0]), false -} - -// mapassign_fast64 should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/bytedance/sonic -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapassign_fast64 -func mapassign_fast64(t *maptype, h *hmap, key uint64) unsafe.Pointer { - if h == nil { - panic(plainError("assignment to entry in nil map")) - } - if raceenabled { - callerpc := sys.GetCallerPC() - racewritepc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapassign_fast64)) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - hash := t.Hasher(noescape(unsafe.Pointer(&key)), uintptr(h.hash0)) - - // Set hashWriting after calling t.hasher for consistency with mapassign. - h.flags ^= hashWriting - - if h.buckets == nil { - h.buckets = newobject(t.Bucket) // newarray(t.bucket, 1) - } - -again: - bucket := hash & bucketMask(h.B) - if h.growing() { - growWork_fast64(t, h, bucket) - } - b := (*bmap)(add(h.buckets, bucket*uintptr(t.BucketSize))) - - var insertb *bmap - var inserti uintptr - var insertk unsafe.Pointer - -bucketloop: - for { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if isEmpty(b.tophash[i]) { - if insertb == nil { - insertb = b - inserti = i - } - if b.tophash[i] == emptyRest { - break bucketloop - } - continue - } - k := *((*uint64)(add(unsafe.Pointer(b), dataOffset+i*8))) - if k != key { - continue - } - insertb = b - inserti = i - goto done - } - ovf := b.overflow(t) - if ovf == nil { - break - } - b = ovf - } - - // Did not find mapping for key. Allocate new cell & add entry. - - // If we hit the max load factor or we have too many overflow buckets, - // and we're not already in the middle of growing, start growing. - if !h.growing() && (overLoadFactor(h.count+1, h.B) || tooManyOverflowBuckets(h.noverflow, h.B)) { - hashGrow(t, h) - goto again // Growing the table invalidates everything, so try again - } - - if insertb == nil { - // The current bucket and all the overflow buckets connected to it are full, allocate a new one. - insertb = h.newoverflow(t, b) - inserti = 0 // not necessary, but avoids needlessly spilling inserti - } - insertb.tophash[inserti&(abi.OldMapBucketCount-1)] = tophash(hash) // mask inserti to avoid bounds checks - - insertk = add(unsafe.Pointer(insertb), dataOffset+inserti*8) - // store new key at insert position - *(*uint64)(insertk) = key - - h.count++ - -done: - elem := add(unsafe.Pointer(insertb), dataOffset+abi.OldMapBucketCount*8+inserti*uintptr(t.ValueSize)) - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting - return elem -} - -// mapassign_fast64ptr should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/bytedance/sonic -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapassign_fast64ptr -func mapassign_fast64ptr(t *maptype, h *hmap, key unsafe.Pointer) unsafe.Pointer { - if h == nil { - panic(plainError("assignment to entry in nil map")) - } - if raceenabled { - callerpc := sys.GetCallerPC() - racewritepc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapassign_fast64)) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - hash := t.Hasher(noescape(unsafe.Pointer(&key)), uintptr(h.hash0)) - - // Set hashWriting after calling t.hasher for consistency with mapassign. - h.flags ^= hashWriting - - if h.buckets == nil { - h.buckets = newobject(t.Bucket) // newarray(t.bucket, 1) - } - -again: - bucket := hash & bucketMask(h.B) - if h.growing() { - growWork_fast64(t, h, bucket) - } - b := (*bmap)(add(h.buckets, bucket*uintptr(t.BucketSize))) - - var insertb *bmap - var inserti uintptr - var insertk unsafe.Pointer - -bucketloop: - for { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if isEmpty(b.tophash[i]) { - if insertb == nil { - insertb = b - inserti = i - } - if b.tophash[i] == emptyRest { - break bucketloop - } - continue - } - k := *((*unsafe.Pointer)(add(unsafe.Pointer(b), dataOffset+i*8))) - if k != key { - continue - } - insertb = b - inserti = i - goto done - } - ovf := b.overflow(t) - if ovf == nil { - break - } - b = ovf - } - - // Did not find mapping for key. Allocate new cell & add entry. - - // If we hit the max load factor or we have too many overflow buckets, - // and we're not already in the middle of growing, start growing. - if !h.growing() && (overLoadFactor(h.count+1, h.B) || tooManyOverflowBuckets(h.noverflow, h.B)) { - hashGrow(t, h) - goto again // Growing the table invalidates everything, so try again - } - - if insertb == nil { - // The current bucket and all the overflow buckets connected to it are full, allocate a new one. - insertb = h.newoverflow(t, b) - inserti = 0 // not necessary, but avoids needlessly spilling inserti - } - insertb.tophash[inserti&(abi.OldMapBucketCount-1)] = tophash(hash) // mask inserti to avoid bounds checks - - insertk = add(unsafe.Pointer(insertb), dataOffset+inserti*8) - // store new key at insert position - *(*unsafe.Pointer)(insertk) = key - - h.count++ - -done: - elem := add(unsafe.Pointer(insertb), dataOffset+abi.OldMapBucketCount*8+inserti*uintptr(t.ValueSize)) - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting - return elem -} - -func mapdelete_fast64(t *maptype, h *hmap, key uint64) { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - racewritepc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapdelete_fast64)) - } - if h == nil || h.count == 0 { - return - } - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - - hash := t.Hasher(noescape(unsafe.Pointer(&key)), uintptr(h.hash0)) - - // Set hashWriting after calling t.hasher for consistency with mapdelete - h.flags ^= hashWriting - - bucket := hash & bucketMask(h.B) - if h.growing() { - growWork_fast64(t, h, bucket) - } - b := (*bmap)(add(h.buckets, bucket*uintptr(t.BucketSize))) - bOrig := b -search: - for ; b != nil; b = b.overflow(t) { - for i, k := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, k = i+1, add(k, 8) { - if key != *(*uint64)(k) || isEmpty(b.tophash[i]) { - continue - } - // Only clear key if there are pointers in it. - if t.Key.Pointers() { - if goarch.PtrSize == 8 { - *(*unsafe.Pointer)(k) = nil - } else { - // There are three ways to squeeze at one or more 32 bit pointers into 64 bits. - // Just call memclrHasPointers instead of trying to handle all cases here. - memclrHasPointers(k, 8) - } - } - e := add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*8+i*uintptr(t.ValueSize)) - if t.Elem.Pointers() { - memclrHasPointers(e, t.Elem.Size_) - } else { - memclrNoHeapPointers(e, t.Elem.Size_) - } - b.tophash[i] = emptyOne - // If the bucket now ends in a bunch of emptyOne states, - // change those to emptyRest states. - if i == abi.OldMapBucketCount-1 { - if b.overflow(t) != nil && b.overflow(t).tophash[0] != emptyRest { - goto notLast - } - } else { - if b.tophash[i+1] != emptyRest { - goto notLast - } - } - for { - b.tophash[i] = emptyRest - if i == 0 { - if b == bOrig { - break // beginning of initial bucket, we're done. - } - // Find previous bucket, continue at its last entry. - c := b - for b = bOrig; b.overflow(t) != c; b = b.overflow(t) { - } - i = abi.OldMapBucketCount - 1 - } else { - i-- - } - if b.tophash[i] != emptyOne { - break - } - } - notLast: - h.count-- - // Reset the hash seed to make it more difficult for attackers to - // repeatedly trigger hash collisions. See issue 25237. - if h.count == 0 { - h.hash0 = uint32(rand()) - } - break search - } - } - - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting -} - -func growWork_fast64(t *maptype, h *hmap, bucket uintptr) { - // make sure we evacuate the oldbucket corresponding - // to the bucket we're about to use - evacuate_fast64(t, h, bucket&h.oldbucketmask()) - - // evacuate one more oldbucket to make progress on growing - if h.growing() { - evacuate_fast64(t, h, h.nevacuate) - } -} - -func evacuate_fast64(t *maptype, h *hmap, oldbucket uintptr) { - b := (*bmap)(add(h.oldbuckets, oldbucket*uintptr(t.BucketSize))) - newbit := h.noldbuckets() - if !evacuated(b) { - // TODO: reuse overflow buckets instead of using new ones, if there - // is no iterator using the old buckets. (If !oldIterator.) - - // xy contains the x and y (low and high) evacuation destinations. - var xy [2]evacDst - x := &xy[0] - x.b = (*bmap)(add(h.buckets, oldbucket*uintptr(t.BucketSize))) - x.k = add(unsafe.Pointer(x.b), dataOffset) - x.e = add(x.k, abi.OldMapBucketCount*8) - - if !h.sameSizeGrow() { - // Only calculate y pointers if we're growing bigger. - // Otherwise GC can see bad pointers. - y := &xy[1] - y.b = (*bmap)(add(h.buckets, (oldbucket+newbit)*uintptr(t.BucketSize))) - y.k = add(unsafe.Pointer(y.b), dataOffset) - y.e = add(y.k, abi.OldMapBucketCount*8) - } - - for ; b != nil; b = b.overflow(t) { - k := add(unsafe.Pointer(b), dataOffset) - e := add(k, abi.OldMapBucketCount*8) - for i := 0; i < abi.OldMapBucketCount; i, k, e = i+1, add(k, 8), add(e, uintptr(t.ValueSize)) { - top := b.tophash[i] - if isEmpty(top) { - b.tophash[i] = evacuatedEmpty - continue - } - if top < minTopHash { - throw("bad map state") - } - var useY uint8 - if !h.sameSizeGrow() { - // Compute hash to make our evacuation decision (whether we need - // to send this key/elem to bucket x or bucket y). - hash := t.Hasher(k, uintptr(h.hash0)) - if hash&newbit != 0 { - useY = 1 - } - } - - b.tophash[i] = evacuatedX + useY // evacuatedX + 1 == evacuatedY, enforced in makemap - dst := &xy[useY] // evacuation destination - - if dst.i == abi.OldMapBucketCount { - dst.b = h.newoverflow(t, dst.b) - dst.i = 0 - dst.k = add(unsafe.Pointer(dst.b), dataOffset) - dst.e = add(dst.k, abi.OldMapBucketCount*8) - } - dst.b.tophash[dst.i&(abi.OldMapBucketCount-1)] = top // mask dst.i as an optimization, to avoid a bounds check - - // Copy key. - if t.Key.Pointers() && writeBarrier.enabled { - if goarch.PtrSize == 8 { - // Write with a write barrier. - *(*unsafe.Pointer)(dst.k) = *(*unsafe.Pointer)(k) - } else { - // There are three ways to squeeze at least one 32 bit pointer into 64 bits. - // Give up and call typedmemmove. - typedmemmove(t.Key, dst.k, k) - } - } else { - *(*uint64)(dst.k) = *(*uint64)(k) - } - - typedmemmove(t.Elem, dst.e, e) - dst.i++ - // These updates might push these pointers past the end of the - // key or elem arrays. That's ok, as we have the overflow pointer - // at the end of the bucket to protect against pointing past the - // end of the bucket. - dst.k = add(dst.k, 8) - dst.e = add(dst.e, uintptr(t.ValueSize)) - } - } - // Unlink the overflow buckets & clear key/elem to help GC. - if h.flags&oldIterator == 0 && t.Bucket.Pointers() { - b := add(h.oldbuckets, oldbucket*uintptr(t.BucketSize)) - // Preserve b.tophash because the evacuation - // state is maintained there. - ptr := add(b, dataOffset) - n := uintptr(t.BucketSize) - dataOffset - memclrHasPointers(ptr, n) - } - } - - if oldbucket == h.nevacuate { - advanceEvacuationMark(h, t, newbit) - } -} diff --git a/src/runtime/map_faststr_swiss.go b/src/runtime/map_faststr.go index 23f6c1e810..5a7b52d037 100644 --- a/src/runtime/map_faststr_swiss.go +++ b/src/runtime/map_faststr.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.swissmap - package runtime import ( @@ -15,7 +13,7 @@ import ( // Functions below pushed from internal/runtime/maps. //go:linkname mapaccess1_faststr -func mapaccess1_faststr(t *abi.SwissMapType, m *maps.Map, ky string) unsafe.Pointer +func mapaccess1_faststr(t *abi.MapType, m *maps.Map, ky string) unsafe.Pointer // mapaccess2_faststr should be an internal detail, // but widely used packages access it using linkname. @@ -26,7 +24,7 @@ func mapaccess1_faststr(t *abi.SwissMapType, m *maps.Map, ky string) unsafe.Poin // See go.dev/issue/67401. // //go:linkname mapaccess2_faststr -func mapaccess2_faststr(t *abi.SwissMapType, m *maps.Map, ky string) (unsafe.Pointer, bool) +func mapaccess2_faststr(t *abi.MapType, m *maps.Map, ky string) (unsafe.Pointer, bool) // mapassign_faststr should be an internal detail, // but widely used packages access it using linkname. @@ -38,7 +36,7 @@ func mapaccess2_faststr(t *abi.SwissMapType, m *maps.Map, ky string) (unsafe.Poi // See go.dev/issue/67401. // //go:linkname mapassign_faststr -func mapassign_faststr(t *abi.SwissMapType, m *maps.Map, s string) unsafe.Pointer +func mapassign_faststr(t *abi.MapType, m *maps.Map, s string) unsafe.Pointer //go:linkname mapdelete_faststr -func mapdelete_faststr(t *abi.SwissMapType, m *maps.Map, ky string) +func mapdelete_faststr(t *abi.MapType, m *maps.Map, ky string) diff --git a/src/runtime/map_faststr_noswiss.go b/src/runtime/map_faststr_noswiss.go deleted file mode 100644 index e8b6a3f1ae..0000000000 --- a/src/runtime/map_faststr_noswiss.go +++ /dev/null @@ -1,507 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -package runtime - -import ( - "internal/abi" - "internal/goarch" - "internal/runtime/sys" - "unsafe" -) - -func mapaccess1_faststr(t *maptype, h *hmap, ky string) unsafe.Pointer { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - racereadpc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapaccess1_faststr)) - } - if h == nil || h.count == 0 { - return unsafe.Pointer(&zeroVal[0]) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map read and map write") - } - key := stringStructOf(&ky) - if h.B == 0 { - // One-bucket table. - b := (*bmap)(h.buckets) - if key.len < 32 { - // short key, doing lots of comparisons is ok - for i, kptr := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, kptr = i+1, add(kptr, 2*goarch.PtrSize) { - k := (*stringStruct)(kptr) - if k.len != key.len || isEmpty(b.tophash[i]) { - if b.tophash[i] == emptyRest { - break - } - continue - } - if k.str == key.str || memequal(k.str, key.str, uintptr(key.len)) { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*2*goarch.PtrSize+i*uintptr(t.ValueSize)) - } - } - return unsafe.Pointer(&zeroVal[0]) - } - // long key, try not to do more comparisons than necessary - keymaybe := uintptr(abi.OldMapBucketCount) - for i, kptr := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, kptr = i+1, add(kptr, 2*goarch.PtrSize) { - k := (*stringStruct)(kptr) - if k.len != key.len || isEmpty(b.tophash[i]) { - if b.tophash[i] == emptyRest { - break - } - continue - } - if k.str == key.str { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*2*goarch.PtrSize+i*uintptr(t.ValueSize)) - } - // check first 4 bytes - if *((*[4]byte)(key.str)) != *((*[4]byte)(k.str)) { - continue - } - // check last 4 bytes - if *((*[4]byte)(add(key.str, uintptr(key.len)-4))) != *((*[4]byte)(add(k.str, uintptr(key.len)-4))) { - continue - } - if keymaybe != abi.OldMapBucketCount { - // Two keys are potential matches. Use hash to distinguish them. - goto dohash - } - keymaybe = i - } - if keymaybe != abi.OldMapBucketCount { - k := (*stringStruct)(add(unsafe.Pointer(b), dataOffset+keymaybe*2*goarch.PtrSize)) - if memequal(k.str, key.str, uintptr(key.len)) { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*2*goarch.PtrSize+keymaybe*uintptr(t.ValueSize)) - } - } - return unsafe.Pointer(&zeroVal[0]) - } -dohash: - hash := t.Hasher(noescape(unsafe.Pointer(&ky)), uintptr(h.hash0)) - m := bucketMask(h.B) - b := (*bmap)(add(h.buckets, (hash&m)*uintptr(t.BucketSize))) - if c := h.oldbuckets; c != nil { - if !h.sameSizeGrow() { - // There used to be half as many buckets; mask down one more power of two. - m >>= 1 - } - oldb := (*bmap)(add(c, (hash&m)*uintptr(t.BucketSize))) - if !evacuated(oldb) { - b = oldb - } - } - top := tophash(hash) - for ; b != nil; b = b.overflow(t) { - for i, kptr := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, kptr = i+1, add(kptr, 2*goarch.PtrSize) { - k := (*stringStruct)(kptr) - if k.len != key.len || b.tophash[i] != top { - continue - } - if k.str == key.str || memequal(k.str, key.str, uintptr(key.len)) { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*2*goarch.PtrSize+i*uintptr(t.ValueSize)) - } - } - } - return unsafe.Pointer(&zeroVal[0]) -} - -// mapaccess2_faststr should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapaccess2_faststr -func mapaccess2_faststr(t *maptype, h *hmap, ky string) (unsafe.Pointer, bool) { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - racereadpc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapaccess2_faststr)) - } - if h == nil || h.count == 0 { - return unsafe.Pointer(&zeroVal[0]), false - } - if h.flags&hashWriting != 0 { - fatal("concurrent map read and map write") - } - key := stringStructOf(&ky) - if h.B == 0 { - // One-bucket table. - b := (*bmap)(h.buckets) - if key.len < 32 { - // short key, doing lots of comparisons is ok - for i, kptr := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, kptr = i+1, add(kptr, 2*goarch.PtrSize) { - k := (*stringStruct)(kptr) - if k.len != key.len || isEmpty(b.tophash[i]) { - if b.tophash[i] == emptyRest { - break - } - continue - } - if k.str == key.str || memequal(k.str, key.str, uintptr(key.len)) { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*2*goarch.PtrSize+i*uintptr(t.ValueSize)), true - } - } - return unsafe.Pointer(&zeroVal[0]), false - } - // long key, try not to do more comparisons than necessary - keymaybe := uintptr(abi.OldMapBucketCount) - for i, kptr := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, kptr = i+1, add(kptr, 2*goarch.PtrSize) { - k := (*stringStruct)(kptr) - if k.len != key.len || isEmpty(b.tophash[i]) { - if b.tophash[i] == emptyRest { - break - } - continue - } - if k.str == key.str { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*2*goarch.PtrSize+i*uintptr(t.ValueSize)), true - } - // check first 4 bytes - if *((*[4]byte)(key.str)) != *((*[4]byte)(k.str)) { - continue - } - // check last 4 bytes - if *((*[4]byte)(add(key.str, uintptr(key.len)-4))) != *((*[4]byte)(add(k.str, uintptr(key.len)-4))) { - continue - } - if keymaybe != abi.OldMapBucketCount { - // Two keys are potential matches. Use hash to distinguish them. - goto dohash - } - keymaybe = i - } - if keymaybe != abi.OldMapBucketCount { - k := (*stringStruct)(add(unsafe.Pointer(b), dataOffset+keymaybe*2*goarch.PtrSize)) - if memequal(k.str, key.str, uintptr(key.len)) { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*2*goarch.PtrSize+keymaybe*uintptr(t.ValueSize)), true - } - } - return unsafe.Pointer(&zeroVal[0]), false - } -dohash: - hash := t.Hasher(noescape(unsafe.Pointer(&ky)), uintptr(h.hash0)) - m := bucketMask(h.B) - b := (*bmap)(add(h.buckets, (hash&m)*uintptr(t.BucketSize))) - if c := h.oldbuckets; c != nil { - if !h.sameSizeGrow() { - // There used to be half as many buckets; mask down one more power of two. - m >>= 1 - } - oldb := (*bmap)(add(c, (hash&m)*uintptr(t.BucketSize))) - if !evacuated(oldb) { - b = oldb - } - } - top := tophash(hash) - for ; b != nil; b = b.overflow(t) { - for i, kptr := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, kptr = i+1, add(kptr, 2*goarch.PtrSize) { - k := (*stringStruct)(kptr) - if k.len != key.len || b.tophash[i] != top { - continue - } - if k.str == key.str || memequal(k.str, key.str, uintptr(key.len)) { - return add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*2*goarch.PtrSize+i*uintptr(t.ValueSize)), true - } - } - } - return unsafe.Pointer(&zeroVal[0]), false -} - -// mapassign_faststr should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/bytedance/sonic -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapassign_faststr -func mapassign_faststr(t *maptype, h *hmap, s string) unsafe.Pointer { - if h == nil { - panic(plainError("assignment to entry in nil map")) - } - if raceenabled { - callerpc := sys.GetCallerPC() - racewritepc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapassign_faststr)) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - key := stringStructOf(&s) - hash := t.Hasher(noescape(unsafe.Pointer(&s)), uintptr(h.hash0)) - - // Set hashWriting after calling t.hasher for consistency with mapassign. - h.flags ^= hashWriting - - if h.buckets == nil { - h.buckets = newobject(t.Bucket) // newarray(t.bucket, 1) - } - -again: - bucket := hash & bucketMask(h.B) - if h.growing() { - growWork_faststr(t, h, bucket) - } - b := (*bmap)(add(h.buckets, bucket*uintptr(t.BucketSize))) - top := tophash(hash) - - var insertb *bmap - var inserti uintptr - var insertk unsafe.Pointer - -bucketloop: - for { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if b.tophash[i] != top { - if isEmpty(b.tophash[i]) && insertb == nil { - insertb = b - inserti = i - } - if b.tophash[i] == emptyRest { - break bucketloop - } - continue - } - k := (*stringStruct)(add(unsafe.Pointer(b), dataOffset+i*2*goarch.PtrSize)) - if k.len != key.len { - continue - } - if k.str != key.str && !memequal(k.str, key.str, uintptr(key.len)) { - continue - } - // already have a mapping for key. Update it. - inserti = i - insertb = b - // Overwrite existing key, so it can be garbage collected. - // The size is already guaranteed to be set correctly. - k.str = key.str - goto done - } - ovf := b.overflow(t) - if ovf == nil { - break - } - b = ovf - } - - // Did not find mapping for key. Allocate new cell & add entry. - - // If we hit the max load factor or we have too many overflow buckets, - // and we're not already in the middle of growing, start growing. - if !h.growing() && (overLoadFactor(h.count+1, h.B) || tooManyOverflowBuckets(h.noverflow, h.B)) { - hashGrow(t, h) - goto again // Growing the table invalidates everything, so try again - } - - if insertb == nil { - // The current bucket and all the overflow buckets connected to it are full, allocate a new one. - insertb = h.newoverflow(t, b) - inserti = 0 // not necessary, but avoids needlessly spilling inserti - } - insertb.tophash[inserti&(abi.OldMapBucketCount-1)] = top // mask inserti to avoid bounds checks - - insertk = add(unsafe.Pointer(insertb), dataOffset+inserti*2*goarch.PtrSize) - // store new key at insert position - *((*stringStruct)(insertk)) = *key - h.count++ - -done: - elem := add(unsafe.Pointer(insertb), dataOffset+abi.OldMapBucketCount*2*goarch.PtrSize+inserti*uintptr(t.ValueSize)) - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting - return elem -} - -func mapdelete_faststr(t *maptype, h *hmap, ky string) { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - racewritepc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapdelete_faststr)) - } - if h == nil || h.count == 0 { - return - } - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - - key := stringStructOf(&ky) - hash := t.Hasher(noescape(unsafe.Pointer(&ky)), uintptr(h.hash0)) - - // Set hashWriting after calling t.hasher for consistency with mapdelete - h.flags ^= hashWriting - - bucket := hash & bucketMask(h.B) - if h.growing() { - growWork_faststr(t, h, bucket) - } - b := (*bmap)(add(h.buckets, bucket*uintptr(t.BucketSize))) - bOrig := b - top := tophash(hash) -search: - for ; b != nil; b = b.overflow(t) { - for i, kptr := uintptr(0), b.keys(); i < abi.OldMapBucketCount; i, kptr = i+1, add(kptr, 2*goarch.PtrSize) { - k := (*stringStruct)(kptr) - if k.len != key.len || b.tophash[i] != top { - continue - } - if k.str != key.str && !memequal(k.str, key.str, uintptr(key.len)) { - continue - } - // Clear key's pointer. - k.str = nil - e := add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*2*goarch.PtrSize+i*uintptr(t.ValueSize)) - if t.Elem.Pointers() { - memclrHasPointers(e, t.Elem.Size_) - } else { - memclrNoHeapPointers(e, t.Elem.Size_) - } - b.tophash[i] = emptyOne - // If the bucket now ends in a bunch of emptyOne states, - // change those to emptyRest states. - if i == abi.OldMapBucketCount-1 { - if b.overflow(t) != nil && b.overflow(t).tophash[0] != emptyRest { - goto notLast - } - } else { - if b.tophash[i+1] != emptyRest { - goto notLast - } - } - for { - b.tophash[i] = emptyRest - if i == 0 { - if b == bOrig { - break // beginning of initial bucket, we're done. - } - // Find previous bucket, continue at its last entry. - c := b - for b = bOrig; b.overflow(t) != c; b = b.overflow(t) { - } - i = abi.OldMapBucketCount - 1 - } else { - i-- - } - if b.tophash[i] != emptyOne { - break - } - } - notLast: - h.count-- - // Reset the hash seed to make it more difficult for attackers to - // repeatedly trigger hash collisions. See issue 25237. - if h.count == 0 { - h.hash0 = uint32(rand()) - } - break search - } - } - - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting -} - -func growWork_faststr(t *maptype, h *hmap, bucket uintptr) { - // make sure we evacuate the oldbucket corresponding - // to the bucket we're about to use - evacuate_faststr(t, h, bucket&h.oldbucketmask()) - - // evacuate one more oldbucket to make progress on growing - if h.growing() { - evacuate_faststr(t, h, h.nevacuate) - } -} - -func evacuate_faststr(t *maptype, h *hmap, oldbucket uintptr) { - b := (*bmap)(add(h.oldbuckets, oldbucket*uintptr(t.BucketSize))) - newbit := h.noldbuckets() - if !evacuated(b) { - // TODO: reuse overflow buckets instead of using new ones, if there - // is no iterator using the old buckets. (If !oldIterator.) - - // xy contains the x and y (low and high) evacuation destinations. - var xy [2]evacDst - x := &xy[0] - x.b = (*bmap)(add(h.buckets, oldbucket*uintptr(t.BucketSize))) - x.k = add(unsafe.Pointer(x.b), dataOffset) - x.e = add(x.k, abi.OldMapBucketCount*2*goarch.PtrSize) - - if !h.sameSizeGrow() { - // Only calculate y pointers if we're growing bigger. - // Otherwise GC can see bad pointers. - y := &xy[1] - y.b = (*bmap)(add(h.buckets, (oldbucket+newbit)*uintptr(t.BucketSize))) - y.k = add(unsafe.Pointer(y.b), dataOffset) - y.e = add(y.k, abi.OldMapBucketCount*2*goarch.PtrSize) - } - - for ; b != nil; b = b.overflow(t) { - k := add(unsafe.Pointer(b), dataOffset) - e := add(k, abi.OldMapBucketCount*2*goarch.PtrSize) - for i := 0; i < abi.OldMapBucketCount; i, k, e = i+1, add(k, 2*goarch.PtrSize), add(e, uintptr(t.ValueSize)) { - top := b.tophash[i] - if isEmpty(top) { - b.tophash[i] = evacuatedEmpty - continue - } - if top < minTopHash { - throw("bad map state") - } - var useY uint8 - if !h.sameSizeGrow() { - // Compute hash to make our evacuation decision (whether we need - // to send this key/elem to bucket x or bucket y). - hash := t.Hasher(k, uintptr(h.hash0)) - if hash&newbit != 0 { - useY = 1 - } - } - - b.tophash[i] = evacuatedX + useY // evacuatedX + 1 == evacuatedY, enforced in makemap - dst := &xy[useY] // evacuation destination - - if dst.i == abi.OldMapBucketCount { - dst.b = h.newoverflow(t, dst.b) - dst.i = 0 - dst.k = add(unsafe.Pointer(dst.b), dataOffset) - dst.e = add(dst.k, abi.OldMapBucketCount*2*goarch.PtrSize) - } - dst.b.tophash[dst.i&(abi.OldMapBucketCount-1)] = top // mask dst.i as an optimization, to avoid a bounds check - - // Copy key. - *(*string)(dst.k) = *(*string)(k) - - typedmemmove(t.Elem, dst.e, e) - dst.i++ - // These updates might push these pointers past the end of the - // key or elem arrays. That's ok, as we have the overflow pointer - // at the end of the bucket to protect against pointing past the - // end of the bucket. - dst.k = add(dst.k, 2*goarch.PtrSize) - dst.e = add(dst.e, uintptr(t.ValueSize)) - } - } - // Unlink the overflow buckets & clear key/elem to help GC. - if h.flags&oldIterator == 0 && t.Bucket.Pointers() { - b := add(h.oldbuckets, oldbucket*uintptr(t.BucketSize)) - // Preserve b.tophash because the evacuation - // state is maintained there. - ptr := add(b, dataOffset) - n := uintptr(t.BucketSize) - dataOffset - memclrHasPointers(ptr, n) - } - } - - if oldbucket == h.nevacuate { - advanceEvacuationMark(h, t, newbit) - } -} diff --git a/src/runtime/map_noswiss.go b/src/runtime/map_noswiss.go deleted file mode 100644 index 7b3c98eb88..0000000000 --- a/src/runtime/map_noswiss.go +++ /dev/null @@ -1,1891 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -package runtime - -// This file contains the implementation of Go's map type. -// -// A map is just a hash table. The data is arranged -// into an array of buckets. Each bucket contains up to -// 8 key/elem pairs. The low-order bits of the hash are -// used to select a bucket. Each bucket contains a few -// high-order bits of each hash to distinguish the entries -// within a single bucket. -// -// If more than 8 keys hash to a bucket, we chain on -// extra buckets. -// -// When the hashtable grows, we allocate a new array -// of buckets twice as big. Buckets are incrementally -// copied from the old bucket array to the new bucket array. -// -// Map iterators walk through the array of buckets and -// return the keys in walk order (bucket #, then overflow -// chain order, then bucket index). To maintain iteration -// semantics, we never move keys within their bucket (if -// we did, keys might be returned 0 or 2 times). When -// growing the table, iterators remain iterating through the -// old table and must check the new table if the bucket -// they are iterating through has been moved ("evacuated") -// to the new table. - -// Picking loadFactor: too large and we have lots of overflow -// buckets, too small and we waste a lot of space. I wrote -// a simple program to check some stats for different loads: -// (64-bit, 8 byte keys and elems) -// loadFactor %overflow bytes/entry hitprobe missprobe -// 4.00 2.13 20.77 3.00 4.00 -// 4.50 4.05 17.30 3.25 4.50 -// 5.00 6.85 14.77 3.50 5.00 -// 5.50 10.55 12.94 3.75 5.50 -// 6.00 15.27 11.67 4.00 6.00 -// 6.50 20.90 10.79 4.25 6.50 -// 7.00 27.14 10.15 4.50 7.00 -// 7.50 34.03 9.73 4.75 7.50 -// 8.00 41.10 9.40 5.00 8.00 -// -// %overflow = percentage of buckets which have an overflow bucket -// bytes/entry = overhead bytes used per key/elem pair -// hitprobe = # of entries to check when looking up a present key -// missprobe = # of entries to check when looking up an absent key -// -// Keep in mind this data is for maximally loaded tables, i.e. just -// before the table grows. Typical tables will be somewhat less loaded. - -import ( - "internal/abi" - "internal/goarch" - "internal/runtime/atomic" - "internal/runtime/maps" - "internal/runtime/math" - "internal/runtime/sys" - "unsafe" -) - -type maptype = abi.OldMapType - -const ( - // Maximum number of key/elem pairs a bucket can hold. - bucketCntBits = abi.OldMapBucketCountBits - - // Maximum average load of a bucket that triggers growth is bucketCnt*13/16 (about 80% full) - // Because of minimum alignment rules, bucketCnt is known to be at least 8. - // Represent as loadFactorNum/loadFactorDen, to allow integer math. - loadFactorDen = 2 - loadFactorNum = loadFactorDen * abi.OldMapBucketCount * 13 / 16 - - // data offset should be the size of the bmap struct, but needs to be - // aligned correctly. For amd64p32 this means 64-bit alignment - // even though pointers are 32 bit. - dataOffset = unsafe.Offsetof(struct { - b bmap - v int64 - }{}.v) - - // Possible tophash values. We reserve a few possibilities for special marks. - // Each bucket (including its overflow buckets, if any) will have either all or none of its - // entries in the evacuated* states (except during the evacuate() method, which only happens - // during map writes and thus no one else can observe the map during that time). - emptyRest = 0 // this cell is empty, and there are no more non-empty cells at higher indexes or overflows. - emptyOne = 1 // this cell is empty - evacuatedX = 2 // key/elem is valid. Entry has been evacuated to first half of larger table. - evacuatedY = 3 // same as above, but evacuated to second half of larger table. - evacuatedEmpty = 4 // cell is empty, bucket is evacuated. - minTopHash = 5 // minimum tophash for a normal filled cell. - - // flags - iterator = 1 // there may be an iterator using buckets - oldIterator = 2 // there may be an iterator using oldbuckets - hashWriting = 4 // a goroutine is writing to the map - sameSizeGrow = 8 // the current map growth is to a new map of the same size - - // sentinel bucket ID for iterator checks - noCheck = 1<<(8*goarch.PtrSize) - 1 -) - -// isEmpty reports whether the given tophash array entry represents an empty bucket entry. -func isEmpty(x uint8) bool { - return x <= emptyOne -} - -// A header for a Go map. -type hmap struct { - // Note: the format of the hmap is also encoded in cmd/compile/internal/reflectdata/reflect.go. - // Make sure this stays in sync with the compiler's definition. - count int // # live cells == size of map. Must be first (used by len() builtin) - flags uint8 - B uint8 // log_2 of # of buckets (can hold up to loadFactor * 2^B items) - noverflow uint16 // approximate number of overflow buckets; see incrnoverflow for details - hash0 uint32 // hash seed - - buckets unsafe.Pointer // array of 2^B Buckets. may be nil if count==0. - oldbuckets unsafe.Pointer // previous bucket array of half the size, non-nil only when growing - nevacuate uintptr // progress counter for evacuation (buckets less than this have been evacuated) - clearSeq uint64 - - extra *mapextra // optional fields -} - -// mapextra holds fields that are not present on all maps. -type mapextra struct { - // If both key and elem do not contain pointers and are inline, then we mark bucket - // type as containing no pointers. This avoids scanning such maps. - // However, bmap.overflow is a pointer. In order to keep overflow buckets - // alive, we store pointers to all overflow buckets in hmap.extra.overflow and hmap.extra.oldoverflow. - // overflow and oldoverflow are only used if key and elem do not contain pointers. - // overflow contains overflow buckets for hmap.buckets. - // oldoverflow contains overflow buckets for hmap.oldbuckets. - // The indirection allows to store a pointer to the slice in hiter. - overflow *[]*bmap - oldoverflow *[]*bmap - - // nextOverflow holds a pointer to a free overflow bucket. - nextOverflow *bmap -} - -// A bucket for a Go map. -type bmap struct { - // tophash generally contains the top byte of the hash value - // for each key in this bucket. If tophash[0] < minTopHash, - // tophash[0] is a bucket evacuation state instead. - tophash [abi.OldMapBucketCount]uint8 - // Followed by bucketCnt keys and then bucketCnt elems. - // NOTE: packing all the keys together and then all the elems together makes the - // code a bit more complicated than alternating key/elem/key/elem/... but it allows - // us to eliminate padding which would be needed for, e.g., map[int64]int8. - // Followed by an overflow pointer. -} - -// A hash iteration structure. -// If you modify hiter, also change cmd/compile/internal/reflectdata/reflect.go -// and reflect/value.go to match the layout of this structure. -type hiter struct { - key unsafe.Pointer // Must be in first position. Write nil to indicate iteration end (see cmd/compile/internal/walk/range.go). - elem unsafe.Pointer // Must be in second position (see cmd/compile/internal/walk/range.go). - t *maptype - h *hmap - buckets unsafe.Pointer // bucket ptr at hash_iter initialization time - bptr *bmap // current bucket - overflow *[]*bmap // keeps overflow buckets of hmap.buckets alive - oldoverflow *[]*bmap // keeps overflow buckets of hmap.oldbuckets alive - startBucket uintptr // bucket iteration started at - offset uint8 // intra-bucket offset to start from during iteration (should be big enough to hold bucketCnt-1) - wrapped bool // already wrapped around from end of bucket array to beginning - B uint8 - i uint8 - bucket uintptr - checkBucket uintptr - clearSeq uint64 -} - -// bucketShift returns 1<<b, optimized for code generation. -func bucketShift(b uint8) uintptr { - // Masking the shift amount allows overflow checks to be elided. - return uintptr(1) << (b & (goarch.PtrSize*8 - 1)) -} - -// bucketMask returns 1<<b - 1, optimized for code generation. -func bucketMask(b uint8) uintptr { - return bucketShift(b) - 1 -} - -// tophash calculates the tophash value for hash. -func tophash(hash uintptr) uint8 { - top := uint8(hash >> (goarch.PtrSize*8 - 8)) - if top < minTopHash { - top += minTopHash - } - return top -} - -func evacuated(b *bmap) bool { - h := b.tophash[0] - return h > emptyOne && h < minTopHash -} - -func (b *bmap) overflow(t *maptype) *bmap { - return *(**bmap)(add(unsafe.Pointer(b), uintptr(t.BucketSize)-goarch.PtrSize)) -} - -func (b *bmap) setoverflow(t *maptype, ovf *bmap) { - *(**bmap)(add(unsafe.Pointer(b), uintptr(t.BucketSize)-goarch.PtrSize)) = ovf -} - -func (b *bmap) keys() unsafe.Pointer { - return add(unsafe.Pointer(b), dataOffset) -} - -// incrnoverflow increments h.noverflow. -// noverflow counts the number of overflow buckets. -// This is used to trigger same-size map growth. -// See also tooManyOverflowBuckets. -// To keep hmap small, noverflow is a uint16. -// When there are few buckets, noverflow is an exact count. -// When there are many buckets, noverflow is an approximate count. -func (h *hmap) incrnoverflow() { - // We trigger same-size map growth if there are - // as many overflow buckets as buckets. - // We need to be able to count to 1<<h.B. - if h.B < 16 { - h.noverflow++ - return - } - // Increment with probability 1/(1<<(h.B-15)). - // When we reach 1<<15 - 1, we will have approximately - // as many overflow buckets as buckets. - mask := uint32(1)<<(h.B-15) - 1 - // Example: if h.B == 18, then mask == 7, - // and rand() & 7 == 0 with probability 1/8. - if uint32(rand())&mask == 0 { - h.noverflow++ - } -} - -func (h *hmap) newoverflow(t *maptype, b *bmap) *bmap { - var ovf *bmap - if h.extra != nil && h.extra.nextOverflow != nil { - // We have preallocated overflow buckets available. - // See makeBucketArray for more details. - ovf = h.extra.nextOverflow - if ovf.overflow(t) == nil { - // We're not at the end of the preallocated overflow buckets. Bump the pointer. - h.extra.nextOverflow = (*bmap)(add(unsafe.Pointer(ovf), uintptr(t.BucketSize))) - } else { - // This is the last preallocated overflow bucket. - // Reset the overflow pointer on this bucket, - // which was set to a non-nil sentinel value. - ovf.setoverflow(t, nil) - h.extra.nextOverflow = nil - } - } else { - ovf = (*bmap)(newobject(t.Bucket)) - } - h.incrnoverflow() - if !t.Bucket.Pointers() { - h.createOverflow() - *h.extra.overflow = append(*h.extra.overflow, ovf) - } - b.setoverflow(t, ovf) - return ovf -} - -func (h *hmap) createOverflow() { - if h.extra == nil { - h.extra = new(mapextra) - } - if h.extra.overflow == nil { - h.extra.overflow = new([]*bmap) - } -} - -func makemap64(t *maptype, hint int64, h *hmap) *hmap { - if int64(int(hint)) != hint { - hint = 0 - } - return makemap(t, int(hint), h) -} - -// makemap_small implements Go map creation for make(map[k]v) and -// make(map[k]v, hint) when hint is known to be at most bucketCnt -// at compile time and the map needs to be allocated on the heap. -// -// makemap_small should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/bytedance/sonic -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname makemap_small -func makemap_small() *hmap { - h := new(hmap) - h.hash0 = uint32(rand()) - return h -} - -// makemap implements Go map creation for make(map[k]v, hint). -// If the compiler has determined that the map or the first bucket -// can be created on the stack, h and/or bucket may be non-nil. -// If h != nil, the map can be created directly in h. -// If h.buckets != nil, bucket pointed to can be used as the first bucket. -// -// makemap should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname makemap -func makemap(t *maptype, hint int, h *hmap) *hmap { - mem, overflow := math.MulUintptr(uintptr(hint), t.Bucket.Size_) - if overflow || mem > maxAlloc { - hint = 0 - } - - // initialize Hmap - if h == nil { - h = new(hmap) - } - h.hash0 = uint32(rand()) - - // Find the size parameter B which will hold the requested # of elements. - // For hint < 0 overLoadFactor returns false since hint < bucketCnt. - B := uint8(0) - for overLoadFactor(hint, B) { - B++ - } - h.B = B - - // allocate initial hash table - // if B == 0, the buckets field is allocated lazily later (in mapassign) - // If hint is large zeroing this memory could take a while. - if h.B != 0 { - var nextOverflow *bmap - h.buckets, nextOverflow = makeBucketArray(t, h.B, nil) - if nextOverflow != nil { - h.extra = new(mapextra) - h.extra.nextOverflow = nextOverflow - } - } - - return h -} - -// makeBucketArray initializes a backing array for map buckets. -// 1<<b is the minimum number of buckets to allocate. -// dirtyalloc should either be nil or a bucket array previously -// allocated by makeBucketArray with the same t and b parameters. -// If dirtyalloc is nil a new backing array will be alloced and -// otherwise dirtyalloc will be cleared and reused as backing array. -func makeBucketArray(t *maptype, b uint8, dirtyalloc unsafe.Pointer) (buckets unsafe.Pointer, nextOverflow *bmap) { - base := bucketShift(b) - nbuckets := base - // For small b, overflow buckets are unlikely. - // Avoid the overhead of the calculation. - if b >= 4 { - // Add on the estimated number of overflow buckets - // required to insert the median number of elements - // used with this value of b. - nbuckets += bucketShift(b - 4) - sz := t.Bucket.Size_ * nbuckets - up := roundupsize(sz, !t.Bucket.Pointers()) - if up != sz { - nbuckets = up / t.Bucket.Size_ - } - } - - if dirtyalloc == nil { - buckets = newarray(t.Bucket, int(nbuckets)) - } else { - // dirtyalloc was previously generated by - // the above newarray(t.Bucket, int(nbuckets)) - // but may not be empty. - buckets = dirtyalloc - size := t.Bucket.Size_ * nbuckets - if t.Bucket.Pointers() { - memclrHasPointers(buckets, size) - } else { - memclrNoHeapPointers(buckets, size) - } - } - - if base != nbuckets { - // We preallocated some overflow buckets. - // To keep the overhead of tracking these overflow buckets to a minimum, - // we use the convention that if a preallocated overflow bucket's overflow - // pointer is nil, then there are more available by bumping the pointer. - // We need a safe non-nil pointer for the last overflow bucket; just use buckets. - nextOverflow = (*bmap)(add(buckets, base*uintptr(t.BucketSize))) - last := (*bmap)(add(buckets, (nbuckets-1)*uintptr(t.BucketSize))) - last.setoverflow(t, (*bmap)(buckets)) - } - return buckets, nextOverflow -} - -// mapaccess1 returns a pointer to h[key]. Never returns nil, instead -// it will return a reference to the zero object for the elem type if -// the key is not in the map. -// NOTE: The returned pointer may keep the whole map live, so don't -// hold onto it for very long. -func mapaccess1(t *maptype, h *hmap, key unsafe.Pointer) unsafe.Pointer { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - pc := abi.FuncPCABIInternal(mapaccess1) - racereadpc(unsafe.Pointer(h), callerpc, pc) - raceReadObjectPC(t.Key, key, callerpc, pc) - } - if msanenabled && h != nil { - msanread(key, t.Key.Size_) - } - if asanenabled && h != nil { - asanread(key, t.Key.Size_) - } - if h == nil || h.count == 0 { - if err := maps.OldMapKeyError(t, key); err != nil { - panic(err) // see issue 23734 - } - return unsafe.Pointer(&zeroVal[0]) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map read and map write") - } - hash := t.Hasher(key, uintptr(h.hash0)) - m := bucketMask(h.B) - b := (*bmap)(add(h.buckets, (hash&m)*uintptr(t.BucketSize))) - if c := h.oldbuckets; c != nil { - if !h.sameSizeGrow() { - // There used to be half as many buckets; mask down one more power of two. - m >>= 1 - } - oldb := (*bmap)(add(c, (hash&m)*uintptr(t.BucketSize))) - if !evacuated(oldb) { - b = oldb - } - } - top := tophash(hash) -bucketloop: - for ; b != nil; b = b.overflow(t) { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if b.tophash[i] != top { - if b.tophash[i] == emptyRest { - break bucketloop - } - continue - } - k := add(unsafe.Pointer(b), dataOffset+i*uintptr(t.KeySize)) - if t.IndirectKey() { - k = *((*unsafe.Pointer)(k)) - } - if t.Key.Equal(key, k) { - e := add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+i*uintptr(t.ValueSize)) - if t.IndirectElem() { - e = *((*unsafe.Pointer)(e)) - } - return e - } - } - } - return unsafe.Pointer(&zeroVal[0]) -} - -// mapaccess2 should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapaccess2 -func mapaccess2(t *maptype, h *hmap, key unsafe.Pointer) (unsafe.Pointer, bool) { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - pc := abi.FuncPCABIInternal(mapaccess2) - racereadpc(unsafe.Pointer(h), callerpc, pc) - raceReadObjectPC(t.Key, key, callerpc, pc) - } - if msanenabled && h != nil { - msanread(key, t.Key.Size_) - } - if asanenabled && h != nil { - asanread(key, t.Key.Size_) - } - if h == nil || h.count == 0 { - if err := maps.OldMapKeyError(t, key); err != nil { - panic(err) // see issue 23734 - } - return unsafe.Pointer(&zeroVal[0]), false - } - if h.flags&hashWriting != 0 { - fatal("concurrent map read and map write") - } - hash := t.Hasher(key, uintptr(h.hash0)) - m := bucketMask(h.B) - b := (*bmap)(add(h.buckets, (hash&m)*uintptr(t.BucketSize))) - if c := h.oldbuckets; c != nil { - if !h.sameSizeGrow() { - // There used to be half as many buckets; mask down one more power of two. - m >>= 1 - } - oldb := (*bmap)(add(c, (hash&m)*uintptr(t.BucketSize))) - if !evacuated(oldb) { - b = oldb - } - } - top := tophash(hash) -bucketloop: - for ; b != nil; b = b.overflow(t) { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if b.tophash[i] != top { - if b.tophash[i] == emptyRest { - break bucketloop - } - continue - } - k := add(unsafe.Pointer(b), dataOffset+i*uintptr(t.KeySize)) - if t.IndirectKey() { - k = *((*unsafe.Pointer)(k)) - } - if t.Key.Equal(key, k) { - e := add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+i*uintptr(t.ValueSize)) - if t.IndirectElem() { - e = *((*unsafe.Pointer)(e)) - } - return e, true - } - } - } - return unsafe.Pointer(&zeroVal[0]), false -} - -// returns both key and elem. Used by map iterator. -func mapaccessK(t *maptype, h *hmap, key unsafe.Pointer) (unsafe.Pointer, unsafe.Pointer) { - if h == nil || h.count == 0 { - return nil, nil - } - hash := t.Hasher(key, uintptr(h.hash0)) - m := bucketMask(h.B) - b := (*bmap)(add(h.buckets, (hash&m)*uintptr(t.BucketSize))) - if c := h.oldbuckets; c != nil { - if !h.sameSizeGrow() { - // There used to be half as many buckets; mask down one more power of two. - m >>= 1 - } - oldb := (*bmap)(add(c, (hash&m)*uintptr(t.BucketSize))) - if !evacuated(oldb) { - b = oldb - } - } - top := tophash(hash) -bucketloop: - for ; b != nil; b = b.overflow(t) { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if b.tophash[i] != top { - if b.tophash[i] == emptyRest { - break bucketloop - } - continue - } - k := add(unsafe.Pointer(b), dataOffset+i*uintptr(t.KeySize)) - if t.IndirectKey() { - k = *((*unsafe.Pointer)(k)) - } - if t.Key.Equal(key, k) { - e := add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+i*uintptr(t.ValueSize)) - if t.IndirectElem() { - e = *((*unsafe.Pointer)(e)) - } - return k, e - } - } - } - return nil, nil -} - -func mapaccess1_fat(t *maptype, h *hmap, key, zero unsafe.Pointer) unsafe.Pointer { - e := mapaccess1(t, h, key) - if e == unsafe.Pointer(&zeroVal[0]) { - return zero - } - return e -} - -func mapaccess2_fat(t *maptype, h *hmap, key, zero unsafe.Pointer) (unsafe.Pointer, bool) { - e := mapaccess1(t, h, key) - if e == unsafe.Pointer(&zeroVal[0]) { - return zero, false - } - return e, true -} - -// Like mapaccess, but allocates a slot for the key if it is not present in the map. -// -// mapassign should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/bytedance/sonic -// - github.com/RomiChan/protobuf -// - github.com/segmentio/encoding -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapassign -func mapassign(t *maptype, h *hmap, key unsafe.Pointer) unsafe.Pointer { - if h == nil { - panic(plainError("assignment to entry in nil map")) - } - if raceenabled { - callerpc := sys.GetCallerPC() - pc := abi.FuncPCABIInternal(mapassign) - racewritepc(unsafe.Pointer(h), callerpc, pc) - raceReadObjectPC(t.Key, key, callerpc, pc) - } - if msanenabled { - msanread(key, t.Key.Size_) - } - if asanenabled { - asanread(key, t.Key.Size_) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - hash := t.Hasher(key, uintptr(h.hash0)) - - // Set hashWriting after calling t.hasher, since t.hasher may panic, - // in which case we have not actually done a write. - h.flags ^= hashWriting - - if h.buckets == nil { - h.buckets = newobject(t.Bucket) // newarray(t.Bucket, 1) - } - -again: - bucket := hash & bucketMask(h.B) - if h.growing() { - growWork(t, h, bucket) - } - b := (*bmap)(add(h.buckets, bucket*uintptr(t.BucketSize))) - top := tophash(hash) - - var inserti *uint8 - var insertk unsafe.Pointer - var elem unsafe.Pointer -bucketloop: - for { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if b.tophash[i] != top { - if isEmpty(b.tophash[i]) && inserti == nil { - inserti = &b.tophash[i] - insertk = add(unsafe.Pointer(b), dataOffset+i*uintptr(t.KeySize)) - elem = add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+i*uintptr(t.ValueSize)) - } - if b.tophash[i] == emptyRest { - break bucketloop - } - continue - } - k := add(unsafe.Pointer(b), dataOffset+i*uintptr(t.KeySize)) - if t.IndirectKey() { - k = *((*unsafe.Pointer)(k)) - } - if !t.Key.Equal(key, k) { - continue - } - // already have a mapping for key. Update it. - if t.NeedKeyUpdate() { - typedmemmove(t.Key, k, key) - } - elem = add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+i*uintptr(t.ValueSize)) - goto done - } - ovf := b.overflow(t) - if ovf == nil { - break - } - b = ovf - } - - // Did not find mapping for key. Allocate new cell & add entry. - - // If we hit the max load factor or we have too many overflow buckets, - // and we're not already in the middle of growing, start growing. - if !h.growing() && (overLoadFactor(h.count+1, h.B) || tooManyOverflowBuckets(h.noverflow, h.B)) { - hashGrow(t, h) - goto again // Growing the table invalidates everything, so try again - } - - if inserti == nil { - // The current bucket and all the overflow buckets connected to it are full, allocate a new one. - newb := h.newoverflow(t, b) - inserti = &newb.tophash[0] - insertk = add(unsafe.Pointer(newb), dataOffset) - elem = add(insertk, abi.OldMapBucketCount*uintptr(t.KeySize)) - } - - // store new key/elem at insert position - if t.IndirectKey() { - kmem := newobject(t.Key) - *(*unsafe.Pointer)(insertk) = kmem - insertk = kmem - } - if t.IndirectElem() { - vmem := newobject(t.Elem) - *(*unsafe.Pointer)(elem) = vmem - } - typedmemmove(t.Key, insertk, key) - *inserti = top - h.count++ - -done: - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting - if t.IndirectElem() { - elem = *((*unsafe.Pointer)(elem)) - } - return elem -} - -// mapdelete should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/ugorji/go/codec -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapdelete -func mapdelete(t *maptype, h *hmap, key unsafe.Pointer) { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - pc := abi.FuncPCABIInternal(mapdelete) - racewritepc(unsafe.Pointer(h), callerpc, pc) - raceReadObjectPC(t.Key, key, callerpc, pc) - } - if msanenabled && h != nil { - msanread(key, t.Key.Size_) - } - if asanenabled && h != nil { - asanread(key, t.Key.Size_) - } - if h == nil || h.count == 0 { - if err := maps.OldMapKeyError(t, key); err != nil { - panic(err) // see issue 23734 - } - return - } - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - - hash := t.Hasher(key, uintptr(h.hash0)) - - // Set hashWriting after calling t.hasher, since t.hasher may panic, - // in which case we have not actually done a write (delete). - h.flags ^= hashWriting - - bucket := hash & bucketMask(h.B) - if h.growing() { - growWork(t, h, bucket) - } - b := (*bmap)(add(h.buckets, bucket*uintptr(t.BucketSize))) - bOrig := b - top := tophash(hash) -search: - for ; b != nil; b = b.overflow(t) { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if b.tophash[i] != top { - if b.tophash[i] == emptyRest { - break search - } - continue - } - k := add(unsafe.Pointer(b), dataOffset+i*uintptr(t.KeySize)) - k2 := k - if t.IndirectKey() { - k2 = *((*unsafe.Pointer)(k2)) - } - if !t.Key.Equal(key, k2) { - continue - } - // Only clear key if there are pointers in it. - if t.IndirectKey() { - *(*unsafe.Pointer)(k) = nil - } else if t.Key.Pointers() { - memclrHasPointers(k, t.Key.Size_) - } - e := add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+i*uintptr(t.ValueSize)) - if t.IndirectElem() { - *(*unsafe.Pointer)(e) = nil - } else if t.Elem.Pointers() { - memclrHasPointers(e, t.Elem.Size_) - } else { - memclrNoHeapPointers(e, t.Elem.Size_) - } - b.tophash[i] = emptyOne - // If the bucket now ends in a bunch of emptyOne states, - // change those to emptyRest states. - // It would be nice to make this a separate function, but - // for loops are not currently inlineable. - if i == abi.OldMapBucketCount-1 { - if b.overflow(t) != nil && b.overflow(t).tophash[0] != emptyRest { - goto notLast - } - } else { - if b.tophash[i+1] != emptyRest { - goto notLast - } - } - for { - b.tophash[i] = emptyRest - if i == 0 { - if b == bOrig { - break // beginning of initial bucket, we're done. - } - // Find previous bucket, continue at its last entry. - c := b - for b = bOrig; b.overflow(t) != c; b = b.overflow(t) { - } - i = abi.OldMapBucketCount - 1 - } else { - i-- - } - if b.tophash[i] != emptyOne { - break - } - } - notLast: - h.count-- - // Reset the hash seed to make it more difficult for attackers to - // repeatedly trigger hash collisions. See issue 25237. - if h.count == 0 { - h.hash0 = uint32(rand()) - } - break search - } - } - - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting -} - -// mapiterinit initializes the hiter struct used for ranging over maps. -// The hiter struct pointed to by 'it' is allocated on the stack -// by the compilers order pass or on the heap by reflect_mapiterinit. -// Both need to have zeroed hiter since the struct contains pointers. -// -// mapiterinit should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/bytedance/sonic -// - github.com/goccy/go-json -// - github.com/RomiChan/protobuf -// - github.com/segmentio/encoding -// - github.com/ugorji/go/codec -// - github.com/wI2L/jettison -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapiterinit -func mapiterinit(t *maptype, h *hmap, it *hiter) { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - racereadpc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapiterinit)) - } - - it.t = t - if h == nil || h.count == 0 { - return - } - - if unsafe.Sizeof(hiter{}) != 8+12*goarch.PtrSize { - throw("hash_iter size incorrect") // see cmd/compile/internal/reflectdata/reflect.go - } - it.h = h - it.clearSeq = h.clearSeq - - // grab snapshot of bucket state - it.B = h.B - it.buckets = h.buckets - if !t.Bucket.Pointers() { - // Allocate the current slice and remember pointers to both current and old. - // This preserves all relevant overflow buckets alive even if - // the table grows and/or overflow buckets are added to the table - // while we are iterating. - h.createOverflow() - it.overflow = h.extra.overflow - it.oldoverflow = h.extra.oldoverflow - } - - // decide where to start - r := uintptr(rand()) - it.startBucket = r & bucketMask(h.B) - it.offset = uint8(r >> h.B & (abi.OldMapBucketCount - 1)) - - // iterator state - it.bucket = it.startBucket - - // Remember we have an iterator. - // Can run concurrently with another mapiterinit(). - if old := h.flags; old&(iterator|oldIterator) != iterator|oldIterator { - atomic.Or8(&h.flags, iterator|oldIterator) - } - - mapiternext(it) -} - -// mapiternext should be an internal detail, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/bytedance/sonic -// - github.com/RomiChan/protobuf -// - github.com/segmentio/encoding -// - github.com/ugorji/go/codec -// - gonum.org/v1/gonum -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname mapiternext -func mapiternext(it *hiter) { - h := it.h - if raceenabled { - callerpc := sys.GetCallerPC() - racereadpc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(mapiternext)) - } - if h.flags&hashWriting != 0 { - fatal("concurrent map iteration and map write") - } - t := it.t - bucket := it.bucket - b := it.bptr - i := it.i - checkBucket := it.checkBucket - -next: - if b == nil { - if bucket == it.startBucket && it.wrapped { - // end of iteration - it.key = nil - it.elem = nil - return - } - if h.growing() && it.B == h.B { - // Iterator was started in the middle of a grow, and the grow isn't done yet. - // If the bucket we're looking at hasn't been filled in yet (i.e. the old - // bucket hasn't been evacuated) then we need to iterate through the old - // bucket and only return the ones that will be migrated to this bucket. - oldbucket := bucket & it.h.oldbucketmask() - b = (*bmap)(add(h.oldbuckets, oldbucket*uintptr(t.BucketSize))) - if !evacuated(b) { - checkBucket = bucket - } else { - b = (*bmap)(add(it.buckets, bucket*uintptr(t.BucketSize))) - checkBucket = noCheck - } - } else { - b = (*bmap)(add(it.buckets, bucket*uintptr(t.BucketSize))) - checkBucket = noCheck - } - bucket++ - if bucket == bucketShift(it.B) { - bucket = 0 - it.wrapped = true - } - i = 0 - } - for ; i < abi.OldMapBucketCount; i++ { - offi := (i + it.offset) & (abi.OldMapBucketCount - 1) - if isEmpty(b.tophash[offi]) || b.tophash[offi] == evacuatedEmpty { - // TODO: emptyRest is hard to use here, as we start iterating - // in the middle of a bucket. It's feasible, just tricky. - continue - } - k := add(unsafe.Pointer(b), dataOffset+uintptr(offi)*uintptr(t.KeySize)) - if t.IndirectKey() { - k = *((*unsafe.Pointer)(k)) - } - e := add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+uintptr(offi)*uintptr(t.ValueSize)) - if checkBucket != noCheck && !h.sameSizeGrow() { - // Special case: iterator was started during a grow to a larger size - // and the grow is not done yet. We're working on a bucket whose - // oldbucket has not been evacuated yet. Or at least, it wasn't - // evacuated when we started the bucket. So we're iterating - // through the oldbucket, skipping any keys that will go - // to the other new bucket (each oldbucket expands to two - // buckets during a grow). - if t.ReflexiveKey() || t.Key.Equal(k, k) { - // If the item in the oldbucket is not destined for - // the current new bucket in the iteration, skip it. - hash := t.Hasher(k, uintptr(h.hash0)) - if hash&bucketMask(it.B) != checkBucket { - continue - } - } else { - // Hash isn't repeatable if k != k (NaNs). We need a - // repeatable and randomish choice of which direction - // to send NaNs during evacuation. We'll use the low - // bit of tophash to decide which way NaNs go. - // NOTE: this case is why we need two evacuate tophash - // values, evacuatedX and evacuatedY, that differ in - // their low bit. - if checkBucket>>(it.B-1) != uintptr(b.tophash[offi]&1) { - continue - } - } - } - if it.clearSeq == h.clearSeq && - ((b.tophash[offi] != evacuatedX && b.tophash[offi] != evacuatedY) || - !(t.ReflexiveKey() || t.Key.Equal(k, k))) { - // This is the golden data, we can return it. - // OR - // key!=key, so the entry can't be deleted or updated, so we can just return it. - // That's lucky for us because when key!=key we can't look it up successfully. - it.key = k - if t.IndirectElem() { - e = *((*unsafe.Pointer)(e)) - } - it.elem = e - } else { - // The hash table has grown since the iterator was started. - // The golden data for this key is now somewhere else. - // Check the current hash table for the data. - // This code handles the case where the key - // has been deleted, updated, or deleted and reinserted. - // NOTE: we need to regrab the key as it has potentially been - // updated to an equal() but not identical key (e.g. +0.0 vs -0.0). - rk, re := mapaccessK(t, h, k) - if rk == nil { - continue // key has been deleted - } - it.key = rk - it.elem = re - } - it.bucket = bucket - if it.bptr != b { // avoid unnecessary write barrier; see issue 14921 - it.bptr = b - } - it.i = i + 1 - it.checkBucket = checkBucket - return - } - b = b.overflow(t) - i = 0 - goto next -} - -// mapclear deletes all keys from a map. -// It is called by the compiler. -func mapclear(t *maptype, h *hmap) { - if raceenabled && h != nil { - callerpc := sys.GetCallerPC() - pc := abi.FuncPCABIInternal(mapclear) - racewritepc(unsafe.Pointer(h), callerpc, pc) - } - - if h == nil || h.count == 0 { - return - } - - if h.flags&hashWriting != 0 { - fatal("concurrent map writes") - } - - h.flags ^= hashWriting - h.flags &^= sameSizeGrow - h.oldbuckets = nil - h.nevacuate = 0 - h.noverflow = 0 - h.count = 0 - h.clearSeq++ - - // Reset the hash seed to make it more difficult for attackers to - // repeatedly trigger hash collisions. See issue 25237. - h.hash0 = uint32(rand()) - - // Keep the mapextra allocation but clear any extra information. - if h.extra != nil { - *h.extra = mapextra{} - } - - // makeBucketArray clears the memory pointed to by h.buckets - // and recovers any overflow buckets by generating them - // as if h.buckets was newly alloced. - _, nextOverflow := makeBucketArray(t, h.B, h.buckets) - if nextOverflow != nil { - // If overflow buckets are created then h.extra - // will have been allocated during initial bucket creation. - h.extra.nextOverflow = nextOverflow - } - - if h.flags&hashWriting == 0 { - fatal("concurrent map writes") - } - h.flags &^= hashWriting -} - -func hashGrow(t *maptype, h *hmap) { - // If we've hit the load factor, get bigger. - // Otherwise, there are too many overflow buckets, - // so keep the same number of buckets and "grow" laterally. - bigger := uint8(1) - if !overLoadFactor(h.count+1, h.B) { - bigger = 0 - h.flags |= sameSizeGrow - } - oldbuckets := h.buckets - newbuckets, nextOverflow := makeBucketArray(t, h.B+bigger, nil) - - flags := h.flags &^ (iterator | oldIterator) - if h.flags&iterator != 0 { - flags |= oldIterator - } - // commit the grow (atomic wrt gc) - h.B += bigger - h.flags = flags - h.oldbuckets = oldbuckets - h.buckets = newbuckets - h.nevacuate = 0 - h.noverflow = 0 - - if h.extra != nil && h.extra.overflow != nil { - // Promote current overflow buckets to the old generation. - if h.extra.oldoverflow != nil { - throw("oldoverflow is not nil") - } - h.extra.oldoverflow = h.extra.overflow - h.extra.overflow = nil - } - if nextOverflow != nil { - if h.extra == nil { - h.extra = new(mapextra) - } - h.extra.nextOverflow = nextOverflow - } - - // the actual copying of the hash table data is done incrementally - // by growWork() and evacuate(). -} - -// overLoadFactor reports whether count items placed in 1<<B buckets is over loadFactor. -func overLoadFactor(count int, B uint8) bool { - return count > abi.OldMapBucketCount && uintptr(count) > loadFactorNum*(bucketShift(B)/loadFactorDen) -} - -// tooManyOverflowBuckets reports whether noverflow buckets is too many for a map with 1<<B buckets. -// Note that most of these overflow buckets must be in sparse use; -// if use was dense, then we'd have already triggered regular map growth. -func tooManyOverflowBuckets(noverflow uint16, B uint8) bool { - // If the threshold is too low, we do extraneous work. - // If the threshold is too high, maps that grow and shrink can hold on to lots of unused memory. - // "too many" means (approximately) as many overflow buckets as regular buckets. - // See incrnoverflow for more details. - if B > 15 { - B = 15 - } - // The compiler doesn't see here that B < 16; mask B to generate shorter shift code. - return noverflow >= uint16(1)<<(B&15) -} - -// growing reports whether h is growing. The growth may be to the same size or bigger. -func (h *hmap) growing() bool { - return h.oldbuckets != nil -} - -// sameSizeGrow reports whether the current growth is to a map of the same size. -func (h *hmap) sameSizeGrow() bool { - return h.flags&sameSizeGrow != 0 -} - -//go:linkname sameSizeGrowForIssue69110Test -func sameSizeGrowForIssue69110Test(h *hmap) bool { - return h.sameSizeGrow() -} - -// noldbuckets calculates the number of buckets prior to the current map growth. -func (h *hmap) noldbuckets() uintptr { - oldB := h.B - if !h.sameSizeGrow() { - oldB-- - } - return bucketShift(oldB) -} - -// oldbucketmask provides a mask that can be applied to calculate n % noldbuckets(). -func (h *hmap) oldbucketmask() uintptr { - return h.noldbuckets() - 1 -} - -func growWork(t *maptype, h *hmap, bucket uintptr) { - // make sure we evacuate the oldbucket corresponding - // to the bucket we're about to use - evacuate(t, h, bucket&h.oldbucketmask()) - - // evacuate one more oldbucket to make progress on growing - if h.growing() { - evacuate(t, h, h.nevacuate) - } -} - -func bucketEvacuated(t *maptype, h *hmap, bucket uintptr) bool { - b := (*bmap)(add(h.oldbuckets, bucket*uintptr(t.BucketSize))) - return evacuated(b) -} - -// evacDst is an evacuation destination. -type evacDst struct { - b *bmap // current destination bucket - i int // key/elem index into b - k unsafe.Pointer // pointer to current key storage - e unsafe.Pointer // pointer to current elem storage -} - -func evacuate(t *maptype, h *hmap, oldbucket uintptr) { - b := (*bmap)(add(h.oldbuckets, oldbucket*uintptr(t.BucketSize))) - newbit := h.noldbuckets() - if !evacuated(b) { - // TODO: reuse overflow buckets instead of using new ones, if there - // is no iterator using the old buckets. (If !oldIterator.) - - // xy contains the x and y (low and high) evacuation destinations. - var xy [2]evacDst - x := &xy[0] - x.b = (*bmap)(add(h.buckets, oldbucket*uintptr(t.BucketSize))) - x.k = add(unsafe.Pointer(x.b), dataOffset) - x.e = add(x.k, abi.OldMapBucketCount*uintptr(t.KeySize)) - - if !h.sameSizeGrow() { - // Only calculate y pointers if we're growing bigger. - // Otherwise GC can see bad pointers. - y := &xy[1] - y.b = (*bmap)(add(h.buckets, (oldbucket+newbit)*uintptr(t.BucketSize))) - y.k = add(unsafe.Pointer(y.b), dataOffset) - y.e = add(y.k, abi.OldMapBucketCount*uintptr(t.KeySize)) - } - - for ; b != nil; b = b.overflow(t) { - k := add(unsafe.Pointer(b), dataOffset) - e := add(k, abi.OldMapBucketCount*uintptr(t.KeySize)) - for i := 0; i < abi.OldMapBucketCount; i, k, e = i+1, add(k, uintptr(t.KeySize)), add(e, uintptr(t.ValueSize)) { - top := b.tophash[i] - if isEmpty(top) { - b.tophash[i] = evacuatedEmpty - continue - } - if top < minTopHash { - throw("bad map state") - } - k2 := k - if t.IndirectKey() { - k2 = *((*unsafe.Pointer)(k2)) - } - var useY uint8 - if !h.sameSizeGrow() { - // Compute hash to make our evacuation decision (whether we need - // to send this key/elem to bucket x or bucket y). - hash := t.Hasher(k2, uintptr(h.hash0)) - if h.flags&iterator != 0 && !t.ReflexiveKey() && !t.Key.Equal(k2, k2) { - // If key != key (NaNs), then the hash could be (and probably - // will be) entirely different from the old hash. Moreover, - // it isn't reproducible. Reproducibility is required in the - // presence of iterators, as our evacuation decision must - // match whatever decision the iterator made. - // Fortunately, we have the freedom to send these keys either - // way. Also, tophash is meaningless for these kinds of keys. - // We let the low bit of tophash drive the evacuation decision. - // We recompute a new random tophash for the next level so - // these keys will get evenly distributed across all buckets - // after multiple grows. - useY = top & 1 - top = tophash(hash) - } else { - if hash&newbit != 0 { - useY = 1 - } - } - } - - if evacuatedX+1 != evacuatedY || evacuatedX^1 != evacuatedY { - throw("bad evacuatedN") - } - - b.tophash[i] = evacuatedX + useY // evacuatedX + 1 == evacuatedY - dst := &xy[useY] // evacuation destination - - if dst.i == abi.OldMapBucketCount { - dst.b = h.newoverflow(t, dst.b) - dst.i = 0 - dst.k = add(unsafe.Pointer(dst.b), dataOffset) - dst.e = add(dst.k, abi.OldMapBucketCount*uintptr(t.KeySize)) - } - dst.b.tophash[dst.i&(abi.OldMapBucketCount-1)] = top // mask dst.i as an optimization, to avoid a bounds check - if t.IndirectKey() { - *(*unsafe.Pointer)(dst.k) = k2 // copy pointer - } else { - typedmemmove(t.Key, dst.k, k) // copy elem - } - if t.IndirectElem() { - *(*unsafe.Pointer)(dst.e) = *(*unsafe.Pointer)(e) - } else { - typedmemmove(t.Elem, dst.e, e) - } - dst.i++ - // These updates might push these pointers past the end of the - // key or elem arrays. That's ok, as we have the overflow pointer - // at the end of the bucket to protect against pointing past the - // end of the bucket. - dst.k = add(dst.k, uintptr(t.KeySize)) - dst.e = add(dst.e, uintptr(t.ValueSize)) - } - } - // Unlink the overflow buckets & clear key/elem to help GC. - if h.flags&oldIterator == 0 && t.Bucket.Pointers() { - b := add(h.oldbuckets, oldbucket*uintptr(t.BucketSize)) - // Preserve b.tophash because the evacuation - // state is maintained there. - ptr := add(b, dataOffset) - n := uintptr(t.BucketSize) - dataOffset - memclrHasPointers(ptr, n) - } - } - - if oldbucket == h.nevacuate { - advanceEvacuationMark(h, t, newbit) - } -} - -func advanceEvacuationMark(h *hmap, t *maptype, newbit uintptr) { - h.nevacuate++ - // Experiments suggest that 1024 is overkill by at least an order of magnitude. - // Put it in there as a safeguard anyway, to ensure O(1) behavior. - stop := h.nevacuate + 1024 - if stop > newbit { - stop = newbit - } - for h.nevacuate != stop && bucketEvacuated(t, h, h.nevacuate) { - h.nevacuate++ - } - if h.nevacuate == newbit { // newbit == # of oldbuckets - // Growing is all done. Free old main bucket array. - h.oldbuckets = nil - // Can discard old overflow buckets as well. - // If they are still referenced by an iterator, - // then the iterator holds a pointers to the slice. - if h.extra != nil { - h.extra.oldoverflow = nil - } - h.flags &^= sameSizeGrow - } -} - -// Reflect stubs. Called from ../reflect/asm_*.s - -// reflect_makemap is for package reflect, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - gitee.com/quant1x/gox -// - github.com/modern-go/reflect2 -// - github.com/goccy/go-json -// - github.com/RomiChan/protobuf -// - github.com/segmentio/encoding -// - github.com/v2pro/plz -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname reflect_makemap reflect.makemap -func reflect_makemap(t *maptype, cap int) *hmap { - // Check invariants and reflects math. - if t.Key.Equal == nil { - throw("runtime.reflect_makemap: unsupported map key type") - } - if t.Key.Size_ > abi.OldMapMaxKeyBytes && (!t.IndirectKey() || t.KeySize != uint8(goarch.PtrSize)) || - t.Key.Size_ <= abi.OldMapMaxKeyBytes && (t.IndirectKey() || t.KeySize != uint8(t.Key.Size_)) { - throw("key size wrong") - } - if t.Elem.Size_ > abi.OldMapMaxElemBytes && (!t.IndirectElem() || t.ValueSize != uint8(goarch.PtrSize)) || - t.Elem.Size_ <= abi.OldMapMaxElemBytes && (t.IndirectElem() || t.ValueSize != uint8(t.Elem.Size_)) { - throw("elem size wrong") - } - if t.Key.Align_ > abi.OldMapBucketCount { - throw("key align too big") - } - if t.Elem.Align_ > abi.OldMapBucketCount { - throw("elem align too big") - } - if t.Key.Size_%uintptr(t.Key.Align_) != 0 { - throw("key size not a multiple of key align") - } - if t.Elem.Size_%uintptr(t.Elem.Align_) != 0 { - throw("elem size not a multiple of elem align") - } - if abi.OldMapBucketCount < 8 { - throw("bucketsize too small for proper alignment") - } - if dataOffset%uintptr(t.Key.Align_) != 0 { - throw("need padding in bucket (key)") - } - if dataOffset%uintptr(t.Elem.Align_) != 0 { - throw("need padding in bucket (elem)") - } - - return makemap(t, cap, nil) -} - -// reflect_mapaccess is for package reflect, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - gitee.com/quant1x/gox -// - github.com/modern-go/reflect2 -// - github.com/v2pro/plz -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname reflect_mapaccess reflect.mapaccess -func reflect_mapaccess(t *maptype, h *hmap, key unsafe.Pointer) unsafe.Pointer { - elem, ok := mapaccess2(t, h, key) - if !ok { - // reflect wants nil for a missing element - elem = nil - } - return elem -} - -//go:linkname reflect_mapaccess_faststr reflect.mapaccess_faststr -func reflect_mapaccess_faststr(t *maptype, h *hmap, key string) unsafe.Pointer { - elem, ok := mapaccess2_faststr(t, h, key) - if !ok { - // reflect wants nil for a missing element - elem = nil - } - return elem -} - -// reflect_mapassign is for package reflect, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - gitee.com/quant1x/gox -// - github.com/v2pro/plz -// -// Do not remove or change the type signature. -// -//go:linkname reflect_mapassign reflect.mapassign0 -func reflect_mapassign(t *maptype, h *hmap, key unsafe.Pointer, elem unsafe.Pointer) { - p := mapassign(t, h, key) - typedmemmove(t.Elem, p, elem) -} - -//go:linkname reflect_mapassign_faststr reflect.mapassign_faststr0 -func reflect_mapassign_faststr(t *maptype, h *hmap, key string, elem unsafe.Pointer) { - p := mapassign_faststr(t, h, key) - typedmemmove(t.Elem, p, elem) -} - -//go:linkname reflect_mapdelete reflect.mapdelete -func reflect_mapdelete(t *maptype, h *hmap, key unsafe.Pointer) { - mapdelete(t, h, key) -} - -//go:linkname reflect_mapdelete_faststr reflect.mapdelete_faststr -func reflect_mapdelete_faststr(t *maptype, h *hmap, key string) { - mapdelete_faststr(t, h, key) -} - -// reflect_mapiterinit is for package reflect, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/modern-go/reflect2 -// - gitee.com/quant1x/gox -// - github.com/v2pro/plz -// - github.com/wI2L/jettison -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname reflect_mapiterinit reflect.mapiterinit -func reflect_mapiterinit(t *maptype, h *hmap, it *hiter) { - mapiterinit(t, h, it) -} - -// reflect_mapiternext is for package reflect, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - gitee.com/quant1x/gox -// - github.com/modern-go/reflect2 -// - github.com/goccy/go-json -// - github.com/v2pro/plz -// - github.com/wI2L/jettison -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname reflect_mapiternext reflect.mapiternext -func reflect_mapiternext(it *hiter) { - mapiternext(it) -} - -// reflect_mapiterkey was for package reflect, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/goccy/go-json -// - gonum.org/v1/gonum -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname reflect_mapiterkey reflect.mapiterkey -func reflect_mapiterkey(it *hiter) unsafe.Pointer { - return it.key -} - -// reflect_mapiterelem was for package reflect, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/goccy/go-json -// - gonum.org/v1/gonum -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname reflect_mapiterelem reflect.mapiterelem -func reflect_mapiterelem(it *hiter) unsafe.Pointer { - return it.elem -} - -// reflect_maplen is for package reflect, -// but widely used packages access it using linkname. -// Notable members of the hall of shame include: -// - github.com/goccy/go-json -// - github.com/wI2L/jettison -// -// Do not remove or change the type signature. -// See go.dev/issue/67401. -// -//go:linkname reflect_maplen reflect.maplen -func reflect_maplen(h *hmap) int { - if h == nil { - return 0 - } - if raceenabled { - callerpc := sys.GetCallerPC() - racereadpc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(reflect_maplen)) - } - return h.count -} - -//go:linkname reflect_mapclear reflect.mapclear -func reflect_mapclear(t *maptype, h *hmap) { - mapclear(t, h) -} - -//go:linkname reflectlite_maplen internal/reflectlite.maplen -func reflectlite_maplen(h *hmap) int { - if h == nil { - return 0 - } - if raceenabled { - callerpc := sys.GetCallerPC() - racereadpc(unsafe.Pointer(h), callerpc, abi.FuncPCABIInternal(reflect_maplen)) - } - return h.count -} - -// mapinitnoop is a no-op function known the Go linker; if a given global -// map (of the right size) is determined to be dead, the linker will -// rewrite the relocation (from the package init func) from the outlined -// map init function to this symbol. Defined in assembly so as to avoid -// complications with instrumentation (coverage, etc). -func mapinitnoop() - -// mapclone for implementing maps.Clone -// -//go:linkname mapclone maps.clone -func mapclone(m any) any { - e := efaceOf(&m) - e.data = unsafe.Pointer(mapclone2((*maptype)(unsafe.Pointer(e._type)), (*hmap)(e.data))) - return m -} - -// moveToBmap moves a bucket from src to dst. It returns the destination bucket or new destination bucket if it overflows -// and the pos that the next key/value will be written, if pos == bucketCnt means needs to written in overflow bucket. -func moveToBmap(t *maptype, h *hmap, dst *bmap, pos int, src *bmap) (*bmap, int) { - for i := 0; i < abi.OldMapBucketCount; i++ { - if isEmpty(src.tophash[i]) { - continue - } - - for ; pos < abi.OldMapBucketCount; pos++ { - if isEmpty(dst.tophash[pos]) { - break - } - } - - if pos == abi.OldMapBucketCount { - dst = h.newoverflow(t, dst) - pos = 0 - } - - srcK := add(unsafe.Pointer(src), dataOffset+uintptr(i)*uintptr(t.KeySize)) - srcEle := add(unsafe.Pointer(src), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+uintptr(i)*uintptr(t.ValueSize)) - dstK := add(unsafe.Pointer(dst), dataOffset+uintptr(pos)*uintptr(t.KeySize)) - dstEle := add(unsafe.Pointer(dst), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+uintptr(pos)*uintptr(t.ValueSize)) - - dst.tophash[pos] = src.tophash[i] - if t.IndirectKey() { - srcK = *(*unsafe.Pointer)(srcK) - if t.NeedKeyUpdate() { - kStore := newobject(t.Key) - typedmemmove(t.Key, kStore, srcK) - srcK = kStore - } - // Note: if NeedKeyUpdate is false, then the memory - // used to store the key is immutable, so we can share - // it between the original map and its clone. - *(*unsafe.Pointer)(dstK) = srcK - } else { - typedmemmove(t.Key, dstK, srcK) - } - if t.IndirectElem() { - srcEle = *(*unsafe.Pointer)(srcEle) - eStore := newobject(t.Elem) - typedmemmove(t.Elem, eStore, srcEle) - *(*unsafe.Pointer)(dstEle) = eStore - } else { - typedmemmove(t.Elem, dstEle, srcEle) - } - pos++ - h.count++ - } - return dst, pos -} - -func mapclone2(t *maptype, src *hmap) *hmap { - hint := src.count - if overLoadFactor(hint, src.B) { - // Note: in rare cases (e.g. during a same-sized grow) the map - // can be overloaded. Make sure we don't allocate a destination - // bucket array larger than the source bucket array. - // This will cause the cloned map to be overloaded also, - // but that's better than crashing. See issue 69110. - hint = int(loadFactorNum * (bucketShift(src.B) / loadFactorDen)) - } - dst := makemap(t, hint, nil) - dst.hash0 = src.hash0 - dst.nevacuate = 0 - // flags do not need to be copied here, just like a new map has no flags. - - if src.count == 0 { - return dst - } - - if src.flags&hashWriting != 0 { - fatal("concurrent map clone and map write") - } - - if src.B == 0 && !(t.IndirectKey() && t.NeedKeyUpdate()) && !t.IndirectElem() { - // Quick copy for small maps. - dst.buckets = newobject(t.Bucket) - dst.count = src.count - typedmemmove(t.Bucket, dst.buckets, src.buckets) - return dst - } - - if dst.B == 0 { - dst.buckets = newobject(t.Bucket) - } - dstArraySize := int(bucketShift(dst.B)) - srcArraySize := int(bucketShift(src.B)) - for i := 0; i < dstArraySize; i++ { - dstBmap := (*bmap)(add(dst.buckets, uintptr(i*int(t.BucketSize)))) - pos := 0 - for j := 0; j < srcArraySize; j += dstArraySize { - srcBmap := (*bmap)(add(src.buckets, uintptr((i+j)*int(t.BucketSize)))) - for srcBmap != nil { - dstBmap, pos = moveToBmap(t, dst, dstBmap, pos, srcBmap) - srcBmap = srcBmap.overflow(t) - } - } - } - - if src.oldbuckets == nil { - return dst - } - - oldB := src.B - srcOldbuckets := src.oldbuckets - if !src.sameSizeGrow() { - oldB-- - } - oldSrcArraySize := int(bucketShift(oldB)) - - for i := 0; i < oldSrcArraySize; i++ { - srcBmap := (*bmap)(add(srcOldbuckets, uintptr(i*int(t.BucketSize)))) - if evacuated(srcBmap) { - continue - } - - if oldB >= dst.B { // main bucket bits in dst is less than oldB bits in src - dstBmap := (*bmap)(add(dst.buckets, (uintptr(i)&bucketMask(dst.B))*uintptr(t.BucketSize))) - for dstBmap.overflow(t) != nil { - dstBmap = dstBmap.overflow(t) - } - pos := 0 - for srcBmap != nil { - dstBmap, pos = moveToBmap(t, dst, dstBmap, pos, srcBmap) - srcBmap = srcBmap.overflow(t) - } - continue - } - - // oldB < dst.B, so a single source bucket may go to multiple destination buckets. - // Process entries one at a time. - for srcBmap != nil { - // move from oldBlucket to new bucket - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - if isEmpty(srcBmap.tophash[i]) { - continue - } - - if src.flags&hashWriting != 0 { - fatal("concurrent map clone and map write") - } - - srcK := add(unsafe.Pointer(srcBmap), dataOffset+i*uintptr(t.KeySize)) - if t.IndirectKey() { - srcK = *((*unsafe.Pointer)(srcK)) - } - - srcEle := add(unsafe.Pointer(srcBmap), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+i*uintptr(t.ValueSize)) - if t.IndirectElem() { - srcEle = *((*unsafe.Pointer)(srcEle)) - } - dstEle := mapassign(t, dst, srcK) - typedmemmove(t.Elem, dstEle, srcEle) - } - srcBmap = srcBmap.overflow(t) - } - } - return dst -} - -// keys for implementing maps.keys -// -//go:linkname keys maps.keys -func keys(m any, p unsafe.Pointer) { - e := efaceOf(&m) - t := (*maptype)(unsafe.Pointer(e._type)) - h := (*hmap)(e.data) - - if h == nil || h.count == 0 { - return - } - s := (*slice)(p) - r := int(rand()) - offset := uint8(r >> h.B & (abi.OldMapBucketCount - 1)) - if h.B == 0 { - copyKeys(t, h, (*bmap)(h.buckets), s, offset) - return - } - arraySize := int(bucketShift(h.B)) - buckets := h.buckets - for i := 0; i < arraySize; i++ { - bucket := (i + r) & (arraySize - 1) - b := (*bmap)(add(buckets, uintptr(bucket)*uintptr(t.BucketSize))) - copyKeys(t, h, b, s, offset) - } - - if h.growing() { - oldArraySize := int(h.noldbuckets()) - for i := 0; i < oldArraySize; i++ { - bucket := (i + r) & (oldArraySize - 1) - b := (*bmap)(add(h.oldbuckets, uintptr(bucket)*uintptr(t.BucketSize))) - if evacuated(b) { - continue - } - copyKeys(t, h, b, s, offset) - } - } - return -} - -func copyKeys(t *maptype, h *hmap, b *bmap, s *slice, offset uint8) { - for b != nil { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - offi := (i + uintptr(offset)) & (abi.OldMapBucketCount - 1) - if isEmpty(b.tophash[offi]) { - continue - } - if h.flags&hashWriting != 0 { - fatal("concurrent map read and map write") - } - k := add(unsafe.Pointer(b), dataOffset+offi*uintptr(t.KeySize)) - if t.IndirectKey() { - k = *((*unsafe.Pointer)(k)) - } - if s.len >= s.cap { - fatal("concurrent map read and map write") - } - typedmemmove(t.Key, add(s.array, uintptr(s.len)*uintptr(t.Key.Size())), k) - s.len++ - } - b = b.overflow(t) - } -} - -// values for implementing maps.values -// -//go:linkname values maps.values -func values(m any, p unsafe.Pointer) { - e := efaceOf(&m) - t := (*maptype)(unsafe.Pointer(e._type)) - h := (*hmap)(e.data) - if h == nil || h.count == 0 { - return - } - s := (*slice)(p) - r := int(rand()) - offset := uint8(r >> h.B & (abi.OldMapBucketCount - 1)) - if h.B == 0 { - copyValues(t, h, (*bmap)(h.buckets), s, offset) - return - } - arraySize := int(bucketShift(h.B)) - buckets := h.buckets - for i := 0; i < arraySize; i++ { - bucket := (i + r) & (arraySize - 1) - b := (*bmap)(add(buckets, uintptr(bucket)*uintptr(t.BucketSize))) - copyValues(t, h, b, s, offset) - } - - if h.growing() { - oldArraySize := int(h.noldbuckets()) - for i := 0; i < oldArraySize; i++ { - bucket := (i + r) & (oldArraySize - 1) - b := (*bmap)(add(h.oldbuckets, uintptr(bucket)*uintptr(t.BucketSize))) - if evacuated(b) { - continue - } - copyValues(t, h, b, s, offset) - } - } - return -} - -func copyValues(t *maptype, h *hmap, b *bmap, s *slice, offset uint8) { - for b != nil { - for i := uintptr(0); i < abi.OldMapBucketCount; i++ { - offi := (i + uintptr(offset)) & (abi.OldMapBucketCount - 1) - if isEmpty(b.tophash[offi]) { - continue - } - - if h.flags&hashWriting != 0 { - fatal("concurrent map read and map write") - } - - ele := add(unsafe.Pointer(b), dataOffset+abi.OldMapBucketCount*uintptr(t.KeySize)+offi*uintptr(t.ValueSize)) - if t.IndirectElem() { - ele = *((*unsafe.Pointer)(ele)) - } - if s.len >= s.cap { - fatal("concurrent map read and map write") - } - typedmemmove(t.Elem, add(s.array, uintptr(s.len)*uintptr(t.Elem.Size())), ele) - s.len++ - } - b = b.overflow(t) - } -} diff --git a/src/runtime/map_noswiss_test.go b/src/runtime/map_noswiss_test.go deleted file mode 100644 index 5af7b7b8c8..0000000000 --- a/src/runtime/map_noswiss_test.go +++ /dev/null @@ -1,214 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !goexperiment.swissmap - -package runtime_test - -import ( - "internal/abi" - "internal/goarch" - "runtime" - "slices" - "testing" -) - -func TestHmapSize(t *testing.T) { - // The structure of hmap is defined in runtime/map.go - // and in cmd/compile/internal/reflectdata/map.go and must be in sync. - // The size of hmap should be 56 bytes on 64 bit and 36 bytes on 32 bit platforms. - var hmapSize = uintptr(2*8 + 5*goarch.PtrSize) - if runtime.RuntimeHmapSize != hmapSize { - t.Errorf("sizeof(runtime.hmap{})==%d, want %d", runtime.RuntimeHmapSize, hmapSize) - } -} - -func TestLoadFactor(t *testing.T) { - for b := uint8(0); b < 20; b++ { - count := 13 * (1 << b) / 2 // 6.5 - if b == 0 { - count = 8 - } - if runtime.OverLoadFactor(count, b) { - t.Errorf("OverLoadFactor(%d,%d)=true, want false", count, b) - } - if !runtime.OverLoadFactor(count+1, b) { - t.Errorf("OverLoadFactor(%d,%d)=false, want true", count+1, b) - } - } -} - -func TestMapIterOrder(t *testing.T) { - sizes := []int{3, 7, 9, 15} - if abi.OldMapBucketCountBits >= 5 { - // it gets flaky (often only one iteration order) at size 3 when abi.MapBucketCountBits >=5. - t.Fatalf("This test becomes flaky if abi.MapBucketCountBits(=%d) is 5 or larger", abi.OldMapBucketCountBits) - } - for _, n := range sizes { - for i := 0; i < 1000; i++ { - // Make m be {0: true, 1: true, ..., n-1: true}. - m := make(map[int]bool) - for i := 0; i < n; i++ { - m[i] = true - } - // Check that iterating over the map produces at least two different orderings. - ord := func() []int { - var s []int - for key := range m { - s = append(s, key) - } - return s - } - first := ord() - ok := false - for try := 0; try < 100; try++ { - if !slices.Equal(first, ord()) { - ok = true - break - } - } - if !ok { - t.Errorf("Map with n=%d elements had consistent iteration order: %v", n, first) - break - } - } - } -} - -const bs = abi.OldMapBucketCount - -// belowOverflow should be a pretty-full pair of buckets; -// atOverflow is 1/8 bs larger = 13/8 buckets or two buckets -// that are 13/16 full each, which is the overflow boundary. -// Adding one to that should ensure overflow to the next higher size. -const ( - belowOverflow = bs * 3 / 2 // 1.5 bs = 2 buckets @ 75% - atOverflow = belowOverflow + bs/8 // 2 buckets at 13/16 fill. -) - -var mapBucketTests = [...]struct { - n int // n is the number of map elements - noescape int // number of expected buckets for non-escaping map - escape int // number of expected buckets for escaping map -}{ - {-(1 << 30), 1, 1}, - {-1, 1, 1}, - {0, 1, 1}, - {1, 1, 1}, - {bs, 1, 1}, - {bs + 1, 2, 2}, - {belowOverflow, 2, 2}, // 1.5 bs = 2 buckets @ 75% - {atOverflow + 1, 4, 4}, // 13/8 bs + 1 == overflow to 4 - - {2 * belowOverflow, 4, 4}, // 3 bs = 4 buckets @75% - {2*atOverflow + 1, 8, 8}, // 13/4 bs + 1 = overflow to 8 - - {4 * belowOverflow, 8, 8}, // 6 bs = 8 buckets @ 75% - {4*atOverflow + 1, 16, 16}, // 13/2 bs + 1 = overflow to 16 -} - -func TestMapBuckets(t *testing.T) { - // Test that maps of different sizes have the right number of buckets. - // Non-escaping maps with small buckets (like map[int]int) never - // have a nil bucket pointer due to starting with preallocated buckets - // on the stack. Escaping maps start with a non-nil bucket pointer if - // hint size is above bucketCnt and thereby have more than one bucket. - // These tests depend on bucketCnt and loadFactor* in map.go. - t.Run("mapliteral", func(t *testing.T) { - for _, tt := range mapBucketTests { - localMap := map[int]int{} - if runtime.MapBucketsPointerIsNil(localMap) { - t.Errorf("no escape: buckets pointer is nil for non-escaping map") - } - for i := 0; i < tt.n; i++ { - localMap[i] = i - } - if got := runtime.MapBucketsCount(localMap); got != tt.noescape { - t.Errorf("no escape: n=%d want %d buckets, got %d", tt.n, tt.noescape, got) - } - escapingMap := runtime.Escape(map[int]int{}) - if count := runtime.MapBucketsCount(escapingMap); count > 1 && runtime.MapBucketsPointerIsNil(escapingMap) { - t.Errorf("escape: buckets pointer is nil for n=%d buckets", count) - } - for i := 0; i < tt.n; i++ { - escapingMap[i] = i - } - if got := runtime.MapBucketsCount(escapingMap); got != tt.escape { - t.Errorf("escape n=%d want %d buckets, got %d", tt.n, tt.escape, got) - } - } - }) - t.Run("nohint", func(t *testing.T) { - for _, tt := range mapBucketTests { - localMap := make(map[int]int) - if runtime.MapBucketsPointerIsNil(localMap) { - t.Errorf("no escape: buckets pointer is nil for non-escaping map") - } - for i := 0; i < tt.n; i++ { - localMap[i] = i - } - if got := runtime.MapBucketsCount(localMap); got != tt.noescape { - t.Errorf("no escape: n=%d want %d buckets, got %d", tt.n, tt.noescape, got) - } - escapingMap := runtime.Escape(make(map[int]int)) - if count := runtime.MapBucketsCount(escapingMap); count > 1 && runtime.MapBucketsPointerIsNil(escapingMap) { - t.Errorf("escape: buckets pointer is nil for n=%d buckets", count) - } - for i := 0; i < tt.n; i++ { - escapingMap[i] = i - } - if got := runtime.MapBucketsCount(escapingMap); got != tt.escape { - t.Errorf("escape: n=%d want %d buckets, got %d", tt.n, tt.escape, got) - } - } - }) - t.Run("makemap", func(t *testing.T) { - for _, tt := range mapBucketTests { - localMap := make(map[int]int, tt.n) - if runtime.MapBucketsPointerIsNil(localMap) { - t.Errorf("no escape: buckets pointer is nil for non-escaping map") - } - for i := 0; i < tt.n; i++ { - localMap[i] = i - } - if got := runtime.MapBucketsCount(localMap); got != tt.noescape { - t.Errorf("no escape: n=%d want %d buckets, got %d", tt.n, tt.noescape, got) - } - escapingMap := runtime.Escape(make(map[int]int, tt.n)) - if count := runtime.MapBucketsCount(escapingMap); count > 1 && runtime.MapBucketsPointerIsNil(escapingMap) { - t.Errorf("escape: buckets pointer is nil for n=%d buckets", count) - } - for i := 0; i < tt.n; i++ { - escapingMap[i] = i - } - if got := runtime.MapBucketsCount(escapingMap); got != tt.escape { - t.Errorf("escape: n=%d want %d buckets, got %d", tt.n, tt.escape, got) - } - } - }) - t.Run("makemap64", func(t *testing.T) { - for _, tt := range mapBucketTests { - localMap := make(map[int]int, int64(tt.n)) - if runtime.MapBucketsPointerIsNil(localMap) { - t.Errorf("no escape: buckets pointer is nil for non-escaping map") - } - for i := 0; i < tt.n; i++ { - localMap[i] = i - } - if got := runtime.MapBucketsCount(localMap); got != tt.noescape { - t.Errorf("no escape: n=%d want %d buckets, got %d", tt.n, tt.noescape, got) - } - escapingMap := runtime.Escape(make(map[int]int, tt.n)) - if count := runtime.MapBucketsCount(escapingMap); count > 1 && runtime.MapBucketsPointerIsNil(escapingMap) { - t.Errorf("escape: buckets pointer is nil for n=%d buckets", count) - } - for i := 0; i < tt.n; i++ { - escapingMap[i] = i - } - if got := runtime.MapBucketsCount(escapingMap); got != tt.escape { - t.Errorf("escape: n=%d want %d buckets, got %d", tt.n, tt.escape, got) - } - } - }) -} diff --git a/src/runtime/map_swiss_test.go b/src/runtime/map_swiss_test.go deleted file mode 100644 index d5c9fdbe46..0000000000 --- a/src/runtime/map_swiss_test.go +++ /dev/null @@ -1,75 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build goexperiment.swissmap - -package runtime_test - -import ( - "internal/abi" - "internal/goarch" - "internal/runtime/maps" - "slices" - "testing" - "unsafe" -) - -func TestHmapSize(t *testing.T) { - // The structure of Map is defined in internal/runtime/maps/map.go - // and in cmd/compile/internal/reflectdata/map_swiss.go and must be in sync. - // The size of Map should be 48 bytes on 64 bit and 32 bytes on 32 bit platforms. - wantSize := uintptr(2*8 + 4*goarch.PtrSize) - gotSize := unsafe.Sizeof(maps.Map{}) - if gotSize != wantSize { - t.Errorf("sizeof(maps.Map{})==%d, want %d", gotSize, wantSize) - } -} - -// See also reflect_test.TestGroupSizeZero. -func TestGroupSizeZero(t *testing.T) { - var m map[struct{}]struct{} - mTyp := abi.TypeOf(m) - mt := (*abi.SwissMapType)(unsafe.Pointer(mTyp)) - - // internal/runtime/maps when create pointers to slots, even if slots - // are size 0. The compiler should have reserved an extra word to - // ensure that pointers to the zero-size type at the end of group are - // valid. - if mt.Group.Size() <= 8 { - t.Errorf("Group size got %d want >8", mt.Group.Size()) - } -} - -func TestMapIterOrder(t *testing.T) { - sizes := []int{3, 7, 9, 15} - for _, n := range sizes { - for i := 0; i < 1000; i++ { - // Make m be {0: true, 1: true, ..., n-1: true}. - m := make(map[int]bool) - for i := 0; i < n; i++ { - m[i] = true - } - // Check that iterating over the map produces at least two different orderings. - ord := func() []int { - var s []int - for key := range m { - s = append(s, key) - } - return s - } - first := ord() - ok := false - for try := 0; try < 100; try++ { - if !slices.Equal(first, ord()) { - ok = true - break - } - } - if !ok { - t.Errorf("Map with n=%d elements had consistent iteration order: %v", n, first) - break - } - } - } -} diff --git a/src/runtime/map_test.go b/src/runtime/map_test.go index b1ff02d851..7fe8399130 100644 --- a/src/runtime/map_test.go +++ b/src/runtime/map_test.go @@ -6,7 +6,9 @@ package runtime_test import ( "fmt" - "internal/goexperiment" + "internal/abi" + "internal/goarch" + "internal/runtime/maps" "internal/testenv" "math" "os" @@ -812,31 +814,6 @@ func TestIncrementAfterBulkClearKeyStringValueInt(t *testing.T) { } } -func TestMapTombstones(t *testing.T) { - m := map[int]int{} - const N = 10000 - // Fill a map. - for i := 0; i < N; i++ { - m[i] = i - } - runtime.MapTombstoneCheck(m) - // Delete half of the entries. - for i := 0; i < N; i += 2 { - delete(m, i) - } - runtime.MapTombstoneCheck(m) - // Add new entries to fill in holes. - for i := N; i < 3*N/2; i++ { - m[i] = i - } - runtime.MapTombstoneCheck(m) - // Delete everything. - for i := 0; i < 3*N/2; i++ { - delete(m, i) - } - runtime.MapTombstoneCheck(m) -} - type canString int func (c canString) String() string { @@ -1060,44 +1037,6 @@ func TestEmptyMapWithInterfaceKey(t *testing.T) { }) } -func TestMapKeys(t *testing.T) { - if goexperiment.SwissMap { - t.Skip("mapkeys not implemented for swissmaps") - } - - type key struct { - s string - pad [128]byte // sizeof(key) > abi.MapMaxKeyBytes - } - m := map[key]int{{s: "a"}: 1, {s: "b"}: 2} - keys := make([]key, 0, len(m)) - runtime.MapKeys(m, unsafe.Pointer(&keys)) - for _, k := range keys { - if len(k.s) != 1 { - t.Errorf("len(k.s) == %d, want 1", len(k.s)) - } - } -} - -func TestMapValues(t *testing.T) { - if goexperiment.SwissMap { - t.Skip("mapvalues not implemented for swissmaps") - } - - type val struct { - s string - pad [128]byte // sizeof(val) > abi.MapMaxElemBytes - } - m := map[int]val{1: {s: "a"}, 2: {s: "b"}} - vals := make([]val, 0, len(m)) - runtime.MapValues(m, unsafe.Pointer(&vals)) - for _, v := range vals { - if len(v.s) != 1 { - t.Errorf("len(v.s) == %d, want 1", len(v.s)) - } - } -} - func computeHash() uintptr { var v struct{} return runtime.MemHash(unsafe.Pointer(&v), 0, unsafe.Sizeof(v)) @@ -1202,3 +1141,62 @@ func TestMapIterDeleteReplace(t *testing.T) { }) } } + +func TestHmapSize(t *testing.T) { + // The structure of Map is defined in internal/runtime/maps/map.go + // and in cmd/compile/internal/reflectdata/map.go and must be in sync. + // The size of Map should be 48 bytes on 64 bit and 32 bytes on 32 bit platforms. + wantSize := uintptr(2*8 + 4*goarch.PtrSize) + gotSize := unsafe.Sizeof(maps.Map{}) + if gotSize != wantSize { + t.Errorf("sizeof(maps.Map{})==%d, want %d", gotSize, wantSize) + } +} + +// See also reflect_test.TestGroupSizeZero. +func TestGroupSizeZero(t *testing.T) { + var m map[struct{}]struct{} + mTyp := abi.TypeOf(m) + mt := (*abi.MapType)(unsafe.Pointer(mTyp)) + + // internal/runtime/maps when create pointers to slots, even if slots + // are size 0. The compiler should have reserved an extra word to + // ensure that pointers to the zero-size type at the end of group are + // valid. + if mt.Group.Size() <= 8 { + t.Errorf("Group size got %d want >8", mt.Group.Size()) + } +} + +func TestMapIterOrder(t *testing.T) { + sizes := []int{3, 7, 9, 15} + for _, n := range sizes { + for i := 0; i < 1000; i++ { + // Make m be {0: true, 1: true, ..., n-1: true}. + m := make(map[int]bool) + for i := 0; i < n; i++ { + m[i] = true + } + // Check that iterating over the map produces at least two different orderings. + ord := func() []int { + var s []int + for key := range m { + s = append(s, key) + } + return s + } + first := ord() + ok := false + for try := 0; try < 100; try++ { + if !slices.Equal(first, ord()) { + ok = true + break + } + } + if !ok { + t.Errorf("Map with n=%d elements had consistent iteration order: %v", n, first) + break + } + } + } +} diff --git a/src/runtime/mbitmap.go b/src/runtime/mbitmap.go index 7331886af2..9872e5297f 100644 --- a/src/runtime/mbitmap.go +++ b/src/runtime/mbitmap.go @@ -692,7 +692,7 @@ func (span *mspan) writeHeapBitsSmall(x, dataSize uintptr, typ *_type) (scanSize // malloc does not call heapSetType* when there are no pointers. // // There can be read-write races between heapSetType* and things -// that read the heap metadata like scanobject. However, since +// that read the heap metadata like scanObject. However, since // heapSetType* is only used for objects that have not yet been // made reachable, readers will ignore bits being modified by this // function. This does mean this function cannot transiently modify @@ -947,7 +947,7 @@ func doubleCheckTypePointersOfType(s *mspan, typ *_type, addr, size uintptr) { if typ == nil { return } - if typ.Kind_&abi.KindMask == abi.Interface { + if typ.Kind() == abi.Interface { // Interfaces are unfortunately inconsistently handled // when it comes to the type pointer, so it's easy to // produce a lot of false positives here. @@ -1776,7 +1776,7 @@ func pointerMask(ep any) (mask []byte) { t := e._type var et *_type - if t.Kind_&abi.KindMask != abi.Pointer { + if t.Kind() != abi.Pointer { throw("bad argument to getgcmask: expected type to be a pointer to the value type whose mask is being queried") } et = (*ptrtype)(unsafe.Pointer(t)).Elem diff --git a/src/runtime/mcleanup.go b/src/runtime/mcleanup.go index c368730c57..383217aa05 100644 --- a/src/runtime/mcleanup.go +++ b/src/runtime/mcleanup.go @@ -173,14 +173,14 @@ func (c Cleanup) Stop() { // Reached the end of the linked list. Stop searching at this point. break } - if offset == uintptr(s.offset) && _KindSpecialCleanup == s.kind && + if offset == s.offset && _KindSpecialCleanup == s.kind && (*specialCleanup)(unsafe.Pointer(s)).id == c.id { // The special is a cleanup and contains a matching cleanup id. *iter = s.next found = s break } - if offset < uintptr(s.offset) || (offset == uintptr(s.offset) && _KindSpecialCleanup < s.kind) { + if offset < s.offset || (offset == s.offset && _KindSpecialCleanup < s.kind) { // The special is outside the region specified for that kind of // special. The specials are sorted by kind. break diff --git a/src/runtime/mem_windows.go b/src/runtime/mem_windows.go index 75860a4c1d..3db6fc2ba4 100644 --- a/src/runtime/mem_windows.go +++ b/src/runtime/mem_windows.go @@ -26,11 +26,11 @@ const ( // //go:nosplit func sysAllocOS(n uintptr, _ string) unsafe.Pointer { - return unsafe.Pointer(stdcall4(_VirtualAlloc, 0, n, _MEM_COMMIT|_MEM_RESERVE, _PAGE_READWRITE)) + return unsafe.Pointer(stdcall(_VirtualAlloc, 0, n, _MEM_COMMIT|_MEM_RESERVE, _PAGE_READWRITE)) } func sysUnusedOS(v unsafe.Pointer, n uintptr) { - r := stdcall3(_VirtualFree, uintptr(v), n, _MEM_DECOMMIT) + r := stdcall(_VirtualFree, uintptr(v), n, _MEM_DECOMMIT) if r != 0 { return } @@ -46,7 +46,7 @@ func sysUnusedOS(v unsafe.Pointer, n uintptr) { // in the worst case, but that's fast enough. for n > 0 { small := n - for small >= 4096 && stdcall3(_VirtualFree, uintptr(v), small, _MEM_DECOMMIT) == 0 { + for small >= 4096 && stdcall(_VirtualFree, uintptr(v), small, _MEM_DECOMMIT) == 0 { small /= 2 small &^= 4096 - 1 } @@ -60,7 +60,7 @@ func sysUnusedOS(v unsafe.Pointer, n uintptr) { } func sysUsedOS(v unsafe.Pointer, n uintptr) { - p := stdcall4(_VirtualAlloc, uintptr(v), n, _MEM_COMMIT, _PAGE_READWRITE) + p := stdcall(_VirtualAlloc, uintptr(v), n, _MEM_COMMIT, _PAGE_READWRITE) if p == uintptr(v) { return } @@ -71,7 +71,7 @@ func sysUsedOS(v unsafe.Pointer, n uintptr) { k := n for k > 0 { small := k - for small >= 4096 && stdcall4(_VirtualAlloc, uintptr(v), small, _MEM_COMMIT, _PAGE_READWRITE) == 0 { + for small >= 4096 && stdcall(_VirtualAlloc, uintptr(v), small, _MEM_COMMIT, _PAGE_READWRITE) == 0 { small /= 2 small &^= 4096 - 1 } @@ -105,7 +105,7 @@ func sysHugePageCollapseOS(v unsafe.Pointer, n uintptr) { // //go:nosplit func sysFreeOS(v unsafe.Pointer, n uintptr) { - r := stdcall3(_VirtualFree, uintptr(v), 0, _MEM_RELEASE) + r := stdcall(_VirtualFree, uintptr(v), 0, _MEM_RELEASE) if r == 0 { print("runtime: VirtualFree of ", n, " bytes failed with errno=", getlasterror(), "\n") throw("runtime: failed to release pages") @@ -121,13 +121,13 @@ func sysReserveOS(v unsafe.Pointer, n uintptr, _ string) unsafe.Pointer { // v is just a hint. // First try at v. // This will fail if any of [v, v+n) is already reserved. - v = unsafe.Pointer(stdcall4(_VirtualAlloc, uintptr(v), n, _MEM_RESERVE, _PAGE_READWRITE)) + v = unsafe.Pointer(stdcall(_VirtualAlloc, uintptr(v), n, _MEM_RESERVE, _PAGE_READWRITE)) if v != nil { return v } // Next let the kernel choose the address. - return unsafe.Pointer(stdcall4(_VirtualAlloc, 0, n, _MEM_RESERVE, _PAGE_READWRITE)) + return unsafe.Pointer(stdcall(_VirtualAlloc, 0, n, _MEM_RESERVE, _PAGE_READWRITE)) } func sysMapOS(v unsafe.Pointer, n uintptr, _ string) { diff --git a/src/runtime/memclr_mips64x.s b/src/runtime/memclr_mips64x.s index cf3a9c4ab4..3df3728146 100644 --- a/src/runtime/memclr_mips64x.s +++ b/src/runtime/memclr_mips64x.s @@ -71,29 +71,93 @@ msa_large_loop: no_msa: // if less than 8 bytes, do one byte at a time SGTU $8, R2, R3 - BNE R3, out + BNE R3, check4 - // do one byte at a time until 8-aligned + // Check alignment AND $7, R1, R3 - BEQ R3, words + BEQ R3, aligned + + // Zero one byte at a time until we reach 8 byte alignment. + MOVV $8, R5 + SUBV R3, R5, R3 + SUBV R3, R2, R2 +align: + SUBV $1, R3 MOVB R0, (R1) ADDV $1, R1 - JMP -4(PC) + BNE R3, align -words: - // do 8 bytes at a time if there is room - ADDV $-7, R4, R2 +aligned: + SGTU $8, R2, R3 + BNE R3, check4 + SGTU $16, R2, R3 + BNE R3, zero8 + SGTU $32, R2, R3 + BNE R3, zero16 + SGTU $64, R2, R3 + BNE R3, zero32 +loop64: + MOVV R0, (R1) + MOVV R0, 8(R1) + MOVV R0, 16(R1) + MOVV R0, 24(R1) + MOVV R0, 32(R1) + MOVV R0, 40(R1) + MOVV R0, 48(R1) + MOVV R0, 56(R1) + ADDV $64, R1 + SUBV $64, R2 + SGTU $64, R2, R3 + BEQ R0, R3, loop64 + BEQ R2, done - SGTU R2, R1, R3 - BEQ R3, out +check32: + SGTU $32, R2, R3 + BNE R3, check16 +zero32: + MOVV R0, (R1) + MOVV R0, 8(R1) + MOVV R0, 16(R1) + MOVV R0, 24(R1) + ADDV $32, R1 + SUBV $32, R2 + BEQ R2, done + +check16: + SGTU $16, R2, R3 + BNE R3, check8 +zero16: + MOVV R0, (R1) + MOVV R0, 8(R1) + ADDV $16, R1 + SUBV $16, R2 + BEQ R2, done + +check8: + SGTU $8, R2, R3 + BNE R3, check4 +zero8: MOVV R0, (R1) ADDV $8, R1 - JMP -4(PC) + SUBV $8, R2 + BEQ R2, done -out: +check4: + SGTU $4, R2, R3 + BNE R3, loop1 +zero4: + MOVB R0, (R1) + MOVB R0, 1(R1) + MOVB R0, 2(R1) + MOVB R0, 3(R1) + ADDV $4, R1 + SUBV $4, R2 + +loop1: BEQ R1, R4, done MOVB R0, (R1) ADDV $1, R1 - JMP -3(PC) + JMP loop1 done: RET + diff --git a/src/runtime/memclr_s390x.s b/src/runtime/memclr_s390x.s index 656e96998c..392057565e 100644 --- a/src/runtime/memclr_s390x.s +++ b/src/runtime/memclr_s390x.s @@ -109,53 +109,23 @@ clearge32: // For size >= 4KB, XC is loop unrolled 16 times (4KB = 256B * 16) clearge4KB: XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 - XC $256, 0(R4), 0(R4) - ADD $256, R4 - ADD $-256, R5 + XC $256, 256(R4), 256(R4) + XC $256, 512(R4), 512(R4) + XC $256, 768(R4), 768(R4) + XC $256, 1024(R4), 1024(R4) + XC $256, 1280(R4), 1280(R4) + XC $256, 1536(R4), 1536(R4) + XC $256, 1792(R4), 1792(R4) + XC $256, 2048(R4), 2048(R4) + XC $256, 2304(R4), 2304(R4) + XC $256, 2560(R4), 2560(R4) + XC $256, 2816(R4), 2816(R4) + XC $256, 3072(R4), 3072(R4) + XC $256, 3328(R4), 3328(R4) + XC $256, 3584(R4), 3584(R4) + XC $256, 3840(R4), 3840(R4) + ADD $4096, R4 + ADD $-4096, R5 CMP R5, $4096 BGE clearge4KB @@ -180,7 +150,7 @@ clear32to255: clear32: VZERO V1 VST V1, 0(R4) - VST V1, 16(R4) + VST V1, 16(R4) RET clear33to64: diff --git a/src/runtime/memmove_test.go b/src/runtime/memmove_test.go index a2c3b72568..22905504d4 100644 --- a/src/runtime/memmove_test.go +++ b/src/runtime/memmove_test.go @@ -8,6 +8,8 @@ import ( "crypto/rand" "encoding/binary" "fmt" + "internal/asan" + "internal/msan" "internal/race" "internal/testenv" . "runtime" @@ -102,8 +104,8 @@ func TestMemmoveLarge0x180000(t *testing.T) { } t.Parallel() - if race.Enabled { - t.Skip("skipping large memmove test under race detector") + if race.Enabled || asan.Enabled || msan.Enabled { + t.Skip("skipping large memmove test under sanitizers") } testSize(t, 0x180000) } @@ -114,8 +116,8 @@ func TestMemmoveOverlapLarge0x120000(t *testing.T) { } t.Parallel() - if race.Enabled { - t.Skip("skipping large memmove test under race detector") + if race.Enabled || asan.Enabled || msan.Enabled { + t.Skip("skipping large memmove test under sanitizers") } testOverlap(t, 0x120000) } @@ -518,6 +520,42 @@ func BenchmarkMemclrRange(b *testing.B) { } } +func BenchmarkClearFat3(b *testing.B) { + p := new([3]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = [3]byte{} + } +} + +func BenchmarkClearFat4(b *testing.B) { + p := new([4 / 4]uint32) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = [4 / 4]uint32{} + } +} + +func BenchmarkClearFat5(b *testing.B) { + p := new([5]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = [5]byte{} + } +} + +func BenchmarkClearFat6(b *testing.B) { + p := new([6]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = [6]byte{} + } +} + func BenchmarkClearFat7(b *testing.B) { p := new([7]byte) Escape(p) @@ -536,6 +574,24 @@ func BenchmarkClearFat8(b *testing.B) { } } +func BenchmarkClearFat9(b *testing.B) { + p := new([9]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = [9]byte{} + } +} + +func BenchmarkClearFat10(b *testing.B) { + p := new([10]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = [10]byte{} + } +} + func BenchmarkClearFat11(b *testing.B) { p := new([11]byte) Escape(p) @@ -590,6 +646,24 @@ func BenchmarkClearFat16(b *testing.B) { } } +func BenchmarkClearFat18(b *testing.B) { + p := new([18]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = [18]byte{} + } +} + +func BenchmarkClearFat20(b *testing.B) { + p := new([20 / 4]uint32) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = [20 / 4]uint32{} + } +} + func BenchmarkClearFat24(b *testing.B) { p := new([24 / 4]uint32) Escape(p) @@ -707,6 +781,46 @@ func BenchmarkClearFat1040(b *testing.B) { } } +func BenchmarkCopyFat3(b *testing.B) { + var x [3]byte + p := new([3]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = x + } +} + +func BenchmarkCopyFat4(b *testing.B) { + var x [4 / 4]uint32 + p := new([4 / 4]uint32) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = x + } +} + +func BenchmarkCopyFat5(b *testing.B) { + var x [5]byte + p := new([5]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = x + } +} + +func BenchmarkCopyFat6(b *testing.B) { + var x [6]byte + p := new([6]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = x + } +} + func BenchmarkCopyFat7(b *testing.B) { var x [7]byte p := new([7]byte) @@ -727,6 +841,26 @@ func BenchmarkCopyFat8(b *testing.B) { } } +func BenchmarkCopyFat9(b *testing.B) { + var x [9]byte + p := new([9]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = x + } +} + +func BenchmarkCopyFat10(b *testing.B) { + var x [10]byte + p := new([10]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = x + } +} + func BenchmarkCopyFat11(b *testing.B) { var x [11]byte p := new([11]byte) @@ -787,6 +921,26 @@ func BenchmarkCopyFat16(b *testing.B) { } } +func BenchmarkCopyFat18(b *testing.B) { + var x [18]byte + p := new([18]byte) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = x + } +} + +func BenchmarkCopyFat20(b *testing.B) { + var x [20 / 4]uint32 + p := new([20 / 4]uint32) + Escape(p) + b.ResetTimer() + for i := 0; i < b.N; i++ { + *p = x + } +} + func BenchmarkCopyFat24(b *testing.B) { var x [24 / 4]uint32 p := new([24 / 4]uint32) diff --git a/src/runtime/metrics.go b/src/runtime/metrics.go index 48da745521..ef3782b783 100644 --- a/src/runtime/metrics.go +++ b/src/runtime/metrics.go @@ -169,6 +169,20 @@ func initMetrics() { out.scalar = float64bits(nsToSec(in.cpuStats.UserTime)) }, }, + "/gc/cleanups/executed:cleanups": { + deps: makeStatDepSet(finalStatsDep), + compute: func(in *statAggregate, out *metricValue) { + out.kind = metricKindUint64 + out.scalar = in.finalStats.cleanupsExecuted + }, + }, + "/gc/cleanups/queued:cleanups": { + deps: makeStatDepSet(finalStatsDep), + compute: func(in *statAggregate, out *metricValue) { + out.kind = metricKindUint64 + out.scalar = in.finalStats.cleanupsQueued + }, + }, "/gc/cycles/automatic:gc-cycles": { deps: makeStatDepSet(sysStatsDep), compute: func(in *statAggregate, out *metricValue) { @@ -190,6 +204,20 @@ func initMetrics() { out.scalar = in.sysStats.gcCyclesDone }, }, + "/gc/finalizers/executed:finalizers": { + deps: makeStatDepSet(finalStatsDep), + compute: func(in *statAggregate, out *metricValue) { + out.kind = metricKindUint64 + out.scalar = in.finalStats.finalizersExecuted + }, + }, + "/gc/finalizers/queued:finalizers": { + deps: makeStatDepSet(finalStatsDep), + compute: func(in *statAggregate, out *metricValue) { + out.kind = metricKindUint64 + out.scalar = in.finalStats.finalizersQueued + }, + }, "/gc/scan/globals:bytes": { deps: makeStatDepSet(gcStatsDep), compute: func(in *statAggregate, out *metricValue) { @@ -514,10 +542,11 @@ func godebug_registerMetric(name string, read func() uint64) { type statDep uint const ( - heapStatsDep statDep = iota // corresponds to heapStatsAggregate - sysStatsDep // corresponds to sysStatsAggregate - cpuStatsDep // corresponds to cpuStatsAggregate - gcStatsDep // corresponds to gcStatsAggregate + heapStatsDep statDep = iota // corresponds to heapStatsAggregate + sysStatsDep // corresponds to sysStatsAggregate + cpuStatsDep // corresponds to cpuStatsAggregate + gcStatsDep // corresponds to gcStatsAggregate + finalStatsDep // corresponds to finalStatsAggregate numStatsDeps ) @@ -696,6 +725,21 @@ func (a *gcStatsAggregate) compute() { a.totalScan = a.heapScan + a.stackScan + a.globalsScan } +// finalStatsAggregate represents various finalizer/cleanup stats obtained +// from the runtime acquired together to avoid skew and inconsistencies. +type finalStatsAggregate struct { + finalizersQueued uint64 + finalizersExecuted uint64 + cleanupsQueued uint64 + cleanupsExecuted uint64 +} + +// compute populates the finalStatsAggregate with values from the runtime. +func (a *finalStatsAggregate) compute() { + a.finalizersQueued, a.finalizersExecuted = finReadQueueStats() + a.cleanupsQueued, a.cleanupsExecuted = gcCleanups.readQueueStats() +} + // nsToSec takes a duration in nanoseconds and converts it to seconds as // a float64. func nsToSec(ns int64) float64 { @@ -708,11 +752,12 @@ func nsToSec(ns int64) float64 { // as a set of these aggregates that it has populated. The aggregates // are populated lazily by its ensure method. type statAggregate struct { - ensured statDepSet - heapStats heapStatsAggregate - sysStats sysStatsAggregate - cpuStats cpuStatsAggregate - gcStats gcStatsAggregate + ensured statDepSet + heapStats heapStatsAggregate + sysStats sysStatsAggregate + cpuStats cpuStatsAggregate + gcStats gcStatsAggregate + finalStats finalStatsAggregate } // ensure populates statistics aggregates determined by deps if they @@ -735,6 +780,8 @@ func (a *statAggregate) ensure(deps *statDepSet) { a.cpuStats.compute() case gcStatsDep: a.gcStats.compute() + case finalStatsDep: + a.finalStats.compute() } } a.ensured = a.ensured.union(missing) diff --git a/src/runtime/metrics/description.go b/src/runtime/metrics/description.go index 19a7dbf07a..4587f791e1 100644 --- a/src/runtime/metrics/description.go +++ b/src/runtime/metrics/description.go @@ -175,6 +175,22 @@ var allDesc = []Description{ Cumulative: true, }, { + Name: "/gc/cleanups/executed:cleanups", + Description: "Approximate total count of cleanup functions (created by runtime.AddCleanup) " + + "executed by the runtime. Subtract /gc/cleanups/queued:cleanups to approximate " + + "cleanup queue length. Useful for detecting slow cleanups holding up the queue.", + Kind: KindUint64, + Cumulative: true, + }, + { + Name: "/gc/cleanups/queued:cleanups", + Description: "Approximate total count of cleanup functions (created by runtime.AddCleanup) " + + "queued by the runtime for execution. Subtract from /gc/cleanups/executed:cleanups " + + "to approximate cleanup queue length. Useful for detecting slow cleanups holding up the queue.", + Kind: KindUint64, + Cumulative: true, + }, + { Name: "/gc/cycles/automatic:gc-cycles", Description: "Count of completed GC cycles generated by the Go runtime.", Kind: KindUint64, @@ -193,6 +209,23 @@ var allDesc = []Description{ Cumulative: true, }, { + Name: "/gc/finalizers/executed:finalizers", + Description: "Total count of finalizer functions (created by runtime.SetFinalizer) " + + "executed by the runtime. Subtract /gc/finalizers/queued:finalizers to approximate " + + "finalizer queue length. Useful for detecting finalizers overwhelming the queue, " + + "either by being too slow, or by there being too many of them.", + Kind: KindUint64, + Cumulative: true, + }, + { + Name: "/gc/finalizers/queued:finalizers", + Description: "Total count of finalizer functions (created by runtime.SetFinalizer) and " + + "queued by the runtime for execution. Subtract from /gc/finalizers/executed:finalizers " + + "to approximate finalizer queue length. Useful for detecting slow finalizers holding up the queue.", + Kind: KindUint64, + Cumulative: true, + }, + { Name: "/gc/gogc:percent", Description: "Heap size target percentage configured by the user, otherwise 100. This " + "value is set by the GOGC environment variable, and the runtime/debug.SetGCPercent " + diff --git a/src/runtime/metrics/doc.go b/src/runtime/metrics/doc.go index a1902bc6d7..058769ac3a 100644 --- a/src/runtime/metrics/doc.go +++ b/src/runtime/metrics/doc.go @@ -137,6 +137,19 @@ Below is the full list of supported metrics, ordered lexicographically. to system CPU time measurements. Compare only with other /cpu/classes metrics. + /gc/cleanups/executed:cleanups + Approximate total count of cleanup functions (created + by runtime.AddCleanup) executed by the runtime. Subtract + /gc/cleanups/queued:cleanups to approximate cleanup queue + length. Useful for detecting slow cleanups holding up the queue. + + /gc/cleanups/queued:cleanups + Approximate total count of cleanup functions (created by + runtime.AddCleanup) queued by the runtime for execution. + Subtract from /gc/cleanups/executed:cleanups to approximate + cleanup queue length. Useful for detecting slow cleanups holding + up the queue. + /gc/cycles/automatic:gc-cycles Count of completed GC cycles generated by the Go runtime. @@ -146,6 +159,20 @@ Below is the full list of supported metrics, ordered lexicographically. /gc/cycles/total:gc-cycles Count of all completed GC cycles. + /gc/finalizers/executed:finalizers + Total count of finalizer functions (created by + runtime.SetFinalizer) executed by the runtime. Subtract + /gc/finalizers/queued:finalizers to approximate finalizer queue + length. Useful for detecting finalizers overwhelming the queue, + either by being too slow, or by there being too many of them. + + /gc/finalizers/queued:finalizers + Total count of finalizer functions (created by + runtime.SetFinalizer) and queued by the runtime for execution. + Subtract from /gc/finalizers/executed:finalizers to approximate + finalizer queue length. Useful for detecting slow finalizers + holding up the queue. + /gc/gogc:percent Heap size target percentage configured by the user, otherwise 100. This value is set by the GOGC environment variable, and the diff --git a/src/runtime/metrics_test.go b/src/runtime/metrics_test.go index 5fc022efc6..5787c96084 100644 --- a/src/runtime/metrics_test.go +++ b/src/runtime/metrics_test.go @@ -499,6 +499,10 @@ func TestReadMetricsCumulative(t *testing.T) { defer wg.Done() for { // Add more things here that could influence metrics. + for i := 0; i < 10; i++ { + runtime.AddCleanup(new(*int), func(_ struct{}) {}, struct{}{}) + runtime.SetFinalizer(new(*int), func(_ **int) {}) + } for i := 0; i < len(readMetricsSink); i++ { readMetricsSink[i] = make([]byte, 1024) select { @@ -1512,3 +1516,62 @@ func TestMetricHeapUnusedLargeObjectOverflow(t *testing.T) { done <- struct{}{} wg.Wait() } + +func TestReadMetricsCleanups(t *testing.T) { + runtime.GC() // End any in-progress GC. + runtime.BlockUntilEmptyCleanupQueue(int64(1 * time.Second)) // Flush any queued cleanups. + + var before [2]metrics.Sample + before[0].Name = "/gc/cleanups/queued:cleanups" + before[1].Name = "/gc/cleanups/executed:cleanups" + after := before + + metrics.Read(before[:]) + + const N = 10 + for i := 0; i < N; i++ { + runtime.AddCleanup(new(*int), func(_ struct{}) {}, struct{}{}) + } + + runtime.GC() + runtime.BlockUntilEmptyCleanupQueue(int64(1 * time.Second)) + + metrics.Read(after[:]) + + if v0, v1 := before[0].Value.Uint64(), after[0].Value.Uint64(); v0+N != v1 { + t.Errorf("expected %s difference to be exactly %d, got %d -> %d", before[0].Name, N, v0, v1) + } + if v0, v1 := before[1].Value.Uint64(), after[1].Value.Uint64(); v0+N != v1 { + t.Errorf("expected %s difference to be exactly %d, got %d -> %d", before[1].Name, N, v0, v1) + } +} + +func TestReadMetricsFinalizers(t *testing.T) { + runtime.GC() // End any in-progress GC. + runtime.BlockUntilEmptyFinalizerQueue(int64(1 * time.Second)) // Flush any queued finalizers. + + var before [2]metrics.Sample + before[0].Name = "/gc/finalizers/queued:finalizers" + before[1].Name = "/gc/finalizers/executed:finalizers" + after := before + + metrics.Read(before[:]) + + const N = 10 + for i := 0; i < N; i++ { + runtime.SetFinalizer(new(*int), func(_ **int) {}) + } + + runtime.GC() + runtime.GC() + runtime.BlockUntilEmptyFinalizerQueue(int64(1 * time.Second)) + + metrics.Read(after[:]) + + if v0, v1 := before[0].Value.Uint64(), after[0].Value.Uint64(); v0+N != v1 { + t.Errorf("expected %s difference to be exactly %d, got %d -> %d", before[0].Name, N, v0, v1) + } + if v0, v1 := before[1].Value.Uint64(), after[1].Value.Uint64(); v0+N != v1 { + t.Errorf("expected %s difference to be exactly %d, got %d -> %d", before[1].Name, N, v0, v1) + } +} diff --git a/src/runtime/mfinal.go b/src/runtime/mfinal.go index 2d4a54c933..bafdb01603 100644 --- a/src/runtime/mfinal.go +++ b/src/runtime/mfinal.go @@ -251,7 +251,7 @@ func runFinalizers() { // confusing the write barrier. *(*[2]uintptr)(frame) = [2]uintptr{} } - switch f.fint.Kind_ & abi.KindMask { + switch f.fint.Kind() { case abi.Pointer: // direct use of pointer *(*unsafe.Pointer)(r) = f.arg @@ -435,7 +435,7 @@ func SetFinalizer(obj any, finalizer any) { if etyp == nil { throw("runtime.SetFinalizer: first argument is nil") } - if etyp.Kind_&abi.KindMask != abi.Pointer { + if etyp.Kind() != abi.Pointer { throw("runtime.SetFinalizer: first argument is " + toRType(etyp).string() + ", not pointer") } ot := (*ptrtype)(unsafe.Pointer(etyp)) @@ -490,7 +490,7 @@ func SetFinalizer(obj any, finalizer any) { return } - if ftyp.Kind_&abi.KindMask != abi.Func { + if ftyp.Kind() != abi.Func { throw("runtime.SetFinalizer: second argument is " + toRType(ftyp).string() + ", not a function") } ft := (*functype)(unsafe.Pointer(ftyp)) @@ -505,13 +505,13 @@ func SetFinalizer(obj any, finalizer any) { case fint == etyp: // ok - same type goto okarg - case fint.Kind_&abi.KindMask == abi.Pointer: + case fint.Kind() == abi.Pointer: if (fint.Uncommon() == nil || etyp.Uncommon() == nil) && (*ptrtype)(unsafe.Pointer(fint)).Elem == ot.Elem { // ok - not same type, but both pointers, // one or the other is unnamed, and same element type, so assignable. goto okarg } - case fint.Kind_&abi.KindMask == abi.Interface: + case fint.Kind() == abi.Interface: ityp := (*interfacetype)(unsafe.Pointer(fint)) if len(ityp.Methods) == 0 { // ok - satisfies empty interface diff --git a/src/runtime/mgclimit.go b/src/runtime/mgclimit.go index ad86fbd65b..80aeb71cad 100644 --- a/src/runtime/mgclimit.go +++ b/src/runtime/mgclimit.go @@ -209,14 +209,12 @@ func (l *gcCPULimiterState) updateLocked(now int64) { for _, pp := range allp { typ, duration := pp.limiterEvent.consume(now) switch typ { - case limiterEventIdleMarkWork: - fallthrough case limiterEventIdle: - idleTime += duration sched.idleTime.Add(duration) - case limiterEventMarkAssist: - fallthrough - case limiterEventScavengeAssist: + idleTime += duration + case limiterEventIdleMarkWork: + idleTime += duration + case limiterEventMarkAssist, limiterEventScavengeAssist: assistTime += duration case limiterEventNone: break @@ -470,14 +468,12 @@ func (e *limiterEvent) stop(typ limiterEventType, now int64) { } // Account for the event. switch typ { - case limiterEventIdleMarkWork: - gcCPULimiter.addIdleTime(duration) case limiterEventIdle: - gcCPULimiter.addIdleTime(duration) sched.idleTime.Add(duration) - case limiterEventMarkAssist: - fallthrough - case limiterEventScavengeAssist: + gcCPULimiter.addIdleTime(duration) + case limiterEventIdleMarkWork: + gcCPULimiter.addIdleTime(duration) + case limiterEventMarkAssist, limiterEventScavengeAssist: gcCPULimiter.addAssistTime(duration) default: throw("limiterEvent.stop: invalid limiter event type found") diff --git a/src/runtime/mgcmark.go b/src/runtime/mgcmark.go index a136c7aeac..8b306045c5 100644 --- a/src/runtime/mgcmark.go +++ b/src/runtime/mgcmark.go @@ -415,13 +415,13 @@ func gcScanFinalizer(spf *specialfinalizer, s *mspan, gcw *gcWork) { // Don't mark finalized object, but scan it so we retain everything it points to. // A finalizer can be set for an inner byte of an object, find object beginning. - p := s.base() + uintptr(spf.special.offset)/s.elemsize*s.elemsize + p := s.base() + spf.special.offset/s.elemsize*s.elemsize // Mark everything that can be reached from // the object (but *not* the object itself or // we'll never collect it). if !s.spanclass.noscan() { - scanobject(p, gcw) + scanObject(p, gcw) } // The special itself is also a root. @@ -1255,7 +1255,7 @@ func gcDrain(gcw *gcWork, flags gcDrainFlags) { } } if b != 0 { - scanobject(b, gcw) + scanObject(b, gcw) } else if s != 0 { scanSpan(s, gcw) } else { @@ -1359,7 +1359,7 @@ func gcDrainN(gcw *gcWork, scanWork int64) int64 { } } if b != 0 { - scanobject(b, gcw) + scanObject(b, gcw) } else if s != 0 { scanSpan(s, gcw) } else { @@ -1390,7 +1390,7 @@ func gcDrainN(gcw *gcWork, scanWork int64) int64 { return workFlushed + gcw.heapScanWork } -// scanblock scans b as scanobject would, but using an explicit +// scanblock scans b as scanObject would, but using an explicit // pointer bitmap instead of the heap bitmap. // // This is used to scan non-heap roots, so it does not update @@ -1415,7 +1415,7 @@ func scanblock(b0, n0 uintptr, ptrmask *uint8, gcw *gcWork, stk *stackScanState) } for j := 0; j < 8 && i < n; j++ { if bits&1 != 0 { - // Same work as in scanobject; see comments there. + // Same work as in scanObject; see comments there. p := *(*uintptr)(unsafe.Pointer(b + i)) if p != 0 { if stk != nil && p >= stk.stack.lo && p < stk.stack.hi { @@ -1435,107 +1435,6 @@ func scanblock(b0, n0 uintptr, ptrmask *uint8, gcw *gcWork, stk *stackScanState) } } -// scanobject scans the object starting at b, adding pointers to gcw. -// b must point to the beginning of a heap object or an oblet. -// scanobject consults the GC bitmap for the pointer mask and the -// spans for the size of the object. -// -//go:nowritebarrier -func scanobject(b uintptr, gcw *gcWork) { - // Prefetch object before we scan it. - // - // This will overlap fetching the beginning of the object with initial - // setup before we start scanning the object. - sys.Prefetch(b) - - // Find the bits for b and the size of the object at b. - // - // b is either the beginning of an object, in which case this - // is the size of the object to scan, or it points to an - // oblet, in which case we compute the size to scan below. - s := spanOfUnchecked(b) - n := s.elemsize - if n == 0 { - throw("scanobject n == 0") - } - if s.spanclass.noscan() { - // Correctness-wise this is ok, but it's inefficient - // if noscan objects reach here. - throw("scanobject of a noscan object") - } - - var tp typePointers - if n > maxObletBytes { - // Large object. Break into oblets for better - // parallelism and lower latency. - if b == s.base() { - // Enqueue the other oblets to scan later. - // Some oblets may be in b's scalar tail, but - // these will be marked as "no more pointers", - // so we'll drop out immediately when we go to - // scan those. - for oblet := b + maxObletBytes; oblet < s.base()+s.elemsize; oblet += maxObletBytes { - if !gcw.putObjFast(oblet) { - gcw.putObj(oblet) - } - } - } - - // Compute the size of the oblet. Since this object - // must be a large object, s.base() is the beginning - // of the object. - n = s.base() + s.elemsize - b - n = min(n, maxObletBytes) - tp = s.typePointersOfUnchecked(s.base()) - tp = tp.fastForward(b-tp.addr, b+n) - } else { - tp = s.typePointersOfUnchecked(b) - } - - var scanSize uintptr - for { - var addr uintptr - if tp, addr = tp.nextFast(); addr == 0 { - if tp, addr = tp.next(b + n); addr == 0 { - break - } - } - - // Keep track of farthest pointer we found, so we can - // update heapScanWork. TODO: is there a better metric, - // now that we can skip scalar portions pretty efficiently? - scanSize = addr - b + goarch.PtrSize - - // Work here is duplicated in scanblock and above. - // If you make changes here, make changes there too. - obj := *(*uintptr)(unsafe.Pointer(addr)) - - // At this point we have extracted the next potential pointer. - // Quickly filter out nil and pointers back to the current object. - if obj != 0 && obj-b >= n { - // Test if obj points into the Go heap and, if so, - // mark the object. - // - // Note that it's possible for findObject to - // fail if obj points to a just-allocated heap - // object because of a race with growing the - // heap. In this case, we know the object was - // just allocated and hence will be marked by - // allocation itself. - if !tryDeferToSpanScan(obj, gcw) { - if obj, span, objIndex := findObject(obj, b, addr-b); obj != 0 { - greyobject(obj, b, addr-b, span, gcw, objIndex) - } - } - } - } - gcw.bytesMarked += uint64(n) - gcw.heapScanWork += int64(scanSize) - if debug.gctrace > 1 { - gcw.stats[s.spanclass.sizeclass()].sparseObjsScanned++ - } -} - // scanConservative scans block [b, b+n) conservatively, treating any // pointer-like value in the block as a pointer. // diff --git a/src/runtime/mgcmark_greenteagc.go b/src/runtime/mgcmark_greenteagc.go index ac2b1732f9..845857a817 100644 --- a/src/runtime/mgcmark_greenteagc.go +++ b/src/runtime/mgcmark_greenteagc.go @@ -110,7 +110,7 @@ func (o *spanScanOwnership) or(v spanScanOwnership) spanScanOwnership { return spanScanOwnership(atomic.Or32(o32, uint32(v)<<off) >> off) } -func (imb *spanInlineMarkBits) init(class spanClass) { +func (imb *spanInlineMarkBits) init(class spanClass, needzero bool) { if imb == nil { // This nil check and throw is almost pointless. Normally we would // expect imb to never be nil. However, this is called on potentially @@ -131,7 +131,13 @@ func (imb *spanInlineMarkBits) init(class spanClass) { // See go.dev/issue/74375 for details. throw("runtime: span inline mark bits nil?") } - *imb = spanInlineMarkBits{} + if needzero { + // Use memclrNoHeapPointers to avoid having the compiler make a worse + // decision. We know that imb is both aligned and a nice power-of-two + // size that works well for wider SIMD instructions. The compiler likely + // has no idea that imb is aligned to 128 bytes. + memclrNoHeapPointers(unsafe.Pointer(imb), unsafe.Sizeof(spanInlineMarkBits{})) + } imb.class = class } @@ -180,25 +186,33 @@ func (s *mspan) initInlineMarkBits() { if doubleCheckGreenTea && !gcUsesSpanInlineMarkBits(s.elemsize) { throw("expected span with inline mark bits") } - s.inlineMarkBits().init(s.spanclass) + // Zeroing is only necessary if this span wasn't just freshly allocated from the OS. + s.inlineMarkBits().init(s.spanclass, s.needzero != 0) } -// mergeInlineMarks merges the span's inline mark bits into dst. +// moveInlineMarks merges the span's inline mark bits into dst and clears them. // // gcUsesSpanInlineMarkBits(s.elemsize) must be true. -func (s *mspan) mergeInlineMarks(dst *gcBits) { +func (s *mspan) moveInlineMarks(dst *gcBits) { if doubleCheckGreenTea && !gcUsesSpanInlineMarkBits(s.elemsize) { throw("expected span with inline mark bits") } bytes := divRoundUp(uintptr(s.nelems), 8) imb := s.inlineMarkBits() - _ = imb.marks[bytes-1] - for i := uintptr(0); i < bytes; i++ { - *dst.bytep(i) |= imb.marks[i] + imbMarks := (*gc.ObjMask)(unsafe.Pointer(&imb.marks)) + for i := uintptr(0); i < bytes; i += goarch.PtrSize { + marks := bswapIfBigEndian(imbMarks[i/goarch.PtrSize]) + if i/goarch.PtrSize == uintptr(len(imb.marks)+1)/goarch.PtrSize-1 { + marks &^= 0xff << ((goarch.PtrSize - 1) * 8) // mask out class + } + *(*uintptr)(unsafe.Pointer(dst.bytep(i))) |= bswapIfBigEndian(marks) } if doubleCheckGreenTea && !s.spanclass.noscan() && imb.marks != imb.scans { throw("marks don't match scans for span with pointer") } + + // Reset the inline mark bits. + imb.init(s.spanclass, true /* We know these bits are always dirty now. */) } // inlineMarkBits returns the inline mark bits for the span. @@ -652,7 +666,7 @@ func spanSetScans(spanBase uintptr, nelems uint16, imb *spanInlineMarkBits, toSc marks := imbMarks[i/goarch.PtrSize] scans = bswapIfBigEndian(scans) marks = bswapIfBigEndian(marks) - if i/goarch.PtrSize == 64/goarch.PtrSize-1 { + if i/goarch.PtrSize == uintptr(len(imb.marks)+1)/goarch.PtrSize-1 { scans &^= 0xff << ((goarch.PtrSize - 1) * 8) // mask out owned marks &^= 0xff << ((goarch.PtrSize - 1) * 8) // mask out class } @@ -837,3 +851,107 @@ func (w *gcWork) flushScanStats(dst *[gc.NumSizeClasses]sizeClassScanStats) { } clear(w.stats[:]) } + +// scanObject scans the object starting at b, adding pointers to gcw. +// b must point to the beginning of a heap object or an oblet. +// scanObject consults the GC bitmap for the pointer mask and the +// spans for the size of the object. +// +// Used only for !gcUsesSpanInlineMarkBits spans, but supports all +// object sizes and is safe to be called on all heap objects. +// +//go:nowritebarrier +func scanObject(b uintptr, gcw *gcWork) { + // Prefetch object before we scan it. + // + // This will overlap fetching the beginning of the object with initial + // setup before we start scanning the object. + sys.Prefetch(b) + + // Find the bits for b and the size of the object at b. + // + // b is either the beginning of an object, in which case this + // is the size of the object to scan, or it points to an + // oblet, in which case we compute the size to scan below. + s := spanOfUnchecked(b) + n := s.elemsize + if n == 0 { + throw("scanObject n == 0") + } + if s.spanclass.noscan() { + // Correctness-wise this is ok, but it's inefficient + // if noscan objects reach here. + throw("scanObject of a noscan object") + } + + var tp typePointers + if n > maxObletBytes { + // Large object. Break into oblets for better + // parallelism and lower latency. + if b == s.base() { + // Enqueue the other oblets to scan later. + // Some oblets may be in b's scalar tail, but + // these will be marked as "no more pointers", + // so we'll drop out immediately when we go to + // scan those. + for oblet := b + maxObletBytes; oblet < s.base()+s.elemsize; oblet += maxObletBytes { + if !gcw.putObjFast(oblet) { + gcw.putObj(oblet) + } + } + } + + // Compute the size of the oblet. Since this object + // must be a large object, s.base() is the beginning + // of the object. + n = s.base() + s.elemsize - b + n = min(n, maxObletBytes) + tp = s.typePointersOfUnchecked(s.base()) + tp = tp.fastForward(b-tp.addr, b+n) + } else { + tp = s.typePointersOfUnchecked(b) + } + + var scanSize uintptr + for { + var addr uintptr + if tp, addr = tp.nextFast(); addr == 0 { + if tp, addr = tp.next(b + n); addr == 0 { + break + } + } + + // Keep track of farthest pointer we found, so we can + // update heapScanWork. TODO: is there a better metric, + // now that we can skip scalar portions pretty efficiently? + scanSize = addr - b + goarch.PtrSize + + // Work here is duplicated in scanblock and above. + // If you make changes here, make changes there too. + obj := *(*uintptr)(unsafe.Pointer(addr)) + + // At this point we have extracted the next potential pointer. + // Quickly filter out nil and pointers back to the current object. + if obj != 0 && obj-b >= n { + // Test if obj points into the Go heap and, if so, + // mark the object. + // + // Note that it's possible for findObject to + // fail if obj points to a just-allocated heap + // object because of a race with growing the + // heap. In this case, we know the object was + // just allocated and hence will be marked by + // allocation itself. + if !tryDeferToSpanScan(obj, gcw) { + if obj, span, objIndex := findObject(obj, b, addr-b); obj != 0 { + greyobject(obj, b, addr-b, span, gcw, objIndex) + } + } + } + } + gcw.bytesMarked += uint64(n) + gcw.heapScanWork += int64(scanSize) + if debug.gctrace > 1 { + gcw.stats[s.spanclass.sizeclass()].sparseObjsScanned++ + } +} diff --git a/src/runtime/mgcmark_nogreenteagc.go b/src/runtime/mgcmark_nogreenteagc.go index c0ca5c21ea..6375773123 100644 --- a/src/runtime/mgcmark_nogreenteagc.go +++ b/src/runtime/mgcmark_nogreenteagc.go @@ -6,7 +6,12 @@ package runtime -import "internal/runtime/gc" +import ( + "internal/goarch" + "internal/runtime/gc" + "internal/runtime/sys" + "unsafe" +) func (s *mspan) markBitsForIndex(objIndex uintptr) markBits { bytep, mask := s.gcmarkBits.bitp(objIndex) @@ -24,7 +29,7 @@ func tryDeferToSpanScan(p uintptr, gcw *gcWork) bool { func (s *mspan) initInlineMarkBits() { } -func (s *mspan) mergeInlineMarks(to *gcBits) { +func (s *mspan) moveInlineMarks(to *gcBits) { throw("unimplemented") } @@ -110,3 +115,104 @@ func (w *gcWork) flushScanStats(dst *[gc.NumSizeClasses]sizeClassScanStats) { } clear(w.stats[:]) } + +// scanObject scans the object starting at b, adding pointers to gcw. +// b must point to the beginning of a heap object or an oblet. +// scanObject consults the GC bitmap for the pointer mask and the +// spans for the size of the object. +// +//go:nowritebarrier +func scanObject(b uintptr, gcw *gcWork) { + // Prefetch object before we scan it. + // + // This will overlap fetching the beginning of the object with initial + // setup before we start scanning the object. + sys.Prefetch(b) + + // Find the bits for b and the size of the object at b. + // + // b is either the beginning of an object, in which case this + // is the size of the object to scan, or it points to an + // oblet, in which case we compute the size to scan below. + s := spanOfUnchecked(b) + n := s.elemsize + if n == 0 { + throw("scanObject n == 0") + } + if s.spanclass.noscan() { + // Correctness-wise this is ok, but it's inefficient + // if noscan objects reach here. + throw("scanObject of a noscan object") + } + + var tp typePointers + if n > maxObletBytes { + // Large object. Break into oblets for better + // parallelism and lower latency. + if b == s.base() { + // Enqueue the other oblets to scan later. + // Some oblets may be in b's scalar tail, but + // these will be marked as "no more pointers", + // so we'll drop out immediately when we go to + // scan those. + for oblet := b + maxObletBytes; oblet < s.base()+s.elemsize; oblet += maxObletBytes { + if !gcw.putObjFast(oblet) { + gcw.putObj(oblet) + } + } + } + + // Compute the size of the oblet. Since this object + // must be a large object, s.base() is the beginning + // of the object. + n = s.base() + s.elemsize - b + n = min(n, maxObletBytes) + tp = s.typePointersOfUnchecked(s.base()) + tp = tp.fastForward(b-tp.addr, b+n) + } else { + tp = s.typePointersOfUnchecked(b) + } + + var scanSize uintptr + for { + var addr uintptr + if tp, addr = tp.nextFast(); addr == 0 { + if tp, addr = tp.next(b + n); addr == 0 { + break + } + } + + // Keep track of farthest pointer we found, so we can + // update heapScanWork. TODO: is there a better metric, + // now that we can skip scalar portions pretty efficiently? + scanSize = addr - b + goarch.PtrSize + + // Work here is duplicated in scanblock and above. + // If you make changes here, make changes there too. + obj := *(*uintptr)(unsafe.Pointer(addr)) + + // At this point we have extracted the next potential pointer. + // Quickly filter out nil and pointers back to the current object. + if obj != 0 && obj-b >= n { + // Test if obj points into the Go heap and, if so, + // mark the object. + // + // Note that it's possible for findObject to + // fail if obj points to a just-allocated heap + // object because of a race with growing the + // heap. In this case, we know the object was + // just allocated and hence will be marked by + // allocation itself. + if !tryDeferToSpanScan(obj, gcw) { + if obj, span, objIndex := findObject(obj, b, addr-b); obj != 0 { + greyobject(obj, b, addr-b, span, gcw, objIndex) + } + } + } + } + gcw.bytesMarked += uint64(n) + gcw.heapScanWork += int64(scanSize) + if debug.gctrace > 1 { + gcw.stats[s.spanclass.sizeclass()].sparseObjsScanned++ + } +} diff --git a/src/runtime/mgcsweep.go b/src/runtime/mgcsweep.go index a3bf2989df..b72cc461ba 100644 --- a/src/runtime/mgcsweep.go +++ b/src/runtime/mgcsweep.go @@ -553,7 +553,7 @@ func (sl *sweepLocked) sweep(preserve bool) bool { siter := newSpecialsIter(s) for siter.valid() { // A finalizer can be set for an inner byte of an object, find object beginning. - objIndex := uintptr(siter.s.offset) / size + objIndex := siter.s.offset / size p := s.base() + objIndex*size mbits := s.markBitsForIndex(objIndex) if !mbits.isMarked() { @@ -561,7 +561,7 @@ func (sl *sweepLocked) sweep(preserve bool) bool { // Pass 1: see if it has a finalizer. hasFinAndRevived := false endOffset := p - s.base() + size - for tmp := siter.s; tmp != nil && uintptr(tmp.offset) < endOffset; tmp = tmp.next { + for tmp := siter.s; tmp != nil && tmp.offset < endOffset; tmp = tmp.next { if tmp.kind == _KindSpecialFinalizer { // Stop freeing of object if it has a finalizer. mbits.setMarkedNonAtomic() @@ -573,11 +573,11 @@ func (sl *sweepLocked) sweep(preserve bool) bool { // Pass 2: queue all finalizers and clear any weak handles. Weak handles are cleared // before finalization as specified by the weak package. See the documentation // for that package for more details. - for siter.valid() && uintptr(siter.s.offset) < endOffset { + for siter.valid() && siter.s.offset < endOffset { // Find the exact byte for which the special was setup // (as opposed to object beginning). special := siter.s - p := s.base() + uintptr(special.offset) + p := s.base() + special.offset if special.kind == _KindSpecialFinalizer || special.kind == _KindSpecialWeakHandle { siter.unlinkAndNext() freeSpecial(special, unsafe.Pointer(p), size) @@ -589,11 +589,11 @@ func (sl *sweepLocked) sweep(preserve bool) bool { } } else { // Pass 2: the object is truly dead, free (and handle) all specials. - for siter.valid() && uintptr(siter.s.offset) < endOffset { + for siter.valid() && siter.s.offset < endOffset { // Find the exact byte for which the special was setup // (as opposed to object beginning). special := siter.s - p := s.base() + uintptr(special.offset) + p := s.base() + special.offset siter.unlinkAndNext() freeSpecial(special, unsafe.Pointer(p), size) } @@ -650,9 +650,9 @@ func (sl *sweepLocked) sweep(preserve bool) bool { } } - // Copy over the inline mark bits if necessary. + // Copy over and clear the inline mark bits if necessary. if gcUsesSpanInlineMarkBits(s.elemsize) { - s.mergeInlineMarks(s.gcmarkBits) + s.moveInlineMarks(s.gcmarkBits) } // Check for zombie objects. @@ -704,11 +704,6 @@ func (sl *sweepLocked) sweep(preserve bool) bool { // Initialize alloc bits cache. s.refillAllocCache(0) - // Reset the object queue, if we have one. - if gcUsesSpanInlineMarkBits(s.elemsize) { - s.initInlineMarkBits() - } - // The span must be in our exclusive ownership until we update sweepgen, // check for potential races. if state := s.state.get(); state != mSpanInUse || s.sweepgen != sweepgen-1 { diff --git a/src/runtime/mheap.go b/src/runtime/mheap.go index 358de2f376..1776206573 100644 --- a/src/runtime/mheap.go +++ b/src/runtime/mheap.go @@ -1490,7 +1490,7 @@ func (h *mheap) initSpan(s *mspan, typ spanAllocType, spanclass spanClass, base, s.allocBits = newAllocBits(uintptr(s.nelems)) // Adjust s.limit down to the object-containing part of the span. - s.limit = s.base() + uintptr(s.elemsize)*uintptr(s.nelems) + s.limit = s.base() + s.elemsize*uintptr(s.nelems) // It's safe to access h.sweepgen without the heap lock because it's // only ever updated with the world stopped and we run on the @@ -1549,6 +1549,8 @@ func (h *mheap) initSpan(s *mspan, typ spanAllocType, spanclass spanClass, base, func (h *mheap) grow(npage uintptr) (uintptr, bool) { assertLockHeld(&h.lock) + firstGrow := h.curArena.base == 0 + // We must grow the heap in whole palloc chunks. // We call sysMap below but note that because we // round up to pallocChunkPages which is on the order @@ -1597,6 +1599,16 @@ func (h *mheap) grow(npage uintptr) (uintptr, bool) { // Switch to the new space. h.curArena.base = uintptr(av) h.curArena.end = uintptr(av) + asize + + if firstGrow && randomizeHeapBase { + // The top heapAddrBits-logHeapArenaBytes are randomized, we now + // want to randomize the next + // logHeapArenaBytes-log2(pallocChunkBytes) bits, making sure + // h.curArena.base is aligned to pallocChunkBytes. + bits := logHeapArenaBytes - logPallocChunkBytes + offset := nextHeapRandBits(bits) + h.curArena.base = alignDown(h.curArena.base|(offset<<logPallocChunkBytes), pallocChunkBytes) + } } // Recalculate nBase. @@ -1627,6 +1639,22 @@ func (h *mheap) grow(npage uintptr) (uintptr, bool) { // space ready for allocation. h.pages.grow(v, nBase-v) totalGrowth += nBase - v + + if firstGrow && randomizeHeapBase { + // The top heapAddrBits-log2(pallocChunkBytes) bits are now randomized, + // we finally want to randomize the next + // log2(pallocChunkBytes)-log2(pageSize) bits, while maintaining + // alignment to pageSize. We do this by calculating a random number of + // pages into the current arena, and marking them as allocated. The + // address of the next available page becomes our fully randomized base + // heap address. + randOffset := nextHeapRandBits(logPallocChunkBytes) + randNumPages := alignDown(randOffset, pageSize) / pageSize + if randNumPages != 0 { + h.pages.markRandomPaddingPages(v, randNumPages) + } + } + return totalGrowth, true } @@ -2126,11 +2154,11 @@ func (span *mspan) specialFindSplicePoint(offset uintptr, kind byte) (**special, if s == nil { break } - if offset == uintptr(s.offset) && kind == s.kind { + if offset == s.offset && kind == s.kind { found = true break } - if offset < uintptr(s.offset) || (offset == uintptr(s.offset) && kind < s.kind) { + if offset < s.offset || (offset == s.offset && kind < s.kind) { break } iter = &s.next @@ -2173,7 +2201,7 @@ func addfinalizer(p unsafe.Pointer, f *funcval, nret uintptr, fint *_type, ot *p // Mark everything reachable from the object // so it's retained for the finalizer. if !span.spanclass.noscan() { - scanobject(base, gcw) + scanObject(base, gcw) } // Mark the finalizer itself, since the // special isn't part of the GC'd heap. @@ -2297,14 +2325,14 @@ func getCleanupContext(ptr uintptr, cleanupID uint64) *specialCheckFinalizer { // Reached the end of the linked list. Stop searching at this point. break } - if offset == uintptr(s.offset) && _KindSpecialCheckFinalizer == s.kind && + if offset == s.offset && _KindSpecialCheckFinalizer == s.kind && (*specialCheckFinalizer)(unsafe.Pointer(s)).cleanupID == cleanupID { // The special is a cleanup and contains a matching cleanup id. *iter = s.next found = (*specialCheckFinalizer)(unsafe.Pointer(s)) break } - if offset < uintptr(s.offset) || (offset == uintptr(s.offset) && _KindSpecialCheckFinalizer < s.kind) { + if offset < s.offset || (offset == s.offset && _KindSpecialCheckFinalizer < s.kind) { // The special is outside the region specified for that kind of // special. The specials are sorted by kind. break @@ -2347,14 +2375,14 @@ func clearCleanupContext(ptr uintptr, cleanupID uint64) { // Reached the end of the linked list. Stop searching at this point. break } - if offset == uintptr(s.offset) && _KindSpecialCheckFinalizer == s.kind && + if offset == s.offset && _KindSpecialCheckFinalizer == s.kind && (*specialCheckFinalizer)(unsafe.Pointer(s)).cleanupID == cleanupID { // The special is a cleanup and contains a matching cleanup id. *iter = s.next found = s break } - if offset < uintptr(s.offset) || (offset == uintptr(s.offset) && _KindSpecialCheckFinalizer < s.kind) { + if offset < s.offset || (offset == s.offset && _KindSpecialCheckFinalizer < s.kind) { // The special is outside the region specified for that kind of // special. The specials are sorted by kind. break @@ -2450,7 +2478,7 @@ type specialWeakHandle struct { //go:linkname internal_weak_runtime_registerWeakPointer weak.runtime_registerWeakPointer func internal_weak_runtime_registerWeakPointer(p unsafe.Pointer) unsafe.Pointer { - return unsafe.Pointer(getOrAddWeakHandle(unsafe.Pointer(p))) + return unsafe.Pointer(getOrAddWeakHandle(p)) } //go:linkname internal_weak_runtime_makeStrongFromWeak weak.runtime_makeStrongFromWeak diff --git a/src/runtime/mpagealloc.go b/src/runtime/mpagealloc.go index 4c58fb6e02..83db005051 100644 --- a/src/runtime/mpagealloc.go +++ b/src/runtime/mpagealloc.go @@ -972,6 +972,45 @@ func (p *pageAlloc) free(base, npages uintptr) { p.update(base, npages, true, false) } +// markRandomPaddingPages marks the range of memory [base, base+npages*pageSize] +// as both allocated and scavenged. This is used for randomizing the base heap +// address. Both the alloc and scav bits are set so that the pages are not used +// and so the memory accounting stats are correctly calculated. +// +// Similar to allocRange, it also updates the summaries to reflect the +// newly-updated bitmap. +// +// p.mheapLock must be held. +func (p *pageAlloc) markRandomPaddingPages(base uintptr, npages uintptr) { + assertLockHeld(p.mheapLock) + + limit := base + npages*pageSize - 1 + sc, ec := chunkIndex(base), chunkIndex(limit) + si, ei := chunkPageIndex(base), chunkPageIndex(limit) + if sc == ec { + chunk := p.chunkOf(sc) + chunk.allocRange(si, ei+1-si) + p.scav.index.alloc(sc, ei+1-si) + chunk.scavenged.setRange(si, ei+1-si) + } else { + chunk := p.chunkOf(sc) + chunk.allocRange(si, pallocChunkPages-si) + p.scav.index.alloc(sc, pallocChunkPages-si) + chunk.scavenged.setRange(si, pallocChunkPages-si) + for c := sc + 1; c < ec; c++ { + chunk := p.chunkOf(c) + chunk.allocAll() + p.scav.index.alloc(c, pallocChunkPages) + chunk.scavenged.setAll() + } + chunk = p.chunkOf(ec) + chunk.allocRange(0, ei+1) + p.scav.index.alloc(ec, ei+1) + chunk.scavenged.setRange(0, ei+1) + } + p.update(base, npages, true, true) +} + const ( pallocSumBytes = unsafe.Sizeof(pallocSum(0)) diff --git a/src/runtime/mwbbuf.go b/src/runtime/mwbbuf.go index 537d558592..e8c6064905 100644 --- a/src/runtime/mwbbuf.go +++ b/src/runtime/mwbbuf.go @@ -215,7 +215,7 @@ func wbBufFlush1(pp *p) { // pointers we greyed. We use the buffer itself to temporarily // record greyed pointers. // - // TODO: Should scanobject/scanblock just stuff pointers into + // TODO: Should scanObject/scanblock just stuff pointers into // the wbBuf? Then this would become the sole greying path. // // TODO: We could avoid shading any of the "new" pointers in diff --git a/src/runtime/netpoll_epoll.go b/src/runtime/netpoll_epoll.go index c43bab0882..48c03d119f 100644 --- a/src/runtime/netpoll_epoll.go +++ b/src/runtime/netpoll_epoll.go @@ -8,7 +8,7 @@ package runtime import ( "internal/runtime/atomic" - "internal/runtime/syscall" + "internal/runtime/syscall/linux" "unsafe" ) @@ -20,21 +20,21 @@ var ( func netpollinit() { var errno uintptr - epfd, errno = syscall.EpollCreate1(syscall.EPOLL_CLOEXEC) + epfd, errno = linux.EpollCreate1(linux.EPOLL_CLOEXEC) if errno != 0 { println("runtime: epollcreate failed with", errno) throw("runtime: netpollinit failed") } - efd, errno := syscall.Eventfd(0, syscall.EFD_CLOEXEC|syscall.EFD_NONBLOCK) + efd, errno := linux.Eventfd(0, linux.EFD_CLOEXEC|linux.EFD_NONBLOCK) if errno != 0 { println("runtime: eventfd failed with", -errno) throw("runtime: eventfd failed") } - ev := syscall.EpollEvent{ - Events: syscall.EPOLLIN, + ev := linux.EpollEvent{ + Events: linux.EPOLLIN, } *(**uintptr)(unsafe.Pointer(&ev.Data)) = &netpollEventFd - errno = syscall.EpollCtl(epfd, syscall.EPOLL_CTL_ADD, efd, &ev) + errno = linux.EpollCtl(epfd, linux.EPOLL_CTL_ADD, efd, &ev) if errno != 0 { println("runtime: epollctl failed with", errno) throw("runtime: epollctl failed") @@ -47,16 +47,16 @@ func netpollIsPollDescriptor(fd uintptr) bool { } func netpollopen(fd uintptr, pd *pollDesc) uintptr { - var ev syscall.EpollEvent - ev.Events = syscall.EPOLLIN | syscall.EPOLLOUT | syscall.EPOLLRDHUP | syscall.EPOLLET + var ev linux.EpollEvent + ev.Events = linux.EPOLLIN | linux.EPOLLOUT | linux.EPOLLRDHUP | linux.EPOLLET tp := taggedPointerPack(unsafe.Pointer(pd), pd.fdseq.Load()) *(*taggedPointer)(unsafe.Pointer(&ev.Data)) = tp - return syscall.EpollCtl(epfd, syscall.EPOLL_CTL_ADD, int32(fd), &ev) + return linux.EpollCtl(epfd, linux.EPOLL_CTL_ADD, int32(fd), &ev) } func netpollclose(fd uintptr) uintptr { - var ev syscall.EpollEvent - return syscall.EpollCtl(epfd, syscall.EPOLL_CTL_DEL, int32(fd), &ev) + var ev linux.EpollEvent + return linux.EpollCtl(epfd, linux.EPOLL_CTL_DEL, int32(fd), &ev) } func netpollarm(pd *pollDesc, mode int) { @@ -114,9 +114,9 @@ func netpoll(delay int64) (gList, int32) { // 1e9 ms == ~11.5 days. waitms = 1e9 } - var events [128]syscall.EpollEvent + var events [128]linux.EpollEvent retry: - n, errno := syscall.EpollWait(epfd, events[:], int32(len(events)), waitms) + n, errno := linux.EpollWait(epfd, events[:], int32(len(events)), waitms) if errno != 0 { if errno != _EINTR { println("runtime: epollwait on fd", epfd, "failed with", errno) @@ -138,7 +138,7 @@ retry: } if *(**uintptr)(unsafe.Pointer(&ev.Data)) == &netpollEventFd { - if ev.Events != syscall.EPOLLIN { + if ev.Events != linux.EPOLLIN { println("runtime: netpoll: eventfd ready for", ev.Events) throw("runtime: netpoll: eventfd ready for something unexpected") } @@ -156,10 +156,10 @@ retry: } var mode int32 - if ev.Events&(syscall.EPOLLIN|syscall.EPOLLRDHUP|syscall.EPOLLHUP|syscall.EPOLLERR) != 0 { + if ev.Events&(linux.EPOLLIN|linux.EPOLLRDHUP|linux.EPOLLHUP|linux.EPOLLERR) != 0 { mode += 'r' } - if ev.Events&(syscall.EPOLLOUT|syscall.EPOLLHUP|syscall.EPOLLERR) != 0 { + if ev.Events&(linux.EPOLLOUT|linux.EPOLLHUP|linux.EPOLLERR) != 0 { mode += 'w' } if mode != 0 { @@ -167,7 +167,7 @@ retry: pd := (*pollDesc)(tp.pointer()) tag := tp.tag() if pd.fdseq.Load() == tag { - pd.setEventErr(ev.Events == syscall.EPOLLERR, tag) + pd.setEventErr(ev.Events == linux.EPOLLERR, tag) delta += netpollready(&toRun, pd, mode) } } diff --git a/src/runtime/netpoll_windows.go b/src/runtime/netpoll_windows.go index fb35d41c0c..93137e4709 100644 --- a/src/runtime/netpoll_windows.go +++ b/src/runtime/netpoll_windows.go @@ -102,7 +102,7 @@ var ( ) func netpollinit() { - iocphandle = stdcall4(_CreateIoCompletionPort, _INVALID_HANDLE_VALUE, 0, 0, _DWORD_MAX) + iocphandle = stdcall(_CreateIoCompletionPort, _INVALID_HANDLE_VALUE, 0, 0, _DWORD_MAX) if iocphandle == 0 { println("runtime: CreateIoCompletionPort failed (errno=", getlasterror(), ")") throw("runtime: netpollinit failed") @@ -115,7 +115,7 @@ func netpollIsPollDescriptor(fd uintptr) bool { func netpollopen(fd uintptr, pd *pollDesc) int32 { key := packNetpollKey(netpollSourceReady, pd) - if stdcall4(_CreateIoCompletionPort, fd, iocphandle, key, 0) == 0 { + if stdcall(_CreateIoCompletionPort, fd, iocphandle, key, 0) == 0 { return int32(getlasterror()) } return 0 @@ -137,7 +137,7 @@ func netpollBreak() { } key := packNetpollKey(netpollSourceBreak, nil) - if stdcall4(_PostQueuedCompletionStatus, iocphandle, 0, key, 0) == 0 { + if stdcall(_PostQueuedCompletionStatus, iocphandle, 0, key, 0) == 0 { println("runtime: netpoll: PostQueuedCompletionStatus failed (errno=", getlasterror(), ")") throw("runtime: netpoll: PostQueuedCompletionStatus failed") } @@ -197,7 +197,7 @@ func netpoll(delay int64) (gList, int32) { if delay != 0 { mp.blocked = true } - if stdcall6(_GetQueuedCompletionStatusEx, iocphandle, uintptr(unsafe.Pointer(&entries[0])), uintptr(n), uintptr(unsafe.Pointer(&n)), uintptr(wait), 0) == 0 { + if stdcall(_GetQueuedCompletionStatusEx, iocphandle, uintptr(unsafe.Pointer(&entries[0])), uintptr(n), uintptr(unsafe.Pointer(&n)), uintptr(wait), 0) == 0 { mp.blocked = false errno := getlasterror() if errno == _WAIT_TIMEOUT { @@ -256,7 +256,7 @@ func netpollQueueTimer(delay int64) (signaled bool) { // such as a netpollBreak, so we can get to this point with a timer that hasn't // expired yet. In this case, the completion packet can still be picked up by // another thread, so defer the cancellation until it is really necessary. - errno := stdcall2(_NtCancelWaitCompletionPacket, mp.waitIocpHandle, 1) + errno := stdcall(_NtCancelWaitCompletionPacket, mp.waitIocpHandle, 1) switch errno { case STATUS_CANCELLED: // STATUS_CANCELLED is returned when the associated timer has already expired, @@ -264,12 +264,12 @@ func netpollQueueTimer(delay int64) (signaled bool) { fallthrough case STATUS_SUCCESS: dt := -delay / 100 // relative sleep (negative), 100ns units - if stdcall6(_SetWaitableTimer, mp.waitIocpTimer, uintptr(unsafe.Pointer(&dt)), 0, 0, 0, 0) == 0 { + if stdcall(_SetWaitableTimer, mp.waitIocpTimer, uintptr(unsafe.Pointer(&dt)), 0, 0, 0, 0) == 0 { println("runtime: SetWaitableTimer failed; errno=", getlasterror()) throw("runtime: netpoll failed") } key := packNetpollKey(netpollSourceTimer, nil) - if errno := stdcall8(_NtAssociateWaitCompletionPacket, mp.waitIocpHandle, iocphandle, mp.waitIocpTimer, key, 0, 0, 0, uintptr(unsafe.Pointer(&signaled))); errno != 0 { + if errno := stdcall(_NtAssociateWaitCompletionPacket, mp.waitIocpHandle, iocphandle, mp.waitIocpTimer, key, 0, 0, 0, uintptr(unsafe.Pointer(&signaled))); errno != 0 { println("runtime: NtAssociateWaitCompletionPacket failed; errno=", errno) throw("runtime: netpoll failed") } diff --git a/src/runtime/os3_solaris.go b/src/runtime/os3_solaris.go index 116995e5f6..3197c66537 100644 --- a/src/runtime/os3_solaris.go +++ b/src/runtime/os3_solaris.go @@ -238,6 +238,7 @@ func unminit() { // resources in minit, semacreate, or elsewhere. Do not take locks after calling this. // // This always runs without a P, so //go:nowritebarrierrec is required. +// //go:nowritebarrierrec func mdestroy(mp *m) { } diff --git a/src/runtime/os_aix.go b/src/runtime/os_aix.go index 3847b7671a..4bb8576f42 100644 --- a/src/runtime/os_aix.go +++ b/src/runtime/os_aix.go @@ -27,6 +27,7 @@ type funcDescriptor struct { type mOS struct { waitsema uintptr // semaphore for parking on locks perrno uintptr // pointer to tls errno + libcall libcall } //go:nosplit @@ -194,6 +195,7 @@ func unminit() { // resources in minit, semacreate, or elsewhere. Do not take locks after calling this. // // This always runs without a P, so //go:nowritebarrierrec is required. +// //go:nowritebarrierrec func mdestroy(mp *m) { } diff --git a/src/runtime/os_darwin.go b/src/runtime/os_darwin.go index 5aef34ff8f..0c7144e9d0 100644 --- a/src/runtime/os_darwin.go +++ b/src/runtime/os_darwin.go @@ -348,6 +348,7 @@ func unminit() { // resources in minit, semacreate, or elsewhere. Do not take locks after calling this. // // This always runs without a P, so //go:nowritebarrierrec is required. +// //go:nowritebarrierrec func mdestroy(mp *m) { } diff --git a/src/runtime/os_dragonfly.go b/src/runtime/os_dragonfly.go index e22fd9b42f..fbbee64fd3 100644 --- a/src/runtime/os_dragonfly.go +++ b/src/runtime/os_dragonfly.go @@ -220,6 +220,7 @@ func unminit() { // resources in minit, semacreate, or elsewhere. Do not take locks after calling this. // // This always runs without a P, so //go:nowritebarrierrec is required. +// //go:nowritebarrierrec func mdestroy(mp *m) { } diff --git a/src/runtime/os_linux.go b/src/runtime/os_linux.go index 54f98ef4f8..0ec5e43007 100644 --- a/src/runtime/os_linux.go +++ b/src/runtime/os_linux.go @@ -9,7 +9,7 @@ import ( "internal/goarch" "internal/runtime/atomic" "internal/runtime/strconv" - "internal/runtime/syscall" + "internal/runtime/syscall/linux" "unsafe" ) @@ -417,6 +417,7 @@ func unminit() { // resources in minit, semacreate, or elsewhere. Do not take locks after calling this. // // This always runs without a P, so //go:nowritebarrierrec is required. +// //go:nowritebarrierrec func mdestroy(mp *m) { } @@ -469,7 +470,7 @@ func pipe2(flags int32) (r, w int32, errno int32) //go:nosplit func fcntl(fd, cmd, arg int32) (ret int32, errno int32) { - r, _, err := syscall.Syscall6(syscall.SYS_FCNTL, uintptr(fd), uintptr(cmd), uintptr(arg), 0, 0, 0) + r, _, err := linux.Syscall6(linux.SYS_FCNTL, uintptr(fd), uintptr(cmd), uintptr(arg), 0, 0, 0) return int32(r), int32(err) } @@ -772,7 +773,7 @@ func syscall_runtime_doAllThreadsSyscall(trap, a1, a2, a3, a4, a5, a6 uintptr) ( // ensuring all threads execute system calls from multiple calls in the // same order. - r1, r2, errno := syscall.Syscall6(trap, a1, a2, a3, a4, a5, a6) + r1, r2, errno := linux.Syscall6(trap, a1, a2, a3, a4, a5, a6) if GOARCH == "ppc64" || GOARCH == "ppc64le" { // TODO(https://go.dev/issue/51192 ): ppc64 doesn't use r2. r2 = 0 @@ -883,7 +884,7 @@ func runPerThreadSyscall() { } args := perThreadSyscall - r1, r2, errno := syscall.Syscall6(args.trap, args.a1, args.a2, args.a3, args.a4, args.a5, args.a6) + r1, r2, errno := linux.Syscall6(args.trap, args.a1, args.a2, args.a3, args.a4, args.a5, args.a6) if GOARCH == "ppc64" || GOARCH == "ppc64le" { // TODO(https://go.dev/issue/51192 ): ppc64 doesn't use r2. r2 = 0 @@ -922,6 +923,6 @@ func (c *sigctxt) sigFromSeccomp() bool { //go:nosplit func mprotect(addr unsafe.Pointer, n uintptr, prot int32) (ret int32, errno int32) { - r, _, err := syscall.Syscall6(syscall.SYS_MPROTECT, uintptr(addr), n, uintptr(prot), 0, 0, 0) + r, _, err := linux.Syscall6(linux.SYS_MPROTECT, uintptr(addr), n, uintptr(prot), 0, 0, 0) return int32(r), int32(err) } diff --git a/src/runtime/os_linux_riscv64.go b/src/runtime/os_linux_riscv64.go index c4a4d4e50d..65fa601a29 100644 --- a/src/runtime/os_linux_riscv64.go +++ b/src/runtime/os_linux_riscv64.go @@ -5,7 +5,7 @@ package runtime import ( - "internal/runtime/syscall" + "internal/runtime/syscall/linux" "unsafe" ) @@ -32,6 +32,6 @@ func internal_cpu_riscvHWProbe(pairs []riscvHWProbePairs, flags uint) bool { } // Passing in a cpuCount of 0 and a cpu of nil ensures that only extensions supported by all the // cores are returned, which is the behaviour we want in internal/cpu. - _, _, e1 := syscall.Syscall6(sys_RISCV_HWPROBE, uintptr(unsafe.Pointer(&pairs[0])), uintptr(len(pairs)), uintptr(0), uintptr(unsafe.Pointer(nil)), uintptr(flags), 0) + _, _, e1 := linux.Syscall6(sys_RISCV_HWPROBE, uintptr(unsafe.Pointer(&pairs[0])), uintptr(len(pairs)), uintptr(0), uintptr(unsafe.Pointer(nil)), uintptr(flags), 0) return e1 == 0 } diff --git a/src/runtime/os_netbsd.go b/src/runtime/os_netbsd.go index 342ede9c53..f117253f34 100644 --- a/src/runtime/os_netbsd.go +++ b/src/runtime/os_netbsd.go @@ -101,9 +101,6 @@ var sigset_all = sigset{[4]uint32{^uint32(0), ^uint32(0), ^uint32(0), ^uint32(0) // From NetBSD's <sys/sysctl.h> const ( - _CTL_KERN = 1 - _KERN_OSREV = 3 - _CTL_HW = 6 _HW_NCPU = 3 _HW_PAGESIZE = 7 @@ -141,13 +138,6 @@ func getPageSize() uintptr { return 0 } -func getOSRev() int { - if osrev, ok := sysctlInt([]uint32{_CTL_KERN, _KERN_OSREV}); ok { - return int(osrev) - } - return 0 -} - //go:nosplit func semacreate(mp *m) { } @@ -268,7 +258,6 @@ func osinit() { if physPageSize == 0 { physPageSize = getPageSize() } - needSysmonWorkaround = getOSRev() < 902000000 // NetBSD 9.2 } var urandom_dev = []byte("/dev/urandom\x00") @@ -324,6 +313,7 @@ func unminit() { // resources in minit, semacreate, or elsewhere. Do not take locks after calling this. // // This always runs without a P, so //go:nowritebarrierrec is required. +// //go:nowritebarrierrec func mdestroy(mp *m) { } diff --git a/src/runtime/os_openbsd.go b/src/runtime/os_openbsd.go index 02846851d6..3943111853 100644 --- a/src/runtime/os_openbsd.go +++ b/src/runtime/os_openbsd.go @@ -134,6 +134,54 @@ func semawakeup(mp *m) { } } +// mstart_stub provides glue code to call mstart from pthread_create. +func mstart_stub() + +// May run with m.p==nil, so write barriers are not allowed. +// +//go:nowritebarrierrec +func newosproc(mp *m) { + if false { + print("newosproc m=", mp, " g=", mp.g0, " id=", mp.id, " ostk=", &mp, "\n") + } + + // Initialize an attribute object. + var attr pthreadattr + if err := pthread_attr_init(&attr); err != 0 { + writeErrStr(failthreadcreate) + exit(1) + } + + // Find out OS stack size for our own stack guard. + var stacksize uintptr + if pthread_attr_getstacksize(&attr, &stacksize) != 0 { + writeErrStr(failthreadcreate) + exit(1) + } + mp.g0.stack.hi = stacksize // for mstart + + // Tell the pthread library we won't join with this thread. + if pthread_attr_setdetachstate(&attr, _PTHREAD_CREATE_DETACHED) != 0 { + writeErrStr(failthreadcreate) + exit(1) + } + + // Finally, create the thread. It starts at mstart_stub, which does some low-level + // setup and then calls mstart. + var oset sigset + sigprocmask(_SIG_SETMASK, &sigset_all, &oset) + err := retryOnEAGAIN(func() int32 { + return pthread_create(&attr, abi.FuncPCABI0(mstart_stub), unsafe.Pointer(mp)) + }) + sigprocmask(_SIG_SETMASK, &oset, nil) + if err != 0 { + writeErrStr(failthreadcreate) + exit(1) + } + + pthread_attr_destroy(&attr) +} + func osinit() { numCPUStartup = getCPUCount() physPageSize = getPageSize() @@ -160,9 +208,6 @@ func goenvs() { // Called on the parent thread (main thread in case of bootstrap), can allocate memory. func mpreinit(mp *m) { gsignalSize := int32(32 * 1024) - if GOARCH == "mips64" { - gsignalSize = int32(64 * 1024) - } mp.gsignal = malg(gsignalSize) mp.gsignal.m = mp } @@ -186,6 +231,7 @@ func unminit() { // resources in minit, semacreate, or elsewhere. Do not take locks after calling this. // // This always runs without a P, so //go:nowritebarrierrec is required. +// //go:nowritebarrierrec func mdestroy(mp *m) { } diff --git a/src/runtime/os_openbsd_libc.go b/src/runtime/os_openbsd_libc.go deleted file mode 100644 index 201f1629d9..0000000000 --- a/src/runtime/os_openbsd_libc.go +++ /dev/null @@ -1,60 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build openbsd && !mips64 - -package runtime - -import ( - "internal/abi" - "unsafe" -) - -// mstart_stub provides glue code to call mstart from pthread_create. -func mstart_stub() - -// May run with m.p==nil, so write barriers are not allowed. -// -//go:nowritebarrierrec -func newosproc(mp *m) { - if false { - print("newosproc m=", mp, " g=", mp.g0, " id=", mp.id, " ostk=", &mp, "\n") - } - - // Initialize an attribute object. - var attr pthreadattr - if err := pthread_attr_init(&attr); err != 0 { - writeErrStr(failthreadcreate) - exit(1) - } - - // Find out OS stack size for our own stack guard. - var stacksize uintptr - if pthread_attr_getstacksize(&attr, &stacksize) != 0 { - writeErrStr(failthreadcreate) - exit(1) - } - mp.g0.stack.hi = stacksize // for mstart - - // Tell the pthread library we won't join with this thread. - if pthread_attr_setdetachstate(&attr, _PTHREAD_CREATE_DETACHED) != 0 { - writeErrStr(failthreadcreate) - exit(1) - } - - // Finally, create the thread. It starts at mstart_stub, which does some low-level - // setup and then calls mstart. - var oset sigset - sigprocmask(_SIG_SETMASK, &sigset_all, &oset) - err := retryOnEAGAIN(func() int32 { - return pthread_create(&attr, abi.FuncPCABI0(mstart_stub), unsafe.Pointer(mp)) - }) - sigprocmask(_SIG_SETMASK, &oset, nil) - if err != 0 { - writeErrStr(failthreadcreate) - exit(1) - } - - pthread_attr_destroy(&attr) -} diff --git a/src/runtime/os_openbsd_mips64.go b/src/runtime/os_openbsd_mips64.go deleted file mode 100644 index e5eeb2dcd1..0000000000 --- a/src/runtime/os_openbsd_mips64.go +++ /dev/null @@ -1,11 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package runtime - -//go:nosplit -func cputicks() int64 { - // runtime·nanotime() is a poor approximation of CPU ticks that is enough for the profiler. - return nanotime() -} diff --git a/src/runtime/os_openbsd_syscall.go b/src/runtime/os_openbsd_syscall.go deleted file mode 100644 index d784f76475..0000000000 --- a/src/runtime/os_openbsd_syscall.go +++ /dev/null @@ -1,51 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build openbsd && mips64 - -package runtime - -import ( - "internal/abi" - "internal/goarch" - "unsafe" -) - -//go:noescape -func tfork(param *tforkt, psize uintptr, mm *m, gg *g, fn uintptr) int32 - -// May run with m.p==nil, so write barriers are not allowed. -// -//go:nowritebarrier -func newosproc(mp *m) { - stk := unsafe.Pointer(mp.g0.stack.hi) - if false { - print("newosproc stk=", stk, " m=", mp, " g=", mp.g0, " id=", mp.id, " ostk=", &mp, "\n") - } - - // Stack pointer must point inside stack area (as marked with MAP_STACK), - // rather than at the top of it. - param := tforkt{ - tf_tcb: unsafe.Pointer(&mp.tls[0]), - tf_tid: nil, // minit will record tid - tf_stack: uintptr(stk) - goarch.PtrSize, - } - - var oset sigset - sigprocmask(_SIG_SETMASK, &sigset_all, &oset) - ret := retryOnEAGAIN(func() int32 { - errno := tfork(¶m, unsafe.Sizeof(param), mp, mp.g0, abi.FuncPCABI0(mstart)) - // tfork returns negative errno - return -errno - }) - sigprocmask(_SIG_SETMASK, &oset, nil) - - if ret != 0 { - print("runtime: failed to create new OS thread (have ", mcount()-1, " already; errno=", ret, ")\n") - if ret == _EAGAIN { - println("runtime: may need to increase max user processes (ulimit -p)") - } - throw("runtime.newosproc") - } -} diff --git a/src/runtime/os_openbsd_syscall1.go b/src/runtime/os_openbsd_syscall1.go deleted file mode 100644 index d32894ba6a..0000000000 --- a/src/runtime/os_openbsd_syscall1.go +++ /dev/null @@ -1,20 +0,0 @@ -// Copyright 2011 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build openbsd && mips64 - -package runtime - -//go:noescape -func thrsleep(ident uintptr, clock_id int32, tsp *timespec, lock uintptr, abort *uint32) int32 - -//go:noescape -func thrwakeup(ident uintptr, n int32) int32 - -func osyield() - -//go:nosplit -func osyield_no_g() { - osyield() -} diff --git a/src/runtime/os_openbsd_syscall2.go b/src/runtime/os_openbsd_syscall2.go deleted file mode 100644 index 072f53320d..0000000000 --- a/src/runtime/os_openbsd_syscall2.go +++ /dev/null @@ -1,102 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build openbsd && mips64 - -package runtime - -import ( - "internal/runtime/atomic" - "unsafe" -) - -//go:noescape -func sigaction(sig uint32, new, old *sigactiont) - -func kqueue() int32 - -//go:noescape -func kevent(kq int32, ch *keventt, nch int32, ev *keventt, nev int32, ts *timespec) int32 - -func raiseproc(sig uint32) - -func getthrid() int32 -func thrkill(tid int32, sig int) - -// read calls the read system call. -// It returns a non-negative number of bytes written or a negative errno value. -func read(fd int32, p unsafe.Pointer, n int32) int32 - -func closefd(fd int32) int32 - -func exit(code int32) -func usleep(usec uint32) - -//go:nosplit -func usleep_no_g(usec uint32) { - usleep(usec) -} - -// write1 calls the write system call. -// It returns a non-negative number of bytes written or a negative errno value. -// -//go:noescape -func write1(fd uintptr, p unsafe.Pointer, n int32) int32 - -//go:noescape -func open(name *byte, mode, perm int32) int32 - -// return value is only set on linux to be used in osinit(). -func madvise(addr unsafe.Pointer, n uintptr, flags int32) int32 - -// exitThread terminates the current thread, writing *wait = freeMStack when -// the stack is safe to reclaim. -// -//go:noescape -func exitThread(wait *atomic.Uint32) - -//go:noescape -func obsdsigprocmask(how int32, new sigset) sigset - -//go:nosplit -//go:nowritebarrierrec -func sigprocmask(how int32, new, old *sigset) { - n := sigset(0) - if new != nil { - n = *new - } - r := obsdsigprocmask(how, n) - if old != nil { - *old = r - } -} - -func pipe2(flags int32) (r, w int32, errno int32) - -//go:noescape -func setitimer(mode int32, new, old *itimerval) - -//go:noescape -func sysctl(mib *uint32, miblen uint32, out *byte, size *uintptr, dst *byte, ndst uintptr) int32 - -// mmap calls the mmap system call. It is implemented in assembly. -// We only pass the lower 32 bits of file offset to the -// assembly routine; the higher bits (if required), should be provided -// by the assembly routine as 0. -// The err result is an OS error code such as ENOMEM. -func mmap(addr unsafe.Pointer, n uintptr, prot, flags, fd int32, off uint32) (p unsafe.Pointer, err int) - -// munmap calls the munmap system call. It is implemented in assembly. -func munmap(addr unsafe.Pointer, n uintptr) - -func nanotime1() int64 - -//go:noescape -func sigaltstack(new, old *stackt) - -func fcntl(fd, cmd, arg int32) (ret int32, errno int32) - -func walltime() (sec int64, nsec int32) - -func issetugid() int32 diff --git a/src/runtime/os_solaris.go b/src/runtime/os_solaris.go index 5f6163f131..42b7e4a6bc 100644 --- a/src/runtime/os_solaris.go +++ b/src/runtime/os_solaris.go @@ -21,9 +21,8 @@ type mscratch struct { type mOS struct { waitsema uintptr // semaphore for parking on locks perrno *int32 // pointer to tls errno - // these are here because they are too large to be on the stack - // of low-level NOSPLIT functions. - //LibCall libcall; + // This is here to avoid using the G stack so the stack can move during the call. + libcall libcall ts mts scratch mscratch } diff --git a/src/runtime/os_windows.go b/src/runtime/os_windows.go index 8f77cd50f8..ab4e165bae 100644 --- a/src/runtime/os_windows.go +++ b/src/runtime/os_windows.go @@ -8,6 +8,7 @@ import ( "internal/abi" "internal/runtime/atomic" "internal/runtime/sys" + "internal/runtime/syscall/windows" "unsafe" ) @@ -40,7 +41,6 @@ const ( //go:cgo_import_dynamic runtime._GetThreadContext GetThreadContext%2 "kernel32.dll" //go:cgo_import_dynamic runtime._SetThreadContext SetThreadContext%2 "kernel32.dll" //go:cgo_import_dynamic runtime._LoadLibraryExW LoadLibraryExW%3 "kernel32.dll" -//go:cgo_import_dynamic runtime._LoadLibraryW LoadLibraryW%1 "kernel32.dll" //go:cgo_import_dynamic runtime._PostQueuedCompletionStatus PostQueuedCompletionStatus%4 "kernel32.dll" //go:cgo_import_dynamic runtime._QueryPerformanceCounter QueryPerformanceCounter%1 "kernel32.dll" //go:cgo_import_dynamic runtime._QueryPerformanceFrequency QueryPerformanceFrequency%1 "kernel32.dll" @@ -98,7 +98,6 @@ var ( _GetThreadContext, _SetThreadContext, _LoadLibraryExW, - _LoadLibraryW, _PostQueuedCompletionStatus, _QueryPerformanceCounter, _QueryPerformanceFrequency, @@ -160,6 +159,9 @@ func tstart_stdcall(newm *m) func wintls() type mOS struct { + // This is here to avoid using the G stack so the stack can move during the call. + stdCallInfo windows.StdCallInfo + threadLock mutex // protects "thread" and prevents closing thread uintptr // thread handle @@ -210,19 +212,15 @@ func read(fd int32, p unsafe.Pointer, n int32) int32 { type sigset struct{} -// Call a Windows function with stdcall conventions, -// and switch to os stack during the call. -func asmstdcall(fn unsafe.Pointer) - var asmstdcallAddr unsafe.Pointer -type winlibcall libcall +type winlibcall windows.StdCallInfo func windowsFindfunc(lib uintptr, name []byte) stdFunction { if name[len(name)-1] != 0 { throw("usage") } - f := stdcall2(_GetProcAddress, lib, uintptr(unsafe.Pointer(&name[0]))) + f := stdcall(_GetProcAddress, lib, uintptr(unsafe.Pointer(&name[0]))) return stdFunction(unsafe.Pointer(f)) } @@ -231,7 +229,7 @@ var sysDirectory [_MAX_PATH + 1]byte var sysDirectoryLen uintptr func initSysDirectory() { - l := stdcall2(_GetSystemDirectoryA, uintptr(unsafe.Pointer(&sysDirectory[0])), uintptr(len(sysDirectory)-1)) + l := stdcall(_GetSystemDirectoryA, uintptr(unsafe.Pointer(&sysDirectory[0])), uintptr(len(sysDirectory)-1)) if l == 0 || l > uintptr(len(sysDirectory)-1) { throw("Unable to determine system directory") } @@ -245,20 +243,21 @@ func windows_GetSystemDirectory() string { } func windowsLoadSystemLib(name []uint16) uintptr { - return stdcall3(_LoadLibraryExW, uintptr(unsafe.Pointer(&name[0])), 0, _LOAD_LIBRARY_SEARCH_SYSTEM32) + const _LOAD_LIBRARY_SEARCH_SYSTEM32 = 0x00000800 + return stdcall(_LoadLibraryExW, uintptr(unsafe.Pointer(&name[0])), 0, _LOAD_LIBRARY_SEARCH_SYSTEM32) } //go:linkname windows_QueryPerformanceCounter internal/syscall/windows.QueryPerformanceCounter func windows_QueryPerformanceCounter() int64 { var counter int64 - stdcall1(_QueryPerformanceCounter, uintptr(unsafe.Pointer(&counter))) + stdcall(_QueryPerformanceCounter, uintptr(unsafe.Pointer(&counter))) return counter } //go:linkname windows_QueryPerformanceFrequency internal/syscall/windows.QueryPerformanceFrequency func windows_QueryPerformanceFrequency() int64 { var frequency int64 - stdcall1(_QueryPerformanceFrequency, uintptr(unsafe.Pointer(&frequency))) + stdcall(_QueryPerformanceFrequency, uintptr(unsafe.Pointer(&frequency))) return frequency } @@ -309,7 +308,7 @@ func monitorSuspendResume() { var fn any = func(context uintptr, changeType uint32, setting uintptr) uintptr { for mp := (*m)(atomic.Loadp(unsafe.Pointer(&allm))); mp != nil; mp = mp.alllink { if mp.resumesema != 0 { - stdcall1(_SetEvent, mp.resumesema) + stdcall(_SetEvent, mp.resumesema) } } return 0 @@ -318,13 +317,13 @@ func monitorSuspendResume() { callback: compileCallback(*efaceOf(&fn), true), } handle := uintptr(0) - stdcall3(powerRegisterSuspendResumeNotification, _DEVICE_NOTIFY_CALLBACK, + stdcall(powerRegisterSuspendResumeNotification, _DEVICE_NOTIFY_CALLBACK, uintptr(unsafe.Pointer(¶ms)), uintptr(unsafe.Pointer(&handle))) } func getCPUCount() int32 { var mask, sysmask uintptr - ret := stdcall3(_GetProcessAffinityMask, currentProcess, uintptr(unsafe.Pointer(&mask)), uintptr(unsafe.Pointer(&sysmask))) + ret := stdcall(_GetProcessAffinityMask, currentProcess, uintptr(unsafe.Pointer(&mask)), uintptr(unsafe.Pointer(&sysmask))) if ret != 0 { n := 0 maskbits := int(unsafe.Sizeof(mask) * 8) @@ -339,13 +338,13 @@ func getCPUCount() int32 { } // use GetSystemInfo if GetProcessAffinityMask fails var info systeminfo - stdcall1(_GetSystemInfo, uintptr(unsafe.Pointer(&info))) + stdcall(_GetSystemInfo, uintptr(unsafe.Pointer(&info))) return int32(info.dwnumberofprocessors) } func getPageSize() uintptr { var info systeminfo - stdcall1(_GetSystemInfo, uintptr(unsafe.Pointer(&info))) + stdcall(_GetSystemInfo, uintptr(unsafe.Pointer(&info))) return uintptr(info.dwpagesize) } @@ -384,9 +383,9 @@ func osRelax(relax bool) uint32 { } if relax { - return uint32(stdcall1(_timeEndPeriod, 1)) + return uint32(stdcall(_timeEndPeriod, 1)) } else { - return uint32(stdcall1(_timeBeginPeriod, 1)) + return uint32(stdcall(_timeBeginPeriod, 1)) } } @@ -415,7 +414,7 @@ func createHighResTimer() uintptr { _TIMER_QUERY_STATE = 0x0001 _TIMER_MODIFY_STATE = 0x0002 ) - return stdcall4(_CreateWaitableTimerExW, 0, 0, + return stdcall(_CreateWaitableTimerExW, 0, 0, _CREATE_WAITABLE_TIMER_HIGH_RESOLUTION, _SYNCHRONIZE|_TIMER_QUERY_STATE|_TIMER_MODIFY_STATE) } @@ -425,7 +424,7 @@ func initHighResTimer() { if h != 0 { haveHighResTimer = true haveHighResSleep = _NtCreateWaitCompletionPacket != nil - stdcall1(_CloseHandle, h) + stdcall(_CloseHandle, h) } else { // Only load winmm.dll if we need it. // This avoids a dependency on winmm.dll for Go programs @@ -457,7 +456,7 @@ func initLongPathSupport() { // Check that we're ≥ 10.0.15063. info := _OSVERSIONINFOW{} info.osVersionInfoSize = uint32(unsafe.Sizeof(info)) - stdcall1(_RtlGetVersion, uintptr(unsafe.Pointer(&info))) + stdcall(_RtlGetVersion, uintptr(unsafe.Pointer(&info))) if info.majorVersion < 10 || (info.majorVersion == 10 && info.minorVersion == 0 && info.buildNumber < 15063) { return } @@ -465,14 +464,14 @@ func initLongPathSupport() { // Set the IsLongPathAwareProcess flag of the PEB's bit field. // This flag is not documented, but it's known to be used // by Windows to enable long path support. - bitField := (*byte)(unsafe.Pointer(stdcall0(_RtlGetCurrentPeb) + PebBitFieldOffset)) + bitField := (*byte)(unsafe.Pointer(stdcall(_RtlGetCurrentPeb) + PebBitFieldOffset)) *bitField |= IsLongPathAwareProcess canUseLongPaths = true } func osinit() { - asmstdcallAddr = unsafe.Pointer(abi.FuncPCABI0(asmstdcall)) + asmstdcallAddr = unsafe.Pointer(windows.AsmStdCallAddr()) loadOptionalSyscalls() @@ -494,13 +493,13 @@ func osinit() { // of dedicated threads -- GUI, IO, computational, etc. Go processes use // equivalent threads that all do a mix of GUI, IO, computations, etc. // In such context dynamic priority boosting does nothing but harm, so we turn it off. - stdcall2(_SetProcessPriorityBoost, currentProcess, 1) + stdcall(_SetProcessPriorityBoost, currentProcess, 1) } //go:nosplit func readRandom(r []byte) int { n := 0 - if stdcall2(_ProcessPrng, uintptr(unsafe.Pointer(&r[0])), uintptr(len(r)))&0xff != 0 { + if stdcall(_ProcessPrng, uintptr(unsafe.Pointer(&r[0])), uintptr(len(r)))&0xff != 0 { n = len(r) } return n @@ -510,7 +509,7 @@ func goenvs() { // strings is a pointer to environment variable pairs in the form: // "envA=valA\x00envB=valB\x00\x00" (in UTF-16) // Two consecutive zero bytes end the list. - strings := unsafe.Pointer(stdcall0(_GetEnvironmentStringsW)) + strings := unsafe.Pointer(stdcall(_GetEnvironmentStringsW)) p := (*[1 << 24]uint16)(strings)[:] n := 0 @@ -534,13 +533,13 @@ func goenvs() { p = p[1:] // skip nil byte } - stdcall1(_FreeEnvironmentStringsW, uintptr(strings)) + stdcall(_FreeEnvironmentStringsW, uintptr(strings)) // We call these all the way here, late in init, so that malloc works // for the callback functions these generate. var fn any = ctrlHandler ctrlHandlerPC := compileCallback(*efaceOf(&fn), true) - stdcall2(_SetConsoleCtrlHandler, ctrlHandlerPC, 1) + stdcall(_SetConsoleCtrlHandler, ctrlHandlerPC, 1) monitorSuspendResume() } @@ -556,7 +555,7 @@ func exit(code int32) { // kills the suspending thread, and then this thread suspends. lock(&suspendLock) atomic.Store(&exiting, 1) - stdcall1(_ExitProcess, uintptr(code)) + stdcall(_ExitProcess, uintptr(code)) } // write1 must be nosplit because it's used as a last resort in @@ -572,9 +571,9 @@ func write1(fd uintptr, buf unsafe.Pointer, n int32) int32 { var handle uintptr switch fd { case 1: - handle = stdcall1(_GetStdHandle, _STD_OUTPUT_HANDLE) + handle = stdcall(_GetStdHandle, _STD_OUTPUT_HANDLE) case 2: - handle = stdcall1(_GetStdHandle, _STD_ERROR_HANDLE) + handle = stdcall(_GetStdHandle, _STD_ERROR_HANDLE) default: // assume fd is real windows handle. handle = fd @@ -590,7 +589,7 @@ func write1(fd uintptr, buf unsafe.Pointer, n int32) int32 { if !isASCII { var m uint32 - isConsole := stdcall2(_GetConsoleMode, handle, uintptr(unsafe.Pointer(&m))) != 0 + isConsole := stdcall(_GetConsoleMode, handle, uintptr(unsafe.Pointer(&m))) != 0 // If this is a console output, various non-unicode code pages can be in use. // Use the dedicated WriteConsole call to ensure unicode is printed correctly. if isConsole { @@ -598,7 +597,7 @@ func write1(fd uintptr, buf unsafe.Pointer, n int32) int32 { } } var written uint32 - stdcall5(_WriteFile, handle, uintptr(buf), uintptr(n), uintptr(unsafe.Pointer(&written)), 0) + stdcall(_WriteFile, handle, uintptr(buf), uintptr(n), uintptr(unsafe.Pointer(&written)), 0) return int32(written) } @@ -651,7 +650,7 @@ func writeConsoleUTF16(handle uintptr, b []uint16) { return } var written uint32 - stdcall5(_WriteConsoleW, + stdcall(_WriteConsoleW, handle, uintptr(unsafe.Pointer(&b[0])), uintptr(l), @@ -672,7 +671,7 @@ func semasleep(ns int64) int32 { var result uintptr if ns < 0 { - result = stdcall2(_WaitForSingleObject, getg().m.waitsema, uintptr(_INFINITE)) + result = stdcall(_WaitForSingleObject, getg().m.waitsema, uintptr(_INFINITE)) } else { start := nanotime() elapsed := int64(0) @@ -681,7 +680,7 @@ func semasleep(ns int64) int32 { if ms == 0 { ms = 1 } - result = stdcall4(_WaitForMultipleObjects, 2, + result = stdcall(_WaitForMultipleObjects, 2, uintptr(unsafe.Pointer(&[2]uintptr{getg().m.waitsema, getg().m.resumesema})), 0, uintptr(ms)) if result != _WAIT_OBJECT_0+1 { @@ -724,7 +723,7 @@ func semasleep(ns int64) int32 { //go:nosplit func semawakeup(mp *m) { - if stdcall1(_SetEvent, mp.waitsema) == 0 { + if stdcall(_SetEvent, mp.waitsema) == 0 { systemstack(func() { print("runtime: setevent failed; errno=", getlasterror(), "\n") throw("runtime.semawakeup") @@ -737,20 +736,20 @@ func semacreate(mp *m) { if mp.waitsema != 0 { return } - mp.waitsema = stdcall4(_CreateEventA, 0, 0, 0, 0) + mp.waitsema = stdcall(_CreateEventA, 0, 0, 0, 0) if mp.waitsema == 0 { systemstack(func() { print("runtime: createevent failed; errno=", getlasterror(), "\n") throw("runtime.semacreate") }) } - mp.resumesema = stdcall4(_CreateEventA, 0, 0, 0, 0) + mp.resumesema = stdcall(_CreateEventA, 0, 0, 0, 0) if mp.resumesema == 0 { systemstack(func() { print("runtime: createevent failed; errno=", getlasterror(), "\n") throw("runtime.semacreate") }) - stdcall1(_CloseHandle, mp.waitsema) + stdcall(_CloseHandle, mp.waitsema) mp.waitsema = 0 } } @@ -763,7 +762,7 @@ func semacreate(mp *m) { //go:nosplit func newosproc(mp *m) { // We pass 0 for the stack size to use the default for this binary. - thandle := stdcall6(_CreateThread, 0, 0, + thandle := stdcall(_CreateThread, 0, 0, abi.FuncPCABI0(tstart_stdcall), uintptr(unsafe.Pointer(mp)), 0, 0) @@ -781,7 +780,7 @@ func newosproc(mp *m) { } // Close thandle to avoid leaking the thread object if it exits. - stdcall1(_CloseHandle, thandle) + stdcall(_CloseHandle, thandle) } // Used by the C library build mode. On Linux this function would allocate a @@ -829,7 +828,7 @@ func sigblock(exiting bool) { // Called on the new thread, cannot allocate Go memory. func minit() { var thandle uintptr - if stdcall7(_DuplicateHandle, currentProcess, currentThread, currentProcess, uintptr(unsafe.Pointer(&thandle)), 0, 0, _DUPLICATE_SAME_ACCESS) == 0 { + if stdcall(_DuplicateHandle, currentProcess, currentThread, currentProcess, uintptr(unsafe.Pointer(&thandle)), 0, 0, _DUPLICATE_SAME_ACCESS) == 0 { print("runtime.minit: duplicatehandle failed; errno=", getlasterror(), "\n") throw("runtime.minit: duplicatehandle failed") } @@ -837,7 +836,7 @@ func minit() { mp := getg().m lock(&mp.threadLock) mp.thread = thandle - mp.procid = uint64(stdcall0(_GetCurrentThreadId)) + mp.procid = uint64(stdcall(_GetCurrentThreadId)) // Configure usleep timer, if possible. if mp.highResTimer == 0 && haveHighResTimer { @@ -854,7 +853,7 @@ func minit() { throw("CreateWaitableTimerEx when creating timer failed") } const GENERIC_ALL = 0x10000000 - errno := stdcall3(_NtCreateWaitCompletionPacket, uintptr(unsafe.Pointer(&mp.waitIocpHandle)), GENERIC_ALL, 0) + errno := stdcall(_NtCreateWaitCompletionPacket, uintptr(unsafe.Pointer(&mp.waitIocpHandle)), GENERIC_ALL, 0) if mp.waitIocpHandle == 0 { print("runtime: NtCreateWaitCompletionPacket failed; errno=", errno, "\n") throw("NtCreateWaitCompletionPacket failed") @@ -865,7 +864,7 @@ func minit() { // Query the true stack base from the OS. Currently we're // running on a small assumed stack. var mbi memoryBasicInformation - res := stdcall3(_VirtualQuery, uintptr(unsafe.Pointer(&mbi)), uintptr(unsafe.Pointer(&mbi)), unsafe.Sizeof(mbi)) + res := stdcall(_VirtualQuery, uintptr(unsafe.Pointer(&mbi)), uintptr(unsafe.Pointer(&mbi)), unsafe.Sizeof(mbi)) if res == 0 { print("runtime: VirtualQuery failed; errno=", getlasterror(), "\n") throw("VirtualQuery for stack base failed") @@ -897,7 +896,7 @@ func unminit() { mp := getg().m lock(&mp.threadLock) if mp.thread != 0 { - stdcall1(_CloseHandle, mp.thread) + stdcall(_CloseHandle, mp.thread) mp.thread = 0 } unlock(&mp.threadLock) @@ -909,56 +908,64 @@ func unminit() { // resources in minit, semacreate, or elsewhere. Do not take locks after calling this. // // This always runs without a P, so //go:nowritebarrierrec is required. +// //go:nowritebarrierrec //go:nosplit func mdestroy(mp *m) { if mp.highResTimer != 0 { - stdcall1(_CloseHandle, mp.highResTimer) + stdcall(_CloseHandle, mp.highResTimer) mp.highResTimer = 0 } if mp.waitIocpTimer != 0 { - stdcall1(_CloseHandle, mp.waitIocpTimer) + stdcall(_CloseHandle, mp.waitIocpTimer) mp.waitIocpTimer = 0 } if mp.waitIocpHandle != 0 { - stdcall1(_CloseHandle, mp.waitIocpHandle) + stdcall(_CloseHandle, mp.waitIocpHandle) mp.waitIocpHandle = 0 } if mp.waitsema != 0 { - stdcall1(_CloseHandle, mp.waitsema) + stdcall(_CloseHandle, mp.waitsema) mp.waitsema = 0 } if mp.resumesema != 0 { - stdcall1(_CloseHandle, mp.resumesema) + stdcall(_CloseHandle, mp.resumesema) mp.resumesema = 0 } } -// asmstdcall_trampoline calls asmstdcall converting from Go to C calling convention. -func asmstdcall_trampoline(args unsafe.Pointer) - -// stdcall_no_g calls asmstdcall on os stack without using g. +// stdcall_no_g is like [stdcall] but can be called without a G. // +//go:nowritebarrier //go:nosplit -func stdcall_no_g(fn stdFunction, n int, args uintptr) uintptr { - libcall := libcall{ - fn: uintptr(unsafe.Pointer(fn)), - n: uintptr(n), - args: args, +//go:uintptrkeepalive +func stdcall_no_g(fn stdFunction, args ...uintptr) uintptr { + call := windows.StdCallInfo{ + Fn: uintptr(unsafe.Pointer(fn)), + N: uintptr(len(args)), + } + if len(args) > 0 { + call.Args = uintptr(abi.NoEscape(unsafe.Pointer(&args[0]))) } - asmstdcall_trampoline(noescape(unsafe.Pointer(&libcall))) - return libcall.r1 + windows.StdCall(&call) + return call.R1 } -// Calling stdcall on os stack. +// stdcall calls fn with the given arguments using the stdcall calling convention. +// Must be called from the system stack. // May run during STW, so write barriers are not allowed. // //go:nowritebarrier //go:nosplit -func stdcall(fn stdFunction) uintptr { +//go:uintptrkeepalive +func stdcall(fn stdFunction, args ...uintptr) uintptr { gp := getg() mp := gp.m - mp.libcall.fn = uintptr(unsafe.Pointer(fn)) + mp.stdCallInfo.Fn = uintptr(unsafe.Pointer(fn)) + mp.stdCallInfo.N = uintptr(len(args)) + if len(args) > 0 { + mp.stdCallInfo.Args = uintptr(abi.NoEscape(unsafe.Pointer(&args[0]))) + } resetLibcall := false if mp.profilehz != 0 && mp.libcallsp == 0 { // leave pc/sp for cpu profiler @@ -969,112 +976,31 @@ func stdcall(fn stdFunction) uintptr { mp.libcallsp = sys.GetCallerSP() resetLibcall = true // See comment in sys_darwin.go:libcCall } - asmcgocall(asmstdcallAddr, unsafe.Pointer(&mp.libcall)) + asmcgocall(asmstdcallAddr, unsafe.Pointer(&mp.stdCallInfo)) if resetLibcall { mp.libcallsp = 0 } - return mp.libcall.r1 -} - -//go:nosplit -func stdcall0(fn stdFunction) uintptr { - mp := getg().m - mp.libcall.n = 0 - mp.libcall.args = 0 - return stdcall(fn) -} - -//go:nosplit -//go:cgo_unsafe_args -func stdcall1(fn stdFunction, a0 uintptr) uintptr { - mp := getg().m - mp.libcall.n = 1 - mp.libcall.args = uintptr(noescape(unsafe.Pointer(&a0))) - return stdcall(fn) -} - -//go:nosplit -//go:cgo_unsafe_args -func stdcall2(fn stdFunction, a0, a1 uintptr) uintptr { - mp := getg().m - mp.libcall.n = 2 - mp.libcall.args = uintptr(noescape(unsafe.Pointer(&a0))) - return stdcall(fn) -} - -//go:nosplit -//go:cgo_unsafe_args -func stdcall3(fn stdFunction, a0, a1, a2 uintptr) uintptr { - mp := getg().m - mp.libcall.n = 3 - mp.libcall.args = uintptr(noescape(unsafe.Pointer(&a0))) - return stdcall(fn) -} - -//go:nosplit -//go:cgo_unsafe_args -func stdcall4(fn stdFunction, a0, a1, a2, a3 uintptr) uintptr { - mp := getg().m - mp.libcall.n = 4 - mp.libcall.args = uintptr(noescape(unsafe.Pointer(&a0))) - return stdcall(fn) -} - -//go:nosplit -//go:cgo_unsafe_args -func stdcall5(fn stdFunction, a0, a1, a2, a3, a4 uintptr) uintptr { - mp := getg().m - mp.libcall.n = 5 - mp.libcall.args = uintptr(noescape(unsafe.Pointer(&a0))) - return stdcall(fn) -} - -//go:nosplit -//go:cgo_unsafe_args -func stdcall6(fn stdFunction, a0, a1, a2, a3, a4, a5 uintptr) uintptr { - mp := getg().m - mp.libcall.n = 6 - mp.libcall.args = uintptr(noescape(unsafe.Pointer(&a0))) - return stdcall(fn) -} - -//go:nosplit -//go:cgo_unsafe_args -func stdcall7(fn stdFunction, a0, a1, a2, a3, a4, a5, a6 uintptr) uintptr { - mp := getg().m - mp.libcall.n = 7 - mp.libcall.args = uintptr(noescape(unsafe.Pointer(&a0))) - return stdcall(fn) -} - -//go:nosplit -//go:cgo_unsafe_args -func stdcall8(fn stdFunction, a0, a1, a2, a3, a4, a5, a6, a7 uintptr) uintptr { - mp := getg().m - mp.libcall.n = 8 - mp.libcall.args = uintptr(noescape(unsafe.Pointer(&a0))) - return stdcall(fn) + return mp.stdCallInfo.R1 } // These must run on the system stack only. //go:nosplit func osyield_no_g() { - stdcall_no_g(_SwitchToThread, 0, 0) + stdcall_no_g(_SwitchToThread) } //go:nosplit func osyield() { systemstack(func() { - stdcall0(_SwitchToThread) + stdcall(_SwitchToThread) }) } //go:nosplit func usleep_no_g(us uint32) { timeout := uintptr(us) / 1000 // ms units - args := [...]uintptr{_INVALID_HANDLE_VALUE, timeout} - stdcall_no_g(_WaitForSingleObject, len(args), uintptr(noescape(unsafe.Pointer(&args[0])))) + stdcall_no_g(_WaitForSingleObject, _INVALID_HANDLE_VALUE, timeout) } //go:nosplit @@ -1086,13 +1012,13 @@ func usleep(us uint32) { if haveHighResTimer && getg().m.highResTimer != 0 { h = getg().m.highResTimer dt := -10 * int64(us) // relative sleep (negative), 100ns units - stdcall6(_SetWaitableTimer, h, uintptr(unsafe.Pointer(&dt)), 0, 0, 0, 0) + stdcall(_SetWaitableTimer, h, uintptr(unsafe.Pointer(&dt)), 0, 0, 0, 0) timeout = _INFINITE } else { h = _INVALID_HANDLE_VALUE timeout = uintptr(us) / 1000 // ms units } - stdcall2(_WaitForSingleObject, h, timeout) + stdcall(_WaitForSingleObject, h, timeout) }) } @@ -1133,7 +1059,7 @@ func profilem(mp *m, thread uintptr) { c = (*context)(unsafe.Pointer((uintptr(unsafe.Pointer(&cbuf[15]))) &^ 15)) c.contextflags = _CONTEXT_CONTROL - stdcall2(_GetThreadContext, thread, uintptr(unsafe.Pointer(c))) + stdcall(_GetThreadContext, thread, uintptr(unsafe.Pointer(c))) gp := gFromSP(mp, c.sp()) @@ -1154,10 +1080,10 @@ func gFromSP(mp *m, sp uintptr) *g { } func profileLoop() { - stdcall2(_SetThreadPriority, currentThread, _THREAD_PRIORITY_HIGHEST) + stdcall(_SetThreadPriority, currentThread, _THREAD_PRIORITY_HIGHEST) for { - stdcall2(_WaitForSingleObject, profiletimer, _INFINITE) + stdcall(_WaitForSingleObject, profiletimer, _INFINITE) first := (*m)(atomic.Loadp(unsafe.Pointer(&allm))) for mp := first; mp != nil; mp = mp.alllink { if mp == getg().m { @@ -1175,7 +1101,7 @@ func profileLoop() { } // Acquire our own handle to the thread. var thread uintptr - if stdcall7(_DuplicateHandle, currentProcess, mp.thread, currentProcess, uintptr(unsafe.Pointer(&thread)), 0, 0, _DUPLICATE_SAME_ACCESS) == 0 { + if stdcall(_DuplicateHandle, currentProcess, mp.thread, currentProcess, uintptr(unsafe.Pointer(&thread)), 0, 0, _DUPLICATE_SAME_ACCESS) == 0 { print("runtime: duplicatehandle failed; errno=", getlasterror(), "\n") throw("duplicatehandle failed") } @@ -1185,9 +1111,9 @@ func profileLoop() { // above and the SuspendThread. The handle // will remain valid, but SuspendThread may // fail. - if int32(stdcall1(_SuspendThread, thread)) == -1 { + if int32(stdcall(_SuspendThread, thread)) == -1 { // The thread no longer exists. - stdcall1(_CloseHandle, thread) + stdcall(_CloseHandle, thread) continue } if mp.profilehz != 0 && !mp.blocked { @@ -1195,8 +1121,8 @@ func profileLoop() { // was in the process of shutting down. profilem(mp, thread) } - stdcall1(_ResumeThread, thread) - stdcall1(_CloseHandle, thread) + stdcall(_ResumeThread, thread) + stdcall(_CloseHandle, thread) } } } @@ -1207,7 +1133,7 @@ func setProcessCPUProfiler(hz int32) { if haveHighResTimer { timer = createHighResTimer() } else { - timer = stdcall3(_CreateWaitableTimerA, 0, 0, 0) + timer = stdcall(_CreateWaitableTimerA, 0, 0, 0) } atomic.Storeuintptr(&profiletimer, timer) newm(profileLoop, nil, -1) @@ -1224,7 +1150,7 @@ func setThreadCPUProfiler(hz int32) { } due = int64(ms) * -10000 } - stdcall6(_SetWaitableTimer, profiletimer, uintptr(unsafe.Pointer(&due)), uintptr(ms), 0, 0, 0) + stdcall(_SetWaitableTimer, profiletimer, uintptr(unsafe.Pointer(&due)), uintptr(ms), 0, 0, 0) atomic.Store((*uint32)(unsafe.Pointer(&getg().m.profilehz)), uint32(hz)) } @@ -1257,7 +1183,7 @@ func preemptM(mp *m) { return } var thread uintptr - if stdcall7(_DuplicateHandle, currentProcess, mp.thread, currentProcess, uintptr(unsafe.Pointer(&thread)), 0, 0, _DUPLICATE_SAME_ACCESS) == 0 { + if stdcall(_DuplicateHandle, currentProcess, mp.thread, currentProcess, uintptr(unsafe.Pointer(&thread)), 0, 0, _DUPLICATE_SAME_ACCESS) == 0 { print("runtime.preemptM: duplicatehandle failed; errno=", getlasterror(), "\n") throw("runtime.preemptM: duplicatehandle failed") } @@ -1277,9 +1203,9 @@ func preemptM(mp *m) { lock(&suspendLock) // Suspend the thread. - if int32(stdcall1(_SuspendThread, thread)) == -1 { + if int32(stdcall(_SuspendThread, thread)) == -1 { unlock(&suspendLock) - stdcall1(_CloseHandle, thread) + stdcall(_CloseHandle, thread) atomic.Store(&mp.preemptExtLock, 0) // The thread no longer exists. This shouldn't be // possible, but just acknowledge the request. @@ -1296,7 +1222,7 @@ func preemptM(mp *m) { // We have to get the thread context before inspecting the M // because SuspendThread only requests a suspend. // GetThreadContext actually blocks until it's suspended. - stdcall2(_GetThreadContext, thread, uintptr(unsafe.Pointer(c))) + stdcall(_GetThreadContext, thread, uintptr(unsafe.Pointer(c))) unlock(&suspendLock) @@ -1307,7 +1233,7 @@ func preemptM(mp *m) { // Inject call to asyncPreempt targetPC := abi.FuncPCABI0(asyncPreempt) c.pushCall(targetPC, resumePC) - stdcall2(_SetThreadContext, thread, uintptr(unsafe.Pointer(c))) + stdcall(_SetThreadContext, thread, uintptr(unsafe.Pointer(c))) } } @@ -1316,8 +1242,8 @@ func preemptM(mp *m) { // Acknowledge the preemption. mp.preemptGen.Add(1) - stdcall1(_ResumeThread, thread) - stdcall1(_CloseHandle, thread) + stdcall(_ResumeThread, thread) + stdcall(_CloseHandle, thread) } // osPreemptExtEnter is called before entering external code that may diff --git a/src/runtime/os_windows_arm.go b/src/runtime/os_windows_arm.go index 10aff75e31..bc29843241 100644 --- a/src/runtime/os_windows_arm.go +++ b/src/runtime/os_windows_arm.go @@ -9,7 +9,7 @@ import "unsafe" //go:nosplit func cputicks() int64 { var counter int64 - stdcall1(_QueryPerformanceCounter, uintptr(unsafe.Pointer(&counter))) + stdcall(_QueryPerformanceCounter, uintptr(unsafe.Pointer(&counter))) return counter } diff --git a/src/runtime/os_windows_arm64.go b/src/runtime/os_windows_arm64.go index 7e413445ba..bd80c08b0e 100644 --- a/src/runtime/os_windows_arm64.go +++ b/src/runtime/os_windows_arm64.go @@ -9,6 +9,6 @@ import "unsafe" //go:nosplit func cputicks() int64 { var counter int64 - stdcall1(_QueryPerformanceCounter, uintptr(unsafe.Pointer(&counter))) + stdcall(_QueryPerformanceCounter, uintptr(unsafe.Pointer(&counter))) return counter } diff --git a/src/runtime/panic.go b/src/runtime/panic.go index 95305b84bc..8f9ab4dd47 100644 --- a/src/runtime/panic.go +++ b/src/runtime/panic.go @@ -112,13 +112,13 @@ func panicCheck2(err string) { //go:yeswritebarrierrec func goPanicIndex(x int, y int) { panicCheck1(sys.GetCallerPC(), "index out of range") - panic(boundsError{x: int64(x), signed: true, y: y, code: boundsIndex}) + panic(boundsError{x: int64(x), signed: true, y: y, code: abi.BoundsIndex}) } //go:yeswritebarrierrec func goPanicIndexU(x uint, y int) { panicCheck1(sys.GetCallerPC(), "index out of range") - panic(boundsError{x: int64(x), signed: false, y: y, code: boundsIndex}) + panic(boundsError{x: int64(x), signed: false, y: y, code: abi.BoundsIndex}) } // failures in the comparisons for s[:x], 0 <= x <= y (y == len(s) or cap(s)) @@ -126,25 +126,25 @@ func goPanicIndexU(x uint, y int) { //go:yeswritebarrierrec func goPanicSliceAlen(x int, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: true, y: y, code: boundsSliceAlen}) + panic(boundsError{x: int64(x), signed: true, y: y, code: abi.BoundsSliceAlen}) } //go:yeswritebarrierrec func goPanicSliceAlenU(x uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: false, y: y, code: boundsSliceAlen}) + panic(boundsError{x: int64(x), signed: false, y: y, code: abi.BoundsSliceAlen}) } //go:yeswritebarrierrec func goPanicSliceAcap(x int, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: true, y: y, code: boundsSliceAcap}) + panic(boundsError{x: int64(x), signed: true, y: y, code: abi.BoundsSliceAcap}) } //go:yeswritebarrierrec func goPanicSliceAcapU(x uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: false, y: y, code: boundsSliceAcap}) + panic(boundsError{x: int64(x), signed: false, y: y, code: abi.BoundsSliceAcap}) } // failures in the comparisons for s[x:y], 0 <= x <= y @@ -152,57 +152,57 @@ func goPanicSliceAcapU(x uint, y int) { //go:yeswritebarrierrec func goPanicSliceB(x int, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: true, y: y, code: boundsSliceB}) + panic(boundsError{x: int64(x), signed: true, y: y, code: abi.BoundsSliceB}) } //go:yeswritebarrierrec func goPanicSliceBU(x uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: false, y: y, code: boundsSliceB}) + panic(boundsError{x: int64(x), signed: false, y: y, code: abi.BoundsSliceB}) } // failures in the comparisons for s[::x], 0 <= x <= y (y == len(s) or cap(s)) func goPanicSlice3Alen(x int, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: true, y: y, code: boundsSlice3Alen}) + panic(boundsError{x: int64(x), signed: true, y: y, code: abi.BoundsSlice3Alen}) } func goPanicSlice3AlenU(x uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: false, y: y, code: boundsSlice3Alen}) + panic(boundsError{x: int64(x), signed: false, y: y, code: abi.BoundsSlice3Alen}) } func goPanicSlice3Acap(x int, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: true, y: y, code: boundsSlice3Acap}) + panic(boundsError{x: int64(x), signed: true, y: y, code: abi.BoundsSlice3Acap}) } func goPanicSlice3AcapU(x uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: false, y: y, code: boundsSlice3Acap}) + panic(boundsError{x: int64(x), signed: false, y: y, code: abi.BoundsSlice3Acap}) } // failures in the comparisons for s[:x:y], 0 <= x <= y func goPanicSlice3B(x int, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: true, y: y, code: boundsSlice3B}) + panic(boundsError{x: int64(x), signed: true, y: y, code: abi.BoundsSlice3B}) } func goPanicSlice3BU(x uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: false, y: y, code: boundsSlice3B}) + panic(boundsError{x: int64(x), signed: false, y: y, code: abi.BoundsSlice3B}) } // failures in the comparisons for s[x:y:], 0 <= x <= y func goPanicSlice3C(x int, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: true, y: y, code: boundsSlice3C}) + panic(boundsError{x: int64(x), signed: true, y: y, code: abi.BoundsSlice3C}) } func goPanicSlice3CU(x uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(x), signed: false, y: y, code: boundsSlice3C}) + panic(boundsError{x: int64(x), signed: false, y: y, code: abi.BoundsSlice3C}) } // failures in the conversion ([x]T)(s) or (*[x]T)(s), 0 <= x <= y, y == len(s) func goPanicSliceConvert(x int, y int) { panicCheck1(sys.GetCallerPC(), "slice length too short to convert to array or pointer to array") - panic(boundsError{x: int64(x), signed: true, y: y, code: boundsConvert}) + panic(boundsError{x: int64(x), signed: true, y: y, code: abi.BoundsConvert}) } // Implemented in assembly, as they take arguments in registers. @@ -225,6 +225,99 @@ func panicSlice3C(x int, y int) func panicSlice3CU(x uint, y int) func panicSliceConvert(x int, y int) +func panicBounds() // in asm_GOARCH.s files, called from generated code +func panicExtend() // in asm_GOARCH.s files, called from generated code (on 32-bit archs) +func panicBounds64(pc uintptr, regs *[16]int64) { // called from panicBounds on 64-bit archs + f := findfunc(pc) + v := pcdatavalue(f, abi.PCDATA_PanicBounds, pc-1) + + code, signed, xIsReg, yIsReg, xVal, yVal := abi.BoundsDecode(int(v)) + + if code == abi.BoundsIndex { + panicCheck1(pc, "index out of range") + } else { + panicCheck1(pc, "slice bounds out of range") + } + + var e boundsError + e.code = code + e.signed = signed + if xIsReg { + e.x = regs[xVal] + } else { + e.x = int64(xVal) + } + if yIsReg { + e.y = int(regs[yVal]) + } else { + e.y = yVal + } + panic(e) +} + +func panicBounds32(pc uintptr, regs *[16]int32) { // called from panicBounds on 32-bit archs + f := findfunc(pc) + v := pcdatavalue(f, abi.PCDATA_PanicBounds, pc-1) + + code, signed, xIsReg, yIsReg, xVal, yVal := abi.BoundsDecode(int(v)) + + if code == abi.BoundsIndex { + panicCheck1(pc, "index out of range") + } else { + panicCheck1(pc, "slice bounds out of range") + } + + var e boundsError + e.code = code + e.signed = signed + if xIsReg { + if signed { + e.x = int64(regs[xVal]) + } else { + e.x = int64(uint32(regs[xVal])) + } + } else { + e.x = int64(xVal) + } + if yIsReg { + e.y = int(regs[yVal]) + } else { + e.y = yVal + } + panic(e) +} + +func panicBounds32X(pc uintptr, regs *[16]int32) { // called from panicExtend on 32-bit archs + f := findfunc(pc) + v := pcdatavalue(f, abi.PCDATA_PanicBounds, pc-1) + + code, signed, xIsReg, yIsReg, xVal, yVal := abi.BoundsDecode(int(v)) + + if code == abi.BoundsIndex { + panicCheck1(pc, "index out of range") + } else { + panicCheck1(pc, "slice bounds out of range") + } + + var e boundsError + e.code = code + e.signed = signed + if xIsReg { + // Our 4-bit register numbers are actually 2 2-bit register numbers. + lo := xVal & 3 + hi := xVal >> 2 + e.x = int64(regs[hi])<<32 + int64(uint32(regs[lo])) + } else { + e.x = int64(xVal) + } + if yIsReg { + e.y = int(regs[yVal]) + } else { + e.y = yVal + } + panic(e) +} + var shiftError = error(errorString("negative shift amount")) //go:yeswritebarrierrec @@ -771,6 +864,7 @@ func gopanic(e any) { var p _panic p.arg = e + p.gopanicFP = unsafe.Pointer(sys.GetCallerSP()) runningPanicDefers.Add(1) @@ -865,10 +959,6 @@ func (p *_panic) nextDefer() (func(), bool) { } } - // The assembler adjusts p.argp in wrapper functions that shouldn't - // be visible to recover(), so we need to restore it each iteration. - p.argp = add(p.startSP, sys.MinFrameSize) - for { for p.deferBitsPtr != nil { bits := *p.deferBitsPtr @@ -993,27 +1083,89 @@ func (p *_panic) initOpenCodedDefers(fn funcInfo, varp unsafe.Pointer) bool { } // The implementation of the predeclared function recover. -// Cannot split the stack because it needs to reliably -// find the stack segment of its caller. -// -// TODO(rsc): Once we commit to CopyStackAlways, -// this doesn't need to be nosplit. -// -//go:nosplit -func gorecover(argp uintptr) any { - // Must be in a function running as part of a deferred call during the panic. - // Must be called from the topmost function of the call - // (the function used in the defer statement). - // p.argp is the argument pointer of that topmost deferred function call. - // Compare against argp reported by caller. - // If they match, the caller is the one who can recover. +func gorecover() any { gp := getg() p := gp._panic - if p != nil && !p.goexit && !p.recovered && argp == uintptr(p.argp) { - p.recovered = true - return p.arg + if p == nil || p.goexit || p.recovered { + return nil + } + + // Check to see if the function that called recover() was + // deferred directly from the panicking function. + // For code like: + // func foo() { + // defer bar() + // panic("panic") + // } + // func bar() { + // recover() + // } + // Normally the stack would look like this: + // foo + // runtime.gopanic + // bar + // runtime.gorecover + // + // However, if the function we deferred requires a wrapper + // of some sort, we need to ignore the wrapper. In that case, + // the stack looks like: + // foo + // runtime.gopanic + // wrapper + // bar + // runtime.gorecover + // And we should also successfully recover. + // + // Finally, in the weird case "defer recover()", the stack looks like: + // foo + // runtime.gopanic + // wrapper + // runtime.gorecover + // And we should not recover in that case. + // + // So our criteria is, there must be exactly one non-wrapper + // frame between gopanic and gorecover. + // + // We don't recover this: + // defer func() { func() { recover() }() } + // because there are 2 non-wrapper frames. + // + // We don't recover this: + // defer recover() + // because there are 0 non-wrapper frames. + canRecover := false + systemstack(func() { + var u unwinder + u.init(gp, 0) + u.next() // skip systemstack_switch + u.next() // skip gorecover + nonWrapperFrames := 0 + loop: + for ; u.valid(); u.next() { + for iu, f := newInlineUnwinder(u.frame.fn, u.symPC()); f.valid(); f = iu.next(f) { + sf := iu.srcFunc(f) + switch sf.funcID { + case abi.FuncIDWrapper: + continue + case abi.FuncID_gopanic: + if u.frame.fp == uintptr(p.gopanicFP) && nonWrapperFrames > 0 { + canRecover = true + } + break loop + default: + nonWrapperFrames++ + if nonWrapperFrames > 1 { + break loop + } + } + } + } + }) + if !canRecover { + return nil } - return nil + p.recovered = true + return p.arg } //go:linkname sync_throw sync.throw diff --git a/src/runtime/panic32.go b/src/runtime/panic32.go index cd34485a96..9dd4c0eb2e 100644 --- a/src/runtime/panic32.go +++ b/src/runtime/panic32.go @@ -7,6 +7,7 @@ package runtime import ( + "internal/abi" "internal/runtime/sys" ) @@ -16,77 +17,77 @@ import ( // failures in the comparisons for s[x], 0 <= x < y (y == len(s)) func goPanicExtendIndex(hi int, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "index out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: boundsIndex}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: abi.BoundsIndex}) } func goPanicExtendIndexU(hi uint, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "index out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: boundsIndex}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: abi.BoundsIndex}) } // failures in the comparisons for s[:x], 0 <= x <= y (y == len(s) or cap(s)) func goPanicExtendSliceAlen(hi int, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: boundsSliceAlen}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: abi.BoundsSliceAlen}) } func goPanicExtendSliceAlenU(hi uint, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: boundsSliceAlen}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: abi.BoundsSliceAlen}) } func goPanicExtendSliceAcap(hi int, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: boundsSliceAcap}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: abi.BoundsSliceAcap}) } func goPanicExtendSliceAcapU(hi uint, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: boundsSliceAcap}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: abi.BoundsSliceAcap}) } // failures in the comparisons for s[x:y], 0 <= x <= y func goPanicExtendSliceB(hi int, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: boundsSliceB}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: abi.BoundsSliceB}) } func goPanicExtendSliceBU(hi uint, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: boundsSliceB}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: abi.BoundsSliceB}) } // failures in the comparisons for s[::x], 0 <= x <= y (y == len(s) or cap(s)) func goPanicExtendSlice3Alen(hi int, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: boundsSlice3Alen}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: abi.BoundsSlice3Alen}) } func goPanicExtendSlice3AlenU(hi uint, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: boundsSlice3Alen}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: abi.BoundsSlice3Alen}) } func goPanicExtendSlice3Acap(hi int, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: boundsSlice3Acap}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: abi.BoundsSlice3Acap}) } func goPanicExtendSlice3AcapU(hi uint, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: boundsSlice3Acap}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: abi.BoundsSlice3Acap}) } // failures in the comparisons for s[:x:y], 0 <= x <= y func goPanicExtendSlice3B(hi int, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: boundsSlice3B}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: abi.BoundsSlice3B}) } func goPanicExtendSlice3BU(hi uint, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: boundsSlice3B}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: abi.BoundsSlice3B}) } // failures in the comparisons for s[x:y:], 0 <= x <= y func goPanicExtendSlice3C(hi int, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: boundsSlice3C}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: true, y: y, code: abi.BoundsSlice3C}) } func goPanicExtendSlice3CU(hi uint, lo uint, y int) { panicCheck1(sys.GetCallerPC(), "slice bounds out of range") - panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: boundsSlice3C}) + panic(boundsError{x: int64(hi)<<32 + int64(lo), signed: false, y: y, code: abi.BoundsSlice3C}) } // Implemented in assembly, as they take arguments in registers. diff --git a/src/runtime/pinner.go b/src/runtime/pinner.go index 543bfdb7a4..424dd065ef 100644 --- a/src/runtime/pinner.go +++ b/src/runtime/pinner.go @@ -108,7 +108,7 @@ func pinnerGetPtr(i *any) unsafe.Pointer { if etyp == nil { panic(errorString("runtime.Pinner: argument is nil")) } - if kind := etyp.Kind_ & abi.KindMask; kind != abi.Pointer && kind != abi.UnsafePointer { + if kind := etyp.Kind(); kind != abi.Pointer && kind != abi.UnsafePointer { panic(errorString("runtime.Pinner: argument is not a pointer: " + toRType(etyp).string())) } if inUserArenaChunk(uintptr(e.data)) { diff --git a/src/runtime/plugin.go b/src/runtime/plugin.go index 4b6821b1fb..49cf13cb64 100644 --- a/src/runtime/plugin.go +++ b/src/runtime/plugin.go @@ -88,7 +88,7 @@ func plugin_lastmoduleinit() (path string, syms map[string]any, initTasks []*ini (*valp)[0] = unsafe.Pointer(t) name := symName.Name() - if t.Kind_&abi.KindMask == abi.Func { + if t.Kind() == abi.Func { name = "." + name } syms[name] = val diff --git a/src/runtime/proc.go b/src/runtime/proc.go index bee3b26c0e..25d39d9ba3 100644 --- a/src/runtime/proc.go +++ b/src/runtime/proc.go @@ -862,10 +862,10 @@ func schedinit() { ticks.init() // run as early as possible moduledataverify() stackinit() + randinit() // must run before mallocinit, alginit, mcommoninit mallocinit() godebug := getGodebugEarly() cpuinit(godebug) // must run before alginit - randinit() // must run before alginit, mcommoninit alginit() // maps, hash, rand must not be used before this call mcommoninit(gp.m, -1) modulesinit() // provides activeModules @@ -6200,10 +6200,6 @@ func checkdead() { // This is a variable for testing purposes. It normally doesn't change. var forcegcperiod int64 = 2 * 60 * 1e9 -// needSysmonWorkaround is true if the workaround for -// golang.org/issue/42515 is needed on NetBSD. -var needSysmonWorkaround bool = false - // haveSysmon indicates whether there is sysmon thread support. // // No threads on wasm yet, so no sysmon. @@ -6312,26 +6308,6 @@ func sysmon() { netpollAdjustWaiters(delta) } } - if GOOS == "netbsd" && needSysmonWorkaround { - // netpoll is responsible for waiting for timer - // expiration, so we typically don't have to worry - // about starting an M to service timers. (Note that - // sleep for timeSleepUntil above simply ensures sysmon - // starts running again when that timer expiration may - // cause Go code to run again). - // - // However, netbsd has a kernel bug that sometimes - // misses netpollBreak wake-ups, which can lead to - // unbounded delays servicing timers. If we detect this - // overrun, then startm to get something to handle the - // timer. - // - // See issue 42515 and - // https://gnats.netbsd.org/cgi-bin/query-pr-single.pl?number=50094. - if next := timeSleepUntil(); next < now { - startm(nil, false, false) - } - } // Check if we need to update GOMAXPROCS at most once per second. if debug.updatemaxprocs != 0 && lastgomaxprocs+1e9 <= now { sysmonUpdateGOMAXPROCS() diff --git a/src/runtime/race.go b/src/runtime/race.go index 7e7bca76ac..2cd4e3a9a2 100644 --- a/src/runtime/race.go +++ b/src/runtime/race.go @@ -156,7 +156,7 @@ const raceenabled = true // callerpc is a return PC of the function that calls this function, // pc is start PC of the function that calls this function. func raceReadObjectPC(t *_type, addr unsafe.Pointer, callerpc, pc uintptr) { - kind := t.Kind_ & abi.KindMask + kind := t.Kind() if kind == abi.Array || kind == abi.Struct { // for composite objects we have to read every address // because a write might happen to any subobject. @@ -174,7 +174,7 @@ func race_ReadObjectPC(t *abi.Type, addr unsafe.Pointer, callerpc, pc uintptr) { } func raceWriteObjectPC(t *_type, addr unsafe.Pointer, callerpc, pc uintptr) { - kind := t.Kind_ & abi.KindMask + kind := t.Kind() if kind == abi.Array || kind == abi.Struct { // for composite objects we have to write every address // because a write might happen to any subobject. diff --git a/src/runtime/race/testdata/rangefunc_test.go b/src/runtime/race/testdata/rangefunc_test.go index 453c0733ed..986395bfb9 100644 --- a/src/runtime/race/testdata/rangefunc_test.go +++ b/src/runtime/race/testdata/rangefunc_test.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.rangefunc - package race_test import ( diff --git a/src/runtime/rt0_openbsd_mips64.s b/src/runtime/rt0_openbsd_mips64.s deleted file mode 100644 index 82a8dfaba6..0000000000 --- a/src/runtime/rt0_openbsd_mips64.s +++ /dev/null @@ -1,36 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -#include "textflag.h" - -TEXT _rt0_mips64_openbsd(SB),NOSPLIT,$0 - JMP _main<>(SB) - -TEXT _rt0_mips64le_openbsd(SB),NOSPLIT,$0 - JMP _main<>(SB) - -TEXT _main<>(SB),NOSPLIT|NOFRAME,$0 - // In a statically linked binary, the stack contains argc, - // argv as argc string pointers followed by a NULL, envv as a - // sequence of string pointers followed by a NULL, and auxv. - // There is no TLS base pointer. -#ifdef GOARCH_mips64 - MOVW 4(R29), R4 // argc, big-endian ABI places int32 at offset 4 -#else - MOVW 0(R29), R4 // argc -#endif - ADDV $8, R29, R5 // argv - JMP main(SB) - -TEXT main(SB),NOSPLIT|NOFRAME,$0 - // in external linking, glibc jumps to main with argc in R4 - // and argv in R5 - - // initialize REGSB = PC&0xffffffff00000000 - BGEZAL R0, 1(PC) - SRLV $32, R31, RSB - SLLV $32, RSB - - MOVV $runtime·rt0_go(SB), R1 - JMP (R1) diff --git a/src/runtime/runtime-gdb.py b/src/runtime/runtime-gdb.py index 6d99515176..345a59605e 100644 --- a/src/runtime/runtime-gdb.py +++ b/src/runtime/runtime-gdb.py @@ -160,14 +160,7 @@ class MapTypePrinter: return str(self.val.type) def children(self): - fields = [f.name for f in self.val.type.strip_typedefs().target().fields()] - if 'buckets' in fields: - yield from self.old_map_children() - else: - yield from self.swiss_map_children() - - def swiss_map_children(self): - SwissMapGroupSlots = 8 # see internal/abi:SwissMapGroupSlots + MapGroupSlots = 8 # see internal/abi:MapGroupSlots cnt = 0 # Yield keys and elements in group. @@ -175,7 +168,7 @@ class MapTypePrinter: def group_slots(group): ctrl = group['ctrl'] - for i in xrange(SwissMapGroupSlots): + for i in xrange(MapGroupSlots): c = (ctrl >> (8*i)) & 0xff if (c & 0x80) != 0: # Empty or deleted @@ -186,7 +179,7 @@ class MapTypePrinter: yield str(cnt+1), group['slots'][i]['elem'] # The linker DWARF generation - # (cmd/link/internal/ld.(*dwctxt).synthesizemaptypesSwiss) records + # (cmd/link/internal/ld.(*dwctxt).synthesizemaptypes) records # dirPtr as a **table[K,V], but it may actually be two different types: # # For "full size" maps (dirLen > 0), dirPtr is actually a pointer to @@ -249,7 +242,7 @@ class MapTypePrinter: length = table['groups']['lengthMask'] + 1 # The linker DWARF generation - # (cmd/link/internal/ld.(*dwctxt).synthesizemaptypesSwiss) records + # (cmd/link/internal/ld.(*dwctxt).synthesizemaptypes) records # groups.data as a *group[K,V], but it is actually a pointer to # variable length array *[length]group[K,V]. # @@ -270,40 +263,6 @@ class MapTypePrinter: yield from group_slots(group) - def old_map_children(self): - MapBucketCount = 8 # see internal/abi:OldMapBucketCount - B = self.val['B'] - buckets = self.val['buckets'] - oldbuckets = self.val['oldbuckets'] - flags = self.val['flags'] - inttype = self.val['hash0'].type - cnt = 0 - for bucket in xrange(2 ** int(B)): - bp = buckets + bucket - if oldbuckets: - oldbucket = bucket & (2 ** (B - 1) - 1) - oldbp = oldbuckets + oldbucket - oldb = oldbp.dereference() - if (oldb['overflow'].cast(inttype) & 1) == 0: # old bucket not evacuated yet - if bucket >= 2 ** (B - 1): - continue # already did old bucket - bp = oldbp - while bp: - b = bp.dereference() - for i in xrange(MapBucketCount): - if b['tophash'][i] != 0: - k = b['keys'][i] - v = b['values'][i] - if flags & 1: - k = k.dereference() - if flags & 2: - v = v.dereference() - yield str(cnt), k - yield str(cnt + 1), v - cnt += 2 - bp = b['overflow'] - - class ChanTypePrinter: """Pretty print chan[T] types. diff --git a/src/runtime/runtime-gdb_test.go b/src/runtime/runtime-gdb_test.go index 47c1fe5851..e81efadeb3 100644 --- a/src/runtime/runtime-gdb_test.go +++ b/src/runtime/runtime-gdb_test.go @@ -8,8 +8,6 @@ import ( "bytes" "flag" "fmt" - "internal/abi" - "internal/goexperiment" "internal/testenv" "os" "os/exec" @@ -155,9 +153,6 @@ func checkPtraceScope(t *testing.T) { } } -// NOTE: the maps below are allocated larger than abi.MapBucketCount -// to ensure that they are not "optimized out". - var helloSource = ` import "fmt" import "runtime" @@ -166,19 +161,21 @@ var gslice []string var smallmapvar map[string]string func main() { smallmapvar = make(map[string]string) - mapvar := make(map[string]string, ` + strconv.FormatInt(abi.OldMapBucketCount+9, 10) + `) - slicemap := make(map[string][]string,` + strconv.FormatInt(abi.OldMapBucketCount+3, 10) + `) - chanint := make(chan int, 10) - chanstr := make(chan string, 10) - chanint <- 99 + // NOTE: the maps below are allocated large to ensure that they are not + // "optimized out". + mapvar := make(map[string]string, 10) + slicemap := make(map[string][]string, 10) + chanint := make(chan int, 10) + chanstr := make(chan string, 10) + chanint <- 99 chanint <- 11 - chanstr <- "spongepants" - chanstr <- "squarebob" + chanstr <- "spongepants" + chanstr <- "squarebob" smallmapvar["abc"] = "def" mapvar["abc"] = "def" mapvar["ghi"] = "jkl" slicemap["a"] = []string{"b","c","d"} - slicemap["e"] = []string{"f","g","h"} + slicemap["e"] = []string{"f","g","h"} strvar := "abc" ptrvar := &strvar slicevar := make([]string, 0, 16) @@ -638,20 +635,10 @@ func TestGdbAutotmpTypes(t *testing.T) { types := []string{ "[]main.astruct", "main.astruct", - } - if goexperiment.SwissMap { - types = append(types, []string{ - "groupReference<string,main.astruct>", - "table<string,main.astruct>", - "map<string,main.astruct>", - "map<string,main.astruct> * map[string]main.astruct", - }...) - } else { - types = append(types, []string{ - "bucket<string,main.astruct>", - "hash<string,main.astruct>", - "hash<string,main.astruct> * map[string]main.astruct", - }...) + "groupReference<string,main.astruct>", + "table<string,main.astruct>", + "map<string,main.astruct>", + "map<string,main.astruct> * map[string]main.astruct", } for _, name := range types { if !strings.Contains(sgot, name) { diff --git a/src/runtime/runtime2.go b/src/runtime/runtime2.go index 1e2de52989..b5d2dcefad 100644 --- a/src/runtime/runtime2.go +++ b/src/runtime/runtime2.go @@ -597,9 +597,7 @@ type m struct { freelink *m // on sched.freem trace mTraceState - // these are here because they are too large to be on the stack - // of low-level NOSPLIT functions. - libcall libcall + // These are here to avoid using the G stack so the stack can move during the call. libcallpc uintptr // for cpu profiler libcallsp uintptr libcallg guintptr @@ -1009,14 +1007,13 @@ type _defer struct { // // A _panic value must only ever live on the stack. // -// The argp and link fields are stack pointers, but don't need special +// The gopanicFP and link fields are stack pointers, but don't need special // handling during stack growth: because they are pointer-typed and // _panic values only live on the stack, regular stack pointer // adjustment takes care of them. type _panic struct { - argp unsafe.Pointer // pointer to arguments of deferred call run during panic; cannot move - known to liblink - arg any // argument to panic - link *_panic // link to earlier panic + arg any // argument to panic + link *_panic // link to earlier panic // startPC and startSP track where _panic.start was called. startPC uintptr @@ -1039,6 +1036,8 @@ type _panic struct { repanicked bool // whether this panic repanicked goexit bool deferreturn bool + + gopanicFP unsafe.Pointer // frame pointer of the gopanic frame } // savedOpenDeferState tracks the extra state from _panic that's diff --git a/src/runtime/set_vma_name_linux.go b/src/runtime/set_vma_name_linux.go index 100c2bfeca..9b6654f332 100644 --- a/src/runtime/set_vma_name_linux.go +++ b/src/runtime/set_vma_name_linux.go @@ -8,7 +8,7 @@ package runtime import ( "internal/runtime/atomic" - "internal/runtime/syscall" + "internal/runtime/syscall/linux" "unsafe" ) @@ -24,7 +24,7 @@ func setVMAName(start unsafe.Pointer, length uintptr, name string) { n := copy(sysName[:], " Go: ") copy(sysName[n:79], name) // leave final byte zero - _, _, err := syscall.Syscall6(syscall.SYS_PRCTL, syscall.PR_SET_VMA, syscall.PR_SET_VMA_ANON_NAME, uintptr(start), length, uintptr(unsafe.Pointer(&sysName[0])), 0) + _, _, err := linux.Syscall6(linux.SYS_PRCTL, linux.PR_SET_VMA, linux.PR_SET_VMA_ANON_NAME, uintptr(start), length, uintptr(unsafe.Pointer(&sysName[0])), 0) if err == _EINVAL { prSetVMAUnsupported.Store(true) } diff --git a/src/runtime/signal_mips64x.go b/src/runtime/signal_mips64x.go index cee1bf7a1b..eea2169408 100644 --- a/src/runtime/signal_mips64x.go +++ b/src/runtime/signal_mips64x.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (linux || openbsd) && (mips64 || mips64le) +//go:build linux && (mips64 || mips64le) package runtime diff --git a/src/runtime/signal_openbsd_mips64.go b/src/runtime/signal_openbsd_mips64.go deleted file mode 100644 index 54ed523c7b..0000000000 --- a/src/runtime/signal_openbsd_mips64.go +++ /dev/null @@ -1,78 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package runtime - -import ( - "unsafe" -) - -type sigctxt struct { - info *siginfo - ctxt unsafe.Pointer -} - -//go:nosplit -//go:nowritebarrierrec -func (c *sigctxt) regs() *sigcontext { - return (*sigcontext)(c.ctxt) -} - -func (c *sigctxt) r0() uint64 { return c.regs().sc_regs[0] } -func (c *sigctxt) r1() uint64 { return c.regs().sc_regs[1] } -func (c *sigctxt) r2() uint64 { return c.regs().sc_regs[2] } -func (c *sigctxt) r3() uint64 { return c.regs().sc_regs[3] } -func (c *sigctxt) r4() uint64 { return c.regs().sc_regs[4] } -func (c *sigctxt) r5() uint64 { return c.regs().sc_regs[5] } -func (c *sigctxt) r6() uint64 { return c.regs().sc_regs[6] } -func (c *sigctxt) r7() uint64 { return c.regs().sc_regs[7] } -func (c *sigctxt) r8() uint64 { return c.regs().sc_regs[8] } -func (c *sigctxt) r9() uint64 { return c.regs().sc_regs[9] } -func (c *sigctxt) r10() uint64 { return c.regs().sc_regs[10] } -func (c *sigctxt) r11() uint64 { return c.regs().sc_regs[11] } -func (c *sigctxt) r12() uint64 { return c.regs().sc_regs[12] } -func (c *sigctxt) r13() uint64 { return c.regs().sc_regs[13] } -func (c *sigctxt) r14() uint64 { return c.regs().sc_regs[14] } -func (c *sigctxt) r15() uint64 { return c.regs().sc_regs[15] } -func (c *sigctxt) r16() uint64 { return c.regs().sc_regs[16] } -func (c *sigctxt) r17() uint64 { return c.regs().sc_regs[17] } -func (c *sigctxt) r18() uint64 { return c.regs().sc_regs[18] } -func (c *sigctxt) r19() uint64 { return c.regs().sc_regs[19] } -func (c *sigctxt) r20() uint64 { return c.regs().sc_regs[20] } -func (c *sigctxt) r21() uint64 { return c.regs().sc_regs[21] } -func (c *sigctxt) r22() uint64 { return c.regs().sc_regs[22] } -func (c *sigctxt) r23() uint64 { return c.regs().sc_regs[23] } -func (c *sigctxt) r24() uint64 { return c.regs().sc_regs[24] } -func (c *sigctxt) r25() uint64 { return c.regs().sc_regs[25] } -func (c *sigctxt) r26() uint64 { return c.regs().sc_regs[26] } -func (c *sigctxt) r27() uint64 { return c.regs().sc_regs[27] } -func (c *sigctxt) r28() uint64 { return c.regs().sc_regs[28] } -func (c *sigctxt) r29() uint64 { return c.regs().sc_regs[29] } -func (c *sigctxt) r30() uint64 { return c.regs().sc_regs[30] } -func (c *sigctxt) r31() uint64 { return c.regs().sc_regs[31] } -func (c *sigctxt) sp() uint64 { return c.regs().sc_regs[29] } - -//go:nosplit -//go:nowritebarrierrec -func (c *sigctxt) pc() uint64 { return c.regs().sc_pc } - -func (c *sigctxt) link() uint64 { return c.regs().sc_regs[31] } -func (c *sigctxt) lo() uint64 { return c.regs().mullo } -func (c *sigctxt) hi() uint64 { return c.regs().mulhi } - -func (c *sigctxt) sigcode() uint32 { return uint32(c.info.si_code) } -func (c *sigctxt) sigaddr() uint64 { - return *(*uint64)(add(unsafe.Pointer(c.info), 16)) -} - -func (c *sigctxt) set_r28(x uint64) { c.regs().sc_regs[28] = x } -func (c *sigctxt) set_r30(x uint64) { c.regs().sc_regs[30] = x } -func (c *sigctxt) set_pc(x uint64) { c.regs().sc_pc = x } -func (c *sigctxt) set_sp(x uint64) { c.regs().sc_regs[29] = x } -func (c *sigctxt) set_link(x uint64) { c.regs().sc_regs[31] = x } - -func (c *sigctxt) set_sigcode(x uint32) { c.info.si_code = int32(x) } -func (c *sigctxt) set_sigaddr(x uint64) { - *(*uint64)(add(unsafe.Pointer(c.info), 16)) = x -} diff --git a/src/runtime/signal_windows.go b/src/runtime/signal_windows.go index 7d7734433e..07778c8ebe 100644 --- a/src/runtime/signal_windows.go +++ b/src/runtime/signal_windows.go @@ -18,24 +18,24 @@ const ( ) func preventErrorDialogs() { - errormode := stdcall0(_GetErrorMode) - stdcall1(_SetErrorMode, errormode|_SEM_FAILCRITICALERRORS|_SEM_NOGPFAULTERRORBOX|_SEM_NOOPENFILEERRORBOX) + errormode := stdcall(_GetErrorMode) + stdcall(_SetErrorMode, errormode|_SEM_FAILCRITICALERRORS|_SEM_NOGPFAULTERRORBOX|_SEM_NOOPENFILEERRORBOX) // Disable WER fault reporting UI. // Do this even if WER is disabled as a whole, // as WER might be enabled later with setTraceback("wer") // and we still want the fault reporting UI to be disabled if this happens. var werflags uintptr - stdcall2(_WerGetFlags, currentProcess, uintptr(unsafe.Pointer(&werflags))) - stdcall1(_WerSetFlags, werflags|_WER_FAULT_REPORTING_NO_UI) + stdcall(_WerGetFlags, currentProcess, uintptr(unsafe.Pointer(&werflags))) + stdcall(_WerSetFlags, werflags|_WER_FAULT_REPORTING_NO_UI) } // enableWER re-enables Windows error reporting without fault reporting UI. func enableWER() { // re-enable Windows Error Reporting - errormode := stdcall0(_GetErrorMode) + errormode := stdcall(_GetErrorMode) if errormode&_SEM_NOGPFAULTERRORBOX != 0 { - stdcall1(_SetErrorMode, errormode^_SEM_NOGPFAULTERRORBOX) + stdcall(_SetErrorMode, errormode^_SEM_NOGPFAULTERRORBOX) } } @@ -47,14 +47,14 @@ func sehtramp() func sigresume() func initExceptionHandler() { - stdcall2(_AddVectoredExceptionHandler, 1, abi.FuncPCABI0(exceptiontramp)) + stdcall(_AddVectoredExceptionHandler, 1, abi.FuncPCABI0(exceptiontramp)) if GOARCH == "386" { // use SetUnhandledExceptionFilter for windows-386. // note: SetUnhandledExceptionFilter handler won't be called, if debugging. - stdcall1(_SetUnhandledExceptionFilter, abi.FuncPCABI0(lastcontinuetramp)) + stdcall(_SetUnhandledExceptionFilter, abi.FuncPCABI0(lastcontinuetramp)) } else { - stdcall2(_AddVectoredContinueHandler, 1, abi.FuncPCABI0(firstcontinuetramp)) - stdcall2(_AddVectoredContinueHandler, 0, abi.FuncPCABI0(lastcontinuetramp)) + stdcall(_AddVectoredContinueHandler, 1, abi.FuncPCABI0(firstcontinuetramp)) + stdcall(_AddVectoredContinueHandler, 0, abi.FuncPCABI0(lastcontinuetramp)) } } @@ -279,11 +279,11 @@ func sehhandler(_ *exceptionrecord, _ uint64, _ *context, dctxt *_DISPATCHER_CON ctxt := dctxt.ctx() var base, sp uintptr for { - entry := stdcall3(_RtlLookupFunctionEntry, ctxt.ip(), uintptr(unsafe.Pointer(&base)), 0) + entry := stdcall(_RtlLookupFunctionEntry, ctxt.ip(), uintptr(unsafe.Pointer(&base)), 0) if entry == 0 { break } - stdcall8(_RtlVirtualUnwind, 0, base, ctxt.ip(), entry, uintptr(unsafe.Pointer(ctxt)), 0, uintptr(unsafe.Pointer(&sp)), 0) + stdcall(_RtlVirtualUnwind, 0, base, ctxt.ip(), entry, uintptr(unsafe.Pointer(ctxt)), 0, uintptr(unsafe.Pointer(&sp)), 0) if sp < gp.stack.lo || gp.stack.hi <= sp { break } @@ -467,7 +467,7 @@ func dieFromException(info *exceptionrecord, r *context) { } } const FAIL_FAST_GENERATE_EXCEPTION_ADDRESS = 0x1 - stdcall3(_RaiseFailFastException, uintptr(unsafe.Pointer(info)), uintptr(unsafe.Pointer(r)), FAIL_FAST_GENERATE_EXCEPTION_ADDRESS) + stdcall(_RaiseFailFastException, uintptr(unsafe.Pointer(info)), uintptr(unsafe.Pointer(r)), FAIL_FAST_GENERATE_EXCEPTION_ADDRESS) } // gsignalStack is unused on Windows. diff --git a/src/runtime/slice.go b/src/runtime/slice.go index 79d3f6c0de..e31d5dccb2 100644 --- a/src/runtime/slice.go +++ b/src/runtime/slice.go @@ -397,5 +397,5 @@ func bytealg_MakeNoZero(len int) []byte { panicmakeslicelen() } cap := roundupsize(uintptr(len), true) - return unsafe.Slice((*byte)(mallocgc(uintptr(cap), nil, false)), cap)[:len] + return unsafe.Slice((*byte)(mallocgc(cap, nil, false)), cap)[:len] } diff --git a/src/runtime/symtab.go b/src/runtime/symtab.go index 866c46a83d..56f2a00d76 100644 --- a/src/runtime/symtab.go +++ b/src/runtime/symtab.go @@ -647,8 +647,15 @@ func moduledataverify1(datap *moduledata) { min := datap.textAddr(datap.ftab[0].entryoff) max := datap.textAddr(datap.ftab[nftab].entryoff) - if datap.minpc != min || datap.maxpc != max { - println("minpc=", hex(datap.minpc), "min=", hex(min), "maxpc=", hex(datap.maxpc), "max=", hex(max)) + minpc := datap.minpc + maxpc := datap.maxpc + if GOARCH == "wasm" { + // On Wasm, the func table contains the function index, whereas + // the "PC" is function index << 16 + block index. + maxpc = alignUp(maxpc, 1<<16) // round up for end PC + } + if minpc != min || maxpc != max { + println("minpc=", hex(minpc), "min=", hex(min), "maxpc=", hex(maxpc), "max=", hex(max)) throw("minpc or maxpc invalid") } @@ -694,6 +701,11 @@ func (md *moduledata) textAddr(off32 uint32) uintptr { throw("runtime: text offset out of range") } } + if GOARCH == "wasm" { + // On Wasm, a text offset (e.g. in the method table) is function index, whereas + // the "PC" is function index << 16 + block index. + res <<= 16 + } return res } @@ -704,8 +716,17 @@ func (md *moduledata) textAddr(off32 uint32) uintptr { // //go:nosplit func (md *moduledata) textOff(pc uintptr) (uint32, bool) { - res := uint32(pc - md.text) + off := pc - md.text + if GOARCH == "wasm" { + // On Wasm, the func table contains the function index, whereas + // the "PC" is function index << 16 + block index. + off >>= 16 + } + res := uint32(off) if len(md.textsectmap) > 1 { + if GOARCH == "wasm" { + fatal("unexpected multiple text sections on Wasm") + } for i, sect := range md.textsectmap { if sect.baseaddr > pc { // pc is not in any section. @@ -904,6 +925,11 @@ func findfunc(pc uintptr) funcInfo { } x := uintptr(pcOff) + datap.text - datap.minpc // TODO: are datap.text and datap.minpc always equal? + if GOARCH == "wasm" { + // On Wasm, pcOff is the function index, whereas + // the "PC" is function index << 16 + block index. + x = uintptr(pcOff)<<16 + datap.text - datap.minpc + } b := x / abi.FuncTabBucketSize i := x % abi.FuncTabBucketSize / (abi.FuncTabBucketSize / nsub) diff --git a/src/runtime/sys_aix_ppc64.s b/src/runtime/sys_aix_ppc64.s index 66081977b1..a0ef7e111a 100644 --- a/src/runtime/sys_aix_ppc64.s +++ b/src/runtime/sys_aix_ppc64.s @@ -130,15 +130,15 @@ TEXT sigtramp<>(SB),NOSPLIT|NOFRAME|TOPFRAME,$0 // Save m->libcall. We need to do this because we // might get interrupted by a signal in runtime·asmcgocall. - MOVD (m_libcall+libcall_fn)(R6), R7 + MOVD (m_mOS+mOS_libcall+libcall_fn)(R6), R7 MOVD R7, 96(R1) - MOVD (m_libcall+libcall_args)(R6), R7 + MOVD (m_mOS+mOS_libcall+libcall_args)(R6), R7 MOVD R7, 104(R1) - MOVD (m_libcall+libcall_n)(R6), R7 + MOVD (m_mOS+mOS_libcall+libcall_n)(R6), R7 MOVD R7, 112(R1) - MOVD (m_libcall+libcall_r1)(R6), R7 + MOVD (m_mOS+mOS_libcall+libcall_r1)(R6), R7 MOVD R7, 120(R1) - MOVD (m_libcall+libcall_r2)(R6), R7 + MOVD (m_mOS+mOS_libcall+libcall_r2)(R6), R7 MOVD R7, 128(R1) // save errno, it might be EINTR; stuff we do here might reset it. @@ -162,15 +162,15 @@ sigtramp: // restore libcall MOVD 96(R1), R7 - MOVD R7, (m_libcall+libcall_fn)(R6) + MOVD R7, (m_mOS+mOS_libcall+libcall_fn)(R6) MOVD 104(R1), R7 - MOVD R7, (m_libcall+libcall_args)(R6) + MOVD R7, (m_mOS+mOS_libcall+libcall_args)(R6) MOVD 112(R1), R7 - MOVD R7, (m_libcall+libcall_n)(R6) + MOVD R7, (m_mOS+mOS_libcall+libcall_n)(R6) MOVD 120(R1), R7 - MOVD R7, (m_libcall+libcall_r1)(R6) + MOVD R7, (m_mOS+mOS_libcall+libcall_r1)(R6) MOVD 128(R1), R7 - MOVD R7, (m_libcall+libcall_r2)(R6) + MOVD R7, (m_mOS+mOS_libcall+libcall_r2)(R6) // restore errno MOVD (m_mOS+mOS_perrno)(R6), R7 diff --git a/src/runtime/sys_libc.go b/src/runtime/sys_libc.go index 72d8991559..214e879319 100644 --- a/src/runtime/sys_libc.go +++ b/src/runtime/sys_libc.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build darwin || (openbsd && !mips64) +//go:build darwin || openbsd package runtime diff --git a/src/runtime/sys_openbsd.go b/src/runtime/sys_openbsd.go index c4b8489612..df503d24c6 100644 --- a/src/runtime/sys_openbsd.go +++ b/src/runtime/sys_openbsd.go @@ -2,12 +2,11 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build openbsd && !mips64 - package runtime import ( "internal/abi" + "internal/runtime/atomic" "unsafe" ) @@ -61,6 +60,412 @@ func pthread_create(attr *pthreadattr, start uintptr, arg unsafe.Pointer) int32 } func pthread_create_trampoline() +//go:nosplit +//go:cgo_unsafe_args +func thrsleep(ident uintptr, clock_id int32, tsp *timespec, lock uintptr, abort *uint32) int32 { + ret := libcCall(unsafe.Pointer(abi.FuncPCABI0(thrsleep_trampoline)), unsafe.Pointer(&ident)) + KeepAlive(tsp) + KeepAlive(abort) + return ret +} +func thrsleep_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func thrwakeup(ident uintptr, n int32) int32 { + return libcCall(unsafe.Pointer(abi.FuncPCABI0(thrwakeup_trampoline)), unsafe.Pointer(&ident)) +} +func thrwakeup_trampoline() + +//go:nosplit +func osyield() { + libcCall(unsafe.Pointer(abi.FuncPCABI0(sched_yield_trampoline)), unsafe.Pointer(nil)) +} +func sched_yield_trampoline() + +//go:nosplit +func osyield_no_g() { + asmcgocall_no_g(unsafe.Pointer(abi.FuncPCABI0(sched_yield_trampoline)), unsafe.Pointer(nil)) +} + +// This is exported via linkname to assembly in runtime/cgo. +// +//go:linkname exit +//go:nosplit +//go:cgo_unsafe_args +func exit(code int32) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(exit_trampoline)), unsafe.Pointer(&code)) +} +func exit_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func getthrid() (tid int32) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(getthrid_trampoline)), unsafe.Pointer(&tid)) + return +} +func getthrid_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func raiseproc(sig uint32) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(raiseproc_trampoline)), unsafe.Pointer(&sig)) +} +func raiseproc_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func thrkill(tid int32, sig int) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(thrkill_trampoline)), unsafe.Pointer(&tid)) +} +func thrkill_trampoline() + +// mmap is used to do low-level memory allocation via mmap. Don't allow stack +// splits, since this function (used by sysAlloc) is called in a lot of low-level +// parts of the runtime and callers often assume it won't acquire any locks. +// +//go:nosplit +func mmap(addr unsafe.Pointer, n uintptr, prot, flags, fd int32, off uint32) (unsafe.Pointer, int) { + args := struct { + addr unsafe.Pointer + n uintptr + prot, flags, fd int32 + off uint32 + ret1 unsafe.Pointer + ret2 int + }{addr, n, prot, flags, fd, off, nil, 0} + libcCall(unsafe.Pointer(abi.FuncPCABI0(mmap_trampoline)), unsafe.Pointer(&args)) + KeepAlive(addr) // Just for consistency. Hopefully addr is not a Go address. + return args.ret1, args.ret2 +} +func mmap_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func munmap(addr unsafe.Pointer, n uintptr) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(munmap_trampoline)), unsafe.Pointer(&addr)) + KeepAlive(addr) // Just for consistency. Hopefully addr is not a Go address. +} +func munmap_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func madvise(addr unsafe.Pointer, n uintptr, flags int32) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(madvise_trampoline)), unsafe.Pointer(&addr)) + KeepAlive(addr) // Just for consistency. Hopefully addr is not a Go address. +} +func madvise_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func open(name *byte, mode, perm int32) (ret int32) { + ret = libcCall(unsafe.Pointer(abi.FuncPCABI0(open_trampoline)), unsafe.Pointer(&name)) + KeepAlive(name) + return +} +func open_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func closefd(fd int32) int32 { + return libcCall(unsafe.Pointer(abi.FuncPCABI0(close_trampoline)), unsafe.Pointer(&fd)) +} +func close_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func read(fd int32, p unsafe.Pointer, n int32) int32 { + ret := libcCall(unsafe.Pointer(abi.FuncPCABI0(read_trampoline)), unsafe.Pointer(&fd)) + KeepAlive(p) + return ret +} +func read_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func write1(fd uintptr, p unsafe.Pointer, n int32) int32 { + ret := libcCall(unsafe.Pointer(abi.FuncPCABI0(write_trampoline)), unsafe.Pointer(&fd)) + KeepAlive(p) + return ret +} +func write_trampoline() + +func pipe2(flags int32) (r, w int32, errno int32) { + var p [2]int32 + args := struct { + p unsafe.Pointer + flags int32 + }{noescape(unsafe.Pointer(&p)), flags} + errno = libcCall(unsafe.Pointer(abi.FuncPCABI0(pipe2_trampoline)), unsafe.Pointer(&args)) + return p[0], p[1], errno +} +func pipe2_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func setitimer(mode int32, new, old *itimerval) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(setitimer_trampoline)), unsafe.Pointer(&mode)) + KeepAlive(new) + KeepAlive(old) +} +func setitimer_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func usleep(usec uint32) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(usleep_trampoline)), unsafe.Pointer(&usec)) +} +func usleep_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func usleep_no_g(usec uint32) { + asmcgocall_no_g(unsafe.Pointer(abi.FuncPCABI0(usleep_trampoline)), unsafe.Pointer(&usec)) +} + +//go:nosplit +//go:cgo_unsafe_args +func sysctl(mib *uint32, miblen uint32, out *byte, size *uintptr, dst *byte, ndst uintptr) int32 { + ret := libcCall(unsafe.Pointer(abi.FuncPCABI0(sysctl_trampoline)), unsafe.Pointer(&mib)) + KeepAlive(mib) + KeepAlive(out) + KeepAlive(size) + KeepAlive(dst) + return ret +} +func sysctl_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func fcntl(fd, cmd, arg int32) (ret int32, errno int32) { + args := struct { + fd, cmd, arg int32 + ret, errno int32 + }{fd, cmd, arg, 0, 0} + libcCall(unsafe.Pointer(abi.FuncPCABI0(fcntl_trampoline)), unsafe.Pointer(&args)) + return args.ret, args.errno +} +func fcntl_trampoline() + +//go:nosplit +func nanotime1() int64 { + var ts timespec + args := struct { + clock_id int32 + tp unsafe.Pointer + }{_CLOCK_MONOTONIC, unsafe.Pointer(&ts)} + if errno := libcCall(unsafe.Pointer(abi.FuncPCABI0(clock_gettime_trampoline)), unsafe.Pointer(&args)); errno < 0 { + // Avoid growing the nosplit stack. + systemstack(func() { + println("runtime: errno", -errno) + throw("clock_gettime failed") + }) + } + return ts.tv_sec*1e9 + int64(ts.tv_nsec) +} +func clock_gettime_trampoline() + +//go:nosplit +func walltime() (int64, int32) { + var ts timespec + args := struct { + clock_id int32 + tp unsafe.Pointer + }{_CLOCK_REALTIME, unsafe.Pointer(&ts)} + if errno := libcCall(unsafe.Pointer(abi.FuncPCABI0(clock_gettime_trampoline)), unsafe.Pointer(&args)); errno < 0 { + // Avoid growing the nosplit stack. + systemstack(func() { + println("runtime: errno", -errno) + throw("clock_gettime failed") + }) + } + return ts.tv_sec, int32(ts.tv_nsec) +} + +//go:nosplit +//go:cgo_unsafe_args +func kqueue() int32 { + return libcCall(unsafe.Pointer(abi.FuncPCABI0(kqueue_trampoline)), nil) +} +func kqueue_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func kevent(kq int32, ch *keventt, nch int32, ev *keventt, nev int32, ts *timespec) int32 { + ret := libcCall(unsafe.Pointer(abi.FuncPCABI0(kevent_trampoline)), unsafe.Pointer(&kq)) + KeepAlive(ch) + KeepAlive(ev) + KeepAlive(ts) + return ret +} +func kevent_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func sigaction(sig uint32, new *sigactiont, old *sigactiont) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(sigaction_trampoline)), unsafe.Pointer(&sig)) + KeepAlive(new) + KeepAlive(old) +} +func sigaction_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func sigprocmask(how uint32, new *sigset, old *sigset) { + // sigprocmask is called from sigsave, which is called from needm. + // As such, we have to be able to run with no g here. + asmcgocall_no_g(unsafe.Pointer(abi.FuncPCABI0(sigprocmask_trampoline)), unsafe.Pointer(&how)) + KeepAlive(new) + KeepAlive(old) +} +func sigprocmask_trampoline() + +//go:nosplit +//go:cgo_unsafe_args +func sigaltstack(new *stackt, old *stackt) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(sigaltstack_trampoline)), unsafe.Pointer(&new)) + KeepAlive(new) + KeepAlive(old) +} +func sigaltstack_trampoline() + +// Not used on OpenBSD, but must be defined. +func exitThread(wait *atomic.Uint32) { + throw("exitThread") +} + +//go:nosplit +//go:cgo_unsafe_args +func issetugid() (ret int32) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(issetugid_trampoline)), unsafe.Pointer(&ret)) + return +} +func issetugid_trampoline() + +// The X versions of syscall expect the libc call to return a 64-bit result. +// Otherwise (the non-X version) expects a 32-bit result. +// This distinction is required because an error is indicated by returning -1, +// and we need to know whether to check 32 or 64 bits of the result. +// (Some libc functions that return 32 bits put junk in the upper 32 bits of AX.) + +// golang.org/x/sys linknames syscall_syscall +// (in addition to standard package syscall). +// Do not remove or change the type signature. +// +//go:linkname syscall_syscall syscall.syscall +//go:nosplit +//go:cgo_unsafe_args +func syscall_syscall(fn, a1, a2, a3 uintptr) (r1, r2, err uintptr) { + entersyscall() + libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall)), unsafe.Pointer(&fn)) + exitsyscall() + return +} +func syscall() + +//go:linkname syscall_syscallX syscall.syscallX +//go:nosplit +//go:cgo_unsafe_args +func syscall_syscallX(fn, a1, a2, a3 uintptr) (r1, r2, err uintptr) { + entersyscall() + libcCall(unsafe.Pointer(abi.FuncPCABI0(syscallX)), unsafe.Pointer(&fn)) + exitsyscall() + return +} +func syscallX() + +// golang.org/x/sys linknames syscall.syscall6 +// (in addition to standard package syscall). +// Do not remove or change the type signature. +// +//go:linkname syscall_syscall6 syscall.syscall6 +//go:nosplit +//go:cgo_unsafe_args +func syscall_syscall6(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2, err uintptr) { + entersyscall() + libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall6)), unsafe.Pointer(&fn)) + exitsyscall() + return +} +func syscall6() + +//go:linkname syscall_syscall6X syscall.syscall6X +//go:nosplit +//go:cgo_unsafe_args +func syscall_syscall6X(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2, err uintptr) { + entersyscall() + libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall6X)), unsafe.Pointer(&fn)) + exitsyscall() + return +} +func syscall6X() + +// golang.org/x/sys linknames syscall.syscall10 +// (in addition to standard package syscall). +// Do not remove or change the type signature. +// +//go:linkname syscall_syscall10 syscall.syscall10 +//go:nosplit +//go:cgo_unsafe_args +func syscall_syscall10(fn, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10 uintptr) (r1, r2, err uintptr) { + entersyscall() + libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall10)), unsafe.Pointer(&fn)) + exitsyscall() + return +} +func syscall10() + +//go:linkname syscall_syscall10X syscall.syscall10X +//go:nosplit +//go:cgo_unsafe_args +func syscall_syscall10X(fn, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10 uintptr) (r1, r2, err uintptr) { + entersyscall() + libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall10X)), unsafe.Pointer(&fn)) + exitsyscall() + return +} +func syscall10X() + +// golang.org/x/sys linknames syscall_rawSyscall +// (in addition to standard package syscall). +// Do not remove or change the type signature. +// +//go:linkname syscall_rawSyscall syscall.rawSyscall +//go:nosplit +//go:cgo_unsafe_args +func syscall_rawSyscall(fn, a1, a2, a3 uintptr) (r1, r2, err uintptr) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall)), unsafe.Pointer(&fn)) + return +} + +// golang.org/x/sys linknames syscall_rawSyscall6 +// (in addition to standard package syscall). +// Do not remove or change the type signature. +// +//go:linkname syscall_rawSyscall6 syscall.rawSyscall6 +//go:nosplit +//go:cgo_unsafe_args +func syscall_rawSyscall6(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2, err uintptr) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall6)), unsafe.Pointer(&fn)) + return +} + +//go:linkname syscall_rawSyscall6X syscall.rawSyscall6X +//go:nosplit +//go:cgo_unsafe_args +func syscall_rawSyscall6X(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2, err uintptr) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall6X)), unsafe.Pointer(&fn)) + return +} + +//go:linkname syscall_rawSyscall10X syscall.rawSyscall10X +//go:nosplit +//go:cgo_unsafe_args +func syscall_rawSyscall10X(fn, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10 uintptr) (r1, r2, err uintptr) { + libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall10X)), unsafe.Pointer(&fn)) + return +} + // Tell the linker that the libc_* functions are to be found // in a system library, with the libc_ prefix missing. @@ -71,5 +476,40 @@ func pthread_create_trampoline() //go:cgo_import_dynamic libc_pthread_create pthread_create "libpthread.so" //go:cgo_import_dynamic libc_pthread_sigmask pthread_sigmask "libpthread.so" +//go:cgo_import_dynamic libc_thrsleep __thrsleep "libc.so" +//go:cgo_import_dynamic libc_thrwakeup __thrwakeup "libc.so" +//go:cgo_import_dynamic libc_sched_yield sched_yield "libc.so" + +//go:cgo_import_dynamic libc_errno __errno "libc.so" +//go:cgo_import_dynamic libc_exit exit "libc.so" +//go:cgo_import_dynamic libc_getthrid getthrid "libc.so" +//go:cgo_import_dynamic libc_sched_yield sched_yield "libc.so" +//go:cgo_import_dynamic libc_thrkill thrkill "libc.so" + +//go:cgo_import_dynamic libc_mmap mmap "libc.so" +//go:cgo_import_dynamic libc_munmap munmap "libc.so" +//go:cgo_import_dynamic libc_madvise madvise "libc.so" + +//go:cgo_import_dynamic libc_open open "libc.so" +//go:cgo_import_dynamic libc_close close "libc.so" +//go:cgo_import_dynamic libc_read read "libc.so" +//go:cgo_import_dynamic libc_write write "libc.so" +//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" + +//go:cgo_import_dynamic libc_clock_gettime clock_gettime "libc.so" +//go:cgo_import_dynamic libc_setitimer setitimer "libc.so" +//go:cgo_import_dynamic libc_usleep usleep "libc.so" +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" +//go:cgo_import_dynamic libc_getpid getpid "libc.so" +//go:cgo_import_dynamic libc_kill kill "libc.so" +//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" +//go:cgo_import_dynamic libc_kevent kevent "libc.so" + +//go:cgo_import_dynamic libc_sigaction sigaction "libc.so" +//go:cgo_import_dynamic libc_sigaltstack sigaltstack "libc.so" + +//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" + //go:cgo_import_dynamic _ _ "libpthread.so" //go:cgo_import_dynamic _ _ "libc.so" diff --git a/src/runtime/sys_openbsd1.go b/src/runtime/sys_openbsd1.go deleted file mode 100644 index d852e3c58a..0000000000 --- a/src/runtime/sys_openbsd1.go +++ /dev/null @@ -1,46 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build openbsd && !mips64 - -package runtime - -import ( - "internal/abi" - "unsafe" -) - -//go:nosplit -//go:cgo_unsafe_args -func thrsleep(ident uintptr, clock_id int32, tsp *timespec, lock uintptr, abort *uint32) int32 { - ret := libcCall(unsafe.Pointer(abi.FuncPCABI0(thrsleep_trampoline)), unsafe.Pointer(&ident)) - KeepAlive(tsp) - KeepAlive(abort) - return ret -} -func thrsleep_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func thrwakeup(ident uintptr, n int32) int32 { - return libcCall(unsafe.Pointer(abi.FuncPCABI0(thrwakeup_trampoline)), unsafe.Pointer(&ident)) -} -func thrwakeup_trampoline() - -//go:nosplit -func osyield() { - libcCall(unsafe.Pointer(abi.FuncPCABI0(sched_yield_trampoline)), unsafe.Pointer(nil)) -} -func sched_yield_trampoline() - -//go:nosplit -func osyield_no_g() { - asmcgocall_no_g(unsafe.Pointer(abi.FuncPCABI0(sched_yield_trampoline)), unsafe.Pointer(nil)) -} - -//go:cgo_import_dynamic libc_thrsleep __thrsleep "libc.so" -//go:cgo_import_dynamic libc_thrwakeup __thrwakeup "libc.so" -//go:cgo_import_dynamic libc_sched_yield sched_yield "libc.so" - -//go:cgo_import_dynamic _ _ "libc.so" diff --git a/src/runtime/sys_openbsd2.go b/src/runtime/sys_openbsd2.go deleted file mode 100644 index 8f5242018d..0000000000 --- a/src/runtime/sys_openbsd2.go +++ /dev/null @@ -1,303 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build openbsd && !mips64 - -package runtime - -import ( - "internal/abi" - "internal/runtime/atomic" - "unsafe" -) - -// This is exported via linkname to assembly in runtime/cgo. -// -//go:linkname exit -//go:nosplit -//go:cgo_unsafe_args -func exit(code int32) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(exit_trampoline)), unsafe.Pointer(&code)) -} -func exit_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func getthrid() (tid int32) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(getthrid_trampoline)), unsafe.Pointer(&tid)) - return -} -func getthrid_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func raiseproc(sig uint32) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(raiseproc_trampoline)), unsafe.Pointer(&sig)) -} -func raiseproc_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func thrkill(tid int32, sig int) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(thrkill_trampoline)), unsafe.Pointer(&tid)) -} -func thrkill_trampoline() - -// mmap is used to do low-level memory allocation via mmap. Don't allow stack -// splits, since this function (used by sysAlloc) is called in a lot of low-level -// parts of the runtime and callers often assume it won't acquire any locks. -// -//go:nosplit -func mmap(addr unsafe.Pointer, n uintptr, prot, flags, fd int32, off uint32) (unsafe.Pointer, int) { - args := struct { - addr unsafe.Pointer - n uintptr - prot, flags, fd int32 - off uint32 - ret1 unsafe.Pointer - ret2 int - }{addr, n, prot, flags, fd, off, nil, 0} - libcCall(unsafe.Pointer(abi.FuncPCABI0(mmap_trampoline)), unsafe.Pointer(&args)) - KeepAlive(addr) // Just for consistency. Hopefully addr is not a Go address. - return args.ret1, args.ret2 -} -func mmap_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func munmap(addr unsafe.Pointer, n uintptr) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(munmap_trampoline)), unsafe.Pointer(&addr)) - KeepAlive(addr) // Just for consistency. Hopefully addr is not a Go address. -} -func munmap_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func madvise(addr unsafe.Pointer, n uintptr, flags int32) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(madvise_trampoline)), unsafe.Pointer(&addr)) - KeepAlive(addr) // Just for consistency. Hopefully addr is not a Go address. -} -func madvise_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func open(name *byte, mode, perm int32) (ret int32) { - ret = libcCall(unsafe.Pointer(abi.FuncPCABI0(open_trampoline)), unsafe.Pointer(&name)) - KeepAlive(name) - return -} -func open_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func closefd(fd int32) int32 { - return libcCall(unsafe.Pointer(abi.FuncPCABI0(close_trampoline)), unsafe.Pointer(&fd)) -} -func close_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func read(fd int32, p unsafe.Pointer, n int32) int32 { - ret := libcCall(unsafe.Pointer(abi.FuncPCABI0(read_trampoline)), unsafe.Pointer(&fd)) - KeepAlive(p) - return ret -} -func read_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func write1(fd uintptr, p unsafe.Pointer, n int32) int32 { - ret := libcCall(unsafe.Pointer(abi.FuncPCABI0(write_trampoline)), unsafe.Pointer(&fd)) - KeepAlive(p) - return ret -} -func write_trampoline() - -func pipe2(flags int32) (r, w int32, errno int32) { - var p [2]int32 - args := struct { - p unsafe.Pointer - flags int32 - }{noescape(unsafe.Pointer(&p)), flags} - errno = libcCall(unsafe.Pointer(abi.FuncPCABI0(pipe2_trampoline)), unsafe.Pointer(&args)) - return p[0], p[1], errno -} -func pipe2_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func setitimer(mode int32, new, old *itimerval) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(setitimer_trampoline)), unsafe.Pointer(&mode)) - KeepAlive(new) - KeepAlive(old) -} -func setitimer_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func usleep(usec uint32) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(usleep_trampoline)), unsafe.Pointer(&usec)) -} -func usleep_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func usleep_no_g(usec uint32) { - asmcgocall_no_g(unsafe.Pointer(abi.FuncPCABI0(usleep_trampoline)), unsafe.Pointer(&usec)) -} - -//go:nosplit -//go:cgo_unsafe_args -func sysctl(mib *uint32, miblen uint32, out *byte, size *uintptr, dst *byte, ndst uintptr) int32 { - ret := libcCall(unsafe.Pointer(abi.FuncPCABI0(sysctl_trampoline)), unsafe.Pointer(&mib)) - KeepAlive(mib) - KeepAlive(out) - KeepAlive(size) - KeepAlive(dst) - return ret -} -func sysctl_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func fcntl(fd, cmd, arg int32) (ret int32, errno int32) { - args := struct { - fd, cmd, arg int32 - ret, errno int32 - }{fd, cmd, arg, 0, 0} - libcCall(unsafe.Pointer(abi.FuncPCABI0(fcntl_trampoline)), unsafe.Pointer(&args)) - return args.ret, args.errno -} -func fcntl_trampoline() - -//go:nosplit -func nanotime1() int64 { - var ts timespec - args := struct { - clock_id int32 - tp unsafe.Pointer - }{_CLOCK_MONOTONIC, unsafe.Pointer(&ts)} - if errno := libcCall(unsafe.Pointer(abi.FuncPCABI0(clock_gettime_trampoline)), unsafe.Pointer(&args)); errno < 0 { - // Avoid growing the nosplit stack. - systemstack(func() { - println("runtime: errno", -errno) - throw("clock_gettime failed") - }) - } - return ts.tv_sec*1e9 + int64(ts.tv_nsec) -} -func clock_gettime_trampoline() - -//go:nosplit -func walltime() (int64, int32) { - var ts timespec - args := struct { - clock_id int32 - tp unsafe.Pointer - }{_CLOCK_REALTIME, unsafe.Pointer(&ts)} - if errno := libcCall(unsafe.Pointer(abi.FuncPCABI0(clock_gettime_trampoline)), unsafe.Pointer(&args)); errno < 0 { - // Avoid growing the nosplit stack. - systemstack(func() { - println("runtime: errno", -errno) - throw("clock_gettime failed") - }) - } - return ts.tv_sec, int32(ts.tv_nsec) -} - -//go:nosplit -//go:cgo_unsafe_args -func kqueue() int32 { - return libcCall(unsafe.Pointer(abi.FuncPCABI0(kqueue_trampoline)), nil) -} -func kqueue_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func kevent(kq int32, ch *keventt, nch int32, ev *keventt, nev int32, ts *timespec) int32 { - ret := libcCall(unsafe.Pointer(abi.FuncPCABI0(kevent_trampoline)), unsafe.Pointer(&kq)) - KeepAlive(ch) - KeepAlive(ev) - KeepAlive(ts) - return ret -} -func kevent_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func sigaction(sig uint32, new *sigactiont, old *sigactiont) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(sigaction_trampoline)), unsafe.Pointer(&sig)) - KeepAlive(new) - KeepAlive(old) -} -func sigaction_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func sigprocmask(how uint32, new *sigset, old *sigset) { - // sigprocmask is called from sigsave, which is called from needm. - // As such, we have to be able to run with no g here. - asmcgocall_no_g(unsafe.Pointer(abi.FuncPCABI0(sigprocmask_trampoline)), unsafe.Pointer(&how)) - KeepAlive(new) - KeepAlive(old) -} -func sigprocmask_trampoline() - -//go:nosplit -//go:cgo_unsafe_args -func sigaltstack(new *stackt, old *stackt) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(sigaltstack_trampoline)), unsafe.Pointer(&new)) - KeepAlive(new) - KeepAlive(old) -} -func sigaltstack_trampoline() - -// Not used on OpenBSD, but must be defined. -func exitThread(wait *atomic.Uint32) { - throw("exitThread") -} - -//go:nosplit -//go:cgo_unsafe_args -func issetugid() (ret int32) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(issetugid_trampoline)), unsafe.Pointer(&ret)) - return -} -func issetugid_trampoline() - -// Tell the linker that the libc_* functions are to be found -// in a system library, with the libc_ prefix missing. - -//go:cgo_import_dynamic libc_errno __errno "libc.so" -//go:cgo_import_dynamic libc_exit exit "libc.so" -//go:cgo_import_dynamic libc_getthrid getthrid "libc.so" -//go:cgo_import_dynamic libc_sched_yield sched_yield "libc.so" -//go:cgo_import_dynamic libc_thrkill thrkill "libc.so" - -//go:cgo_import_dynamic libc_mmap mmap "libc.so" -//go:cgo_import_dynamic libc_munmap munmap "libc.so" -//go:cgo_import_dynamic libc_madvise madvise "libc.so" - -//go:cgo_import_dynamic libc_open open "libc.so" -//go:cgo_import_dynamic libc_close close "libc.so" -//go:cgo_import_dynamic libc_read read "libc.so" -//go:cgo_import_dynamic libc_write write "libc.so" -//go:cgo_import_dynamic libc_pipe2 pipe2 "libc.so" - -//go:cgo_import_dynamic libc_clock_gettime clock_gettime "libc.so" -//go:cgo_import_dynamic libc_setitimer setitimer "libc.so" -//go:cgo_import_dynamic libc_usleep usleep "libc.so" -//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" -//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" -//go:cgo_import_dynamic libc_getpid getpid "libc.so" -//go:cgo_import_dynamic libc_kill kill "libc.so" -//go:cgo_import_dynamic libc_kqueue kqueue "libc.so" -//go:cgo_import_dynamic libc_kevent kevent "libc.so" - -//go:cgo_import_dynamic libc_sigaction sigaction "libc.so" -//go:cgo_import_dynamic libc_sigaltstack sigaltstack "libc.so" - -//go:cgo_import_dynamic libc_issetugid issetugid "libc.so" - -//go:cgo_import_dynamic _ _ "libc.so" diff --git a/src/runtime/sys_openbsd3.go b/src/runtime/sys_openbsd3.go deleted file mode 100644 index de09ec5e25..0000000000 --- a/src/runtime/sys_openbsd3.go +++ /dev/null @@ -1,136 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build openbsd && !mips64 - -package runtime - -import ( - "internal/abi" - "unsafe" -) - -// The X versions of syscall expect the libc call to return a 64-bit result. -// Otherwise (the non-X version) expects a 32-bit result. -// This distinction is required because an error is indicated by returning -1, -// and we need to know whether to check 32 or 64 bits of the result. -// (Some libc functions that return 32 bits put junk in the upper 32 bits of AX.) - -// golang.org/x/sys linknames syscall_syscall -// (in addition to standard package syscall). -// Do not remove or change the type signature. -// -//go:linkname syscall_syscall syscall.syscall -//go:nosplit -//go:cgo_unsafe_args -func syscall_syscall(fn, a1, a2, a3 uintptr) (r1, r2, err uintptr) { - entersyscall() - libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall)), unsafe.Pointer(&fn)) - exitsyscall() - return -} -func syscall() - -//go:linkname syscall_syscallX syscall.syscallX -//go:nosplit -//go:cgo_unsafe_args -func syscall_syscallX(fn, a1, a2, a3 uintptr) (r1, r2, err uintptr) { - entersyscall() - libcCall(unsafe.Pointer(abi.FuncPCABI0(syscallX)), unsafe.Pointer(&fn)) - exitsyscall() - return -} -func syscallX() - -// golang.org/x/sys linknames syscall.syscall6 -// (in addition to standard package syscall). -// Do not remove or change the type signature. -// -//go:linkname syscall_syscall6 syscall.syscall6 -//go:nosplit -//go:cgo_unsafe_args -func syscall_syscall6(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2, err uintptr) { - entersyscall() - libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall6)), unsafe.Pointer(&fn)) - exitsyscall() - return -} -func syscall6() - -//go:linkname syscall_syscall6X syscall.syscall6X -//go:nosplit -//go:cgo_unsafe_args -func syscall_syscall6X(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2, err uintptr) { - entersyscall() - libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall6X)), unsafe.Pointer(&fn)) - exitsyscall() - return -} -func syscall6X() - -// golang.org/x/sys linknames syscall.syscall10 -// (in addition to standard package syscall). -// Do not remove or change the type signature. -// -//go:linkname syscall_syscall10 syscall.syscall10 -//go:nosplit -//go:cgo_unsafe_args -func syscall_syscall10(fn, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10 uintptr) (r1, r2, err uintptr) { - entersyscall() - libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall10)), unsafe.Pointer(&fn)) - exitsyscall() - return -} -func syscall10() - -//go:linkname syscall_syscall10X syscall.syscall10X -//go:nosplit -//go:cgo_unsafe_args -func syscall_syscall10X(fn, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10 uintptr) (r1, r2, err uintptr) { - entersyscall() - libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall10X)), unsafe.Pointer(&fn)) - exitsyscall() - return -} -func syscall10X() - -// golang.org/x/sys linknames syscall_rawSyscall -// (in addition to standard package syscall). -// Do not remove or change the type signature. -// -//go:linkname syscall_rawSyscall syscall.rawSyscall -//go:nosplit -//go:cgo_unsafe_args -func syscall_rawSyscall(fn, a1, a2, a3 uintptr) (r1, r2, err uintptr) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall)), unsafe.Pointer(&fn)) - return -} - -// golang.org/x/sys linknames syscall_rawSyscall6 -// (in addition to standard package syscall). -// Do not remove or change the type signature. -// -//go:linkname syscall_rawSyscall6 syscall.rawSyscall6 -//go:nosplit -//go:cgo_unsafe_args -func syscall_rawSyscall6(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2, err uintptr) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall6)), unsafe.Pointer(&fn)) - return -} - -//go:linkname syscall_rawSyscall6X syscall.rawSyscall6X -//go:nosplit -//go:cgo_unsafe_args -func syscall_rawSyscall6X(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2, err uintptr) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall6X)), unsafe.Pointer(&fn)) - return -} - -//go:linkname syscall_rawSyscall10X syscall.rawSyscall10X -//go:nosplit -//go:cgo_unsafe_args -func syscall_rawSyscall10X(fn, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10 uintptr) (r1, r2, err uintptr) { - libcCall(unsafe.Pointer(abi.FuncPCABI0(syscall10X)), unsafe.Pointer(&fn)) - return -} diff --git a/src/runtime/sys_openbsd_mips64.s b/src/runtime/sys_openbsd_mips64.s deleted file mode 100644 index 7ac0db0480..0000000000 --- a/src/runtime/sys_openbsd_mips64.s +++ /dev/null @@ -1,388 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// -// System calls and other sys.stuff for mips64, OpenBSD -// /usr/src/sys/kern/syscalls.master for syscall numbers. -// - -#include "go_asm.h" -#include "go_tls.h" -#include "textflag.h" - -#define CLOCK_REALTIME $0 -#define CLOCK_MONOTONIC $3 - -// Exit the entire program (like C exit) -TEXT runtime·exit(SB),NOSPLIT|NOFRAME,$0 - MOVW code+0(FP), R4 // arg 1 - status - MOVV $1, R2 // sys_exit - SYSCALL - BEQ R7, 3(PC) - MOVV $0, R2 // crash on syscall failure - MOVV R2, (R2) - RET - -// func exitThread(wait *atomic.Uint32) -TEXT runtime·exitThread(SB),NOSPLIT,$0 - MOVV wait+0(FP), R4 // arg 1 - notdead - MOVV $302, R2 // sys___threxit - SYSCALL - MOVV $0, R2 // crash on syscall failure - MOVV R2, (R2) - JMP 0(PC) - -TEXT runtime·open(SB),NOSPLIT|NOFRAME,$0 - MOVV name+0(FP), R4 // arg 1 - path - MOVW mode+8(FP), R5 // arg 2 - mode - MOVW perm+12(FP), R6 // arg 3 - perm - MOVV $5, R2 // sys_open - SYSCALL - BEQ R7, 2(PC) - MOVW $-1, R2 - MOVW R2, ret+16(FP) - RET - -TEXT runtime·closefd(SB),NOSPLIT|NOFRAME,$0 - MOVW fd+0(FP), R4 // arg 1 - fd - MOVV $6, R2 // sys_close - SYSCALL - BEQ R7, 2(PC) - MOVW $-1, R2 - MOVW R2, ret+8(FP) - RET - -TEXT runtime·read(SB),NOSPLIT|NOFRAME,$0 - MOVW fd+0(FP), R4 // arg 1 - fd - MOVV p+8(FP), R5 // arg 2 - buf - MOVW n+16(FP), R6 // arg 3 - nbyte - MOVV $3, R2 // sys_read - SYSCALL - BEQ R7, 2(PC) - SUBVU R2, R0, R2 // caller expects negative errno - MOVW R2, ret+24(FP) - RET - -// func pipe2(flags int32) (r, w int32, errno int32) -TEXT runtime·pipe2(SB),NOSPLIT|NOFRAME,$0-20 - MOVV $r+8(FP), R4 - MOVW flags+0(FP), R5 - MOVV $101, R2 // sys_pipe2 - SYSCALL - BEQ R7, 2(PC) - SUBVU R2, R0, R2 // caller expects negative errno - MOVW R2, errno+16(FP) - RET - -TEXT runtime·write1(SB),NOSPLIT|NOFRAME,$0 - MOVV fd+0(FP), R4 // arg 1 - fd - MOVV p+8(FP), R5 // arg 2 - buf - MOVW n+16(FP), R6 // arg 3 - nbyte - MOVV $4, R2 // sys_write - SYSCALL - BEQ R7, 2(PC) - SUBVU R2, R0, R2 // caller expects negative errno - MOVW R2, ret+24(FP) - RET - -TEXT runtime·usleep(SB),NOSPLIT,$24-4 - MOVWU usec+0(FP), R3 - MOVV R3, R5 - MOVW $1000000, R4 - DIVVU R4, R3 - MOVV LO, R3 - MOVV R3, 8(R29) // tv_sec - MOVW $1000, R4 - MULVU R3, R4 - MOVV LO, R4 - SUBVU R4, R5 - MOVV R5, 16(R29) // tv_nsec - - ADDV $8, R29, R4 // arg 1 - rqtp - MOVV $0, R5 // arg 2 - rmtp - MOVV $91, R2 // sys_nanosleep - SYSCALL - RET - -TEXT runtime·getthrid(SB),NOSPLIT,$0-4 - MOVV $299, R2 // sys_getthrid - SYSCALL - MOVW R2, ret+0(FP) - RET - -TEXT runtime·thrkill(SB),NOSPLIT,$0-16 - MOVW tid+0(FP), R4 // arg 1 - tid - MOVV sig+8(FP), R5 // arg 2 - signum - MOVW $0, R6 // arg 3 - tcb - MOVV $119, R2 // sys_thrkill - SYSCALL - RET - -TEXT runtime·raiseproc(SB),NOSPLIT,$0 - MOVV $20, R4 // sys_getpid - SYSCALL - MOVV R2, R4 // arg 1 - pid - MOVW sig+0(FP), R5 // arg 2 - signum - MOVV $122, R2 // sys_kill - SYSCALL - RET - -TEXT runtime·mmap(SB),NOSPLIT,$0 - MOVV addr+0(FP), R4 // arg 1 - addr - MOVV n+8(FP), R5 // arg 2 - len - MOVW prot+16(FP), R6 // arg 3 - prot - MOVW flags+20(FP), R7 // arg 4 - flags - MOVW fd+24(FP), R8 // arg 5 - fd - MOVW $0, R9 // arg 6 - pad - MOVW off+28(FP), R10 // arg 7 - offset - MOVV $197, R2 // sys_mmap - SYSCALL - MOVV $0, R4 - BEQ R7, 3(PC) - MOVV R2, R4 // if error, move to R4 - MOVV $0, R2 - MOVV R2, p+32(FP) - MOVV R4, err+40(FP) - RET - -TEXT runtime·munmap(SB),NOSPLIT,$0 - MOVV addr+0(FP), R4 // arg 1 - addr - MOVV n+8(FP), R5 // arg 2 - len - MOVV $73, R2 // sys_munmap - SYSCALL - BEQ R7, 3(PC) - MOVV $0, R2 // crash on syscall failure - MOVV R2, (R2) - RET - -TEXT runtime·madvise(SB),NOSPLIT,$0 - MOVV addr+0(FP), R4 // arg 1 - addr - MOVV n+8(FP), R5 // arg 2 - len - MOVW flags+16(FP), R6 // arg 2 - flags - MOVV $75, R2 // sys_madvise - SYSCALL - BEQ R7, 2(PC) - MOVW $-1, R2 - MOVW R2, ret+24(FP) - RET - -TEXT runtime·setitimer(SB),NOSPLIT,$0 - MOVW mode+0(FP), R4 // arg 1 - mode - MOVV new+8(FP), R5 // arg 2 - new value - MOVV old+16(FP), R6 // arg 3 - old value - MOVV $69, R2 // sys_setitimer - SYSCALL - RET - -// func walltime() (sec int64, nsec int32) -TEXT runtime·walltime(SB), NOSPLIT, $32 - MOVW CLOCK_REALTIME, R4 // arg 1 - clock_id - MOVV $8(R29), R5 // arg 2 - tp - MOVV $87, R2 // sys_clock_gettime - SYSCALL - - MOVV 8(R29), R4 // sec - MOVV 16(R29), R5 // nsec - MOVV R4, sec+0(FP) - MOVW R5, nsec+8(FP) - - RET - -// int64 nanotime1(void) so really -// void nanotime1(int64 *nsec) -TEXT runtime·nanotime1(SB),NOSPLIT,$32 - MOVW CLOCK_MONOTONIC, R4 // arg 1 - clock_id - MOVV $8(R29), R5 // arg 2 - tp - MOVV $87, R2 // sys_clock_gettime - SYSCALL - - MOVV 8(R29), R3 // sec - MOVV 16(R29), R5 // nsec - - MOVV $1000000000, R4 - MULVU R4, R3 - MOVV LO, R3 - ADDVU R5, R3 - MOVV R3, ret+0(FP) - RET - -TEXT runtime·sigaction(SB),NOSPLIT,$0 - MOVW sig+0(FP), R4 // arg 1 - signum - MOVV new+8(FP), R5 // arg 2 - new sigaction - MOVV old+16(FP), R6 // arg 3 - old sigaction - MOVV $46, R2 // sys_sigaction - SYSCALL - BEQ R7, 3(PC) - MOVV $3, R2 // crash on syscall failure - MOVV R2, (R2) - RET - -TEXT runtime·obsdsigprocmask(SB),NOSPLIT,$0 - MOVW how+0(FP), R4 // arg 1 - mode - MOVW new+4(FP), R5 // arg 2 - new - MOVV $48, R2 // sys_sigprocmask - SYSCALL - BEQ R7, 3(PC) - MOVV $3, R2 // crash on syscall failure - MOVV R2, (R2) - MOVW R2, ret+8(FP) - RET - -TEXT runtime·sigfwd(SB),NOSPLIT,$0-32 - MOVW sig+8(FP), R4 - MOVV info+16(FP), R5 - MOVV ctx+24(FP), R6 - MOVV fn+0(FP), R25 // Must use R25, needed for PIC code. - CALL (R25) - RET - -TEXT runtime·sigtramp(SB),NOSPLIT|TOPFRAME,$192 - // initialize REGSB = PC&0xffffffff00000000 - BGEZAL R0, 1(PC) - SRLV $32, R31, RSB - SLLV $32, RSB - - // this might be called in external code context, - // where g is not set. - MOVB runtime·iscgo(SB), R1 - BEQ R1, 2(PC) - JAL runtime·load_g(SB) - - MOVW R4, 8(R29) - MOVV R5, 16(R29) - MOVV R6, 24(R29) - MOVV $runtime·sigtrampgo(SB), R1 - JAL (R1) - RET - -// int32 tfork(void *param, uintptr psize, M *mp, G *gp, void (*fn)(void)); -TEXT runtime·tfork(SB),NOSPLIT,$0 - - // Copy mp, gp and fn off parent stack for use by child. - MOVV mm+16(FP), R16 - MOVV gg+24(FP), R17 - MOVV fn+32(FP), R18 - - MOVV param+0(FP), R4 // arg 1 - param - MOVV psize+8(FP), R5 // arg 2 - psize - MOVV $8, R2 // sys___tfork - SYSCALL - - // Return if syscall failed. - BEQ R7, 4(PC) - SUBVU R2, R0, R2 // caller expects negative errno - MOVW R2, ret+40(FP) - RET - - // In parent, return. - BEQ R2, 3(PC) - MOVW $0, ret+40(FP) - RET - - // Initialise m, g. - MOVV R17, g - MOVV R16, g_m(g) - - // Call fn. - CALL (R18) - - // fn should never return. - MOVV $2, R8 // crash if reached - MOVV R8, (R8) - RET - -TEXT runtime·sigaltstack(SB),NOSPLIT,$0 - MOVV new+0(FP), R4 // arg 1 - new sigaltstack - MOVV old+8(FP), R5 // arg 2 - old sigaltstack - MOVV $288, R2 // sys_sigaltstack - SYSCALL - BEQ R7, 3(PC) - MOVV $0, R8 // crash on syscall failure - MOVV R8, (R8) - RET - -TEXT runtime·osyield(SB),NOSPLIT,$0 - MOVV $298, R2 // sys_sched_yield - SYSCALL - RET - -TEXT runtime·thrsleep(SB),NOSPLIT,$0 - MOVV ident+0(FP), R4 // arg 1 - ident - MOVW clock_id+8(FP), R5 // arg 2 - clock_id - MOVV tsp+16(FP), R6 // arg 3 - tsp - MOVV lock+24(FP), R7 // arg 4 - lock - MOVV abort+32(FP), R8 // arg 5 - abort - MOVV $94, R2 // sys___thrsleep - SYSCALL - MOVW R2, ret+40(FP) - RET - -TEXT runtime·thrwakeup(SB),NOSPLIT,$0 - MOVV ident+0(FP), R4 // arg 1 - ident - MOVW n+8(FP), R5 // arg 2 - n - MOVV $301, R2 // sys___thrwakeup - SYSCALL - MOVW R2, ret+16(FP) - RET - -TEXT runtime·sysctl(SB),NOSPLIT,$0 - MOVV mib+0(FP), R4 // arg 1 - mib - MOVW miblen+8(FP), R5 // arg 2 - miblen - MOVV out+16(FP), R6 // arg 3 - out - MOVV size+24(FP), R7 // arg 4 - size - MOVV dst+32(FP), R8 // arg 5 - dest - MOVV ndst+40(FP), R9 // arg 6 - newlen - MOVV $202, R2 // sys___sysctl - SYSCALL - BEQ R7, 2(PC) - SUBVU R2, R0, R2 // caller expects negative errno - MOVW R2, ret+48(FP) - RET - -// int32 runtime·kqueue(void); -TEXT runtime·kqueue(SB),NOSPLIT,$0 - MOVV $269, R2 // sys_kqueue - SYSCALL - BEQ R7, 2(PC) - SUBVU R2, R0, R2 // caller expects negative errno - MOVW R2, ret+0(FP) - RET - -// int32 runtime·kevent(int kq, Kevent *changelist, int nchanges, Kevent *eventlist, int nevents, Timespec *timeout); -TEXT runtime·kevent(SB),NOSPLIT,$0 - MOVW kq+0(FP), R4 // arg 1 - kq - MOVV ch+8(FP), R5 // arg 2 - changelist - MOVW nch+16(FP), R6 // arg 3 - nchanges - MOVV ev+24(FP), R7 // arg 4 - eventlist - MOVW nev+32(FP), R8 // arg 5 - nevents - MOVV ts+40(FP), R9 // arg 6 - timeout - MOVV $72, R2 // sys_kevent - SYSCALL - BEQ R7, 2(PC) - SUBVU R2, R0, R2 // caller expects negative errno - MOVW R2, ret+48(FP) - RET - -// func fcntl(fd, cmd, arg int32) (int32, int32) -TEXT runtime·fcntl(SB),NOSPLIT,$0 - MOVW fd+0(FP), R4 // fd - MOVW cmd+4(FP), R5 // cmd - MOVW arg+8(FP), R6 // arg - MOVV $92, R2 // sys_fcntl - SYSCALL - MOVV $0, R4 - BEQ R7, noerr - MOVV R2, R4 - MOVW $-1, R2 -noerr: - MOVW R2, ret+16(FP) - MOVW R4, errno+20(FP) - RET - -// func issetugid() int32 -TEXT runtime·issetugid(SB),NOSPLIT,$0 - MOVV $253, R2 // sys_issetugid - SYSCALL - MOVW R2, ret+0(FP) - RET diff --git a/src/runtime/sys_solaris_amd64.s b/src/runtime/sys_solaris_amd64.s index 7a80020ba3..9235cad391 100644 --- a/src/runtime/sys_solaris_amd64.s +++ b/src/runtime/sys_solaris_amd64.s @@ -155,7 +155,7 @@ allgood: // save m->libcall MOVQ g_m(R10), BP - LEAQ m_libcall(BP), R11 + LEAQ (m_mOS+mOS_libcall)(BP), R11 MOVQ libcall_fn(R11), R10 MOVQ R10, 72(SP) MOVQ libcall_args(R11), R10 @@ -197,7 +197,7 @@ allgood: MOVQ g(BX), BP MOVQ g_m(BP), BP // restore libcall - LEAQ m_libcall(BP), R11 + LEAQ (m_mOS+mOS_libcall)(BP), R11 MOVQ 72(SP), R10 MOVQ R10, libcall_fn(R11) MOVQ 80(SP), R10 diff --git a/src/runtime/sys_windows_386.s b/src/runtime/sys_windows_386.s index e71fda78ae..4030e4c38b 100644 --- a/src/runtime/sys_windows_386.s +++ b/src/runtime/sys_windows_386.s @@ -11,49 +11,6 @@ #define TEB_TlsSlots 0xE10 #define TEB_ArbitraryPtr 0x14 -TEXT runtime·asmstdcall_trampoline<ABIInternal>(SB),NOSPLIT,$0 - JMP runtime·asmstdcall(SB) - -// void runtime·asmstdcall(void *c); -TEXT runtime·asmstdcall(SB),NOSPLIT,$0 - MOVL fn+0(FP), BX - MOVL SP, BP // save stack pointer - - // SetLastError(0). - MOVL $0, 0x34(FS) - - MOVL libcall_n(BX), CX - - // Fast version, do not store args on the stack. - CMPL CX, $0 - JE docall - - // Copy args to the stack. - MOVL CX, AX - SALL $2, AX - SUBL AX, SP // room for args - MOVL SP, DI - MOVL libcall_args(BX), SI - CLD - REP; MOVSL - -docall: - // Call stdcall or cdecl function. - // DI SI BP BX are preserved, SP is not - CALL libcall_fn(BX) - MOVL BP, SP - - // Return result. - MOVL fn+0(FP), BX - MOVL AX, libcall_r1(BX) - MOVL DX, libcall_r2(BX) - - // GetLastError(). - MOVL 0x34(FS), AX - MOVL AX, libcall_err(BX) - - RET - // faster get/set last error TEXT runtime·getlasterror(SB),NOSPLIT,$0 MOVL 0x34(FS), AX diff --git a/src/runtime/sys_windows_amd64.s b/src/runtime/sys_windows_amd64.s index 56a2dc0bcf..e438599910 100644 --- a/src/runtime/sys_windows_amd64.s +++ b/src/runtime/sys_windows_amd64.s @@ -12,85 +12,6 @@ #define TEB_TlsSlots 0x1480 #define TEB_ArbitraryPtr 0x28 -TEXT runtime·asmstdcall_trampoline<ABIInternal>(SB),NOSPLIT,$0 - MOVQ AX, CX - JMP runtime·asmstdcall(SB) - -// void runtime·asmstdcall(void *c); -TEXT runtime·asmstdcall(SB),NOSPLIT,$16 - MOVQ SP, AX - ANDQ $~15, SP // alignment as per Windows requirement - MOVQ AX, 8(SP) - MOVQ CX, 0(SP) // asmcgocall will put first argument into CX. - - MOVQ libcall_fn(CX), AX - MOVQ libcall_args(CX), SI - MOVQ libcall_n(CX), CX - - // SetLastError(0). - MOVQ 0x30(GS), DI - MOVL $0, 0x68(DI) - - SUBQ $(const_maxArgs*8), SP // room for args - - // Fast version, do not store args on the stack. - CMPL CX, $0; JE _0args - CMPL CX, $1; JE _1args - CMPL CX, $2; JE _2args - CMPL CX, $3; JE _3args - CMPL CX, $4; JE _4args - - // Check we have enough room for args. - CMPL CX, $const_maxArgs - JLE 2(PC) - INT $3 // not enough room -> crash - - // Copy args to the stack. - MOVQ SP, DI - CLD - REP; MOVSQ - MOVQ SP, SI - - // Load first 4 args into correspondent registers. - // Floating point arguments are passed in the XMM - // registers. Set them here in case any of the arguments - // are floating point values. For details see - // https://learn.microsoft.com/en-us/cpp/build/x64-calling-convention?view=msvc-170 -_4args: - MOVQ 24(SI), R9 - MOVQ R9, X3 -_3args: - MOVQ 16(SI), R8 - MOVQ R8, X2 -_2args: - MOVQ 8(SI), DX - MOVQ DX, X1 -_1args: - MOVQ 0(SI), CX - MOVQ CX, X0 -_0args: - - // Call stdcall function. - CALL AX - - ADDQ $(const_maxArgs*8), SP - - // Return result. - MOVQ 0(SP), CX - MOVQ 8(SP), SP - MOVQ AX, libcall_r1(CX) - // Floating point return values are returned in XMM0. Setting r2 to this - // value in case this call returned a floating point value. For details, - // see https://docs.microsoft.com/en-us/cpp/build/x64-calling-convention - MOVQ X0, libcall_r2(CX) - - // GetLastError(). - MOVQ 0x30(GS), DI - MOVL 0x68(DI), AX - MOVQ AX, libcall_err(CX) - - RET - // faster get/set last error TEXT runtime·getlasterror(SB),NOSPLIT,$0 MOVQ 0x30(GS), AX diff --git a/src/runtime/sys_windows_arm.s b/src/runtime/sys_windows_arm.s index 99f33cf07d..c7f2369e57 100644 --- a/src/runtime/sys_windows_arm.s +++ b/src/runtime/sys_windows_arm.s @@ -9,76 +9,6 @@ // Note: For system ABI, R0-R3 are args, R4-R11 are callee-save. -TEXT runtime·asmstdcall_trampoline<ABIInternal>(SB),NOSPLIT,$0 - B runtime·asmstdcall(SB) - -// void runtime·asmstdcall(void *c); -TEXT runtime·asmstdcall(SB),NOSPLIT|NOFRAME,$0 - MOVM.DB.W [R4, R5, R14], (R13) // push {r4, r5, lr} - MOVW R0, R4 // put libcall * in r4 - MOVW R13, R5 // save stack pointer in r5 - - // SetLastError(0) - MOVW $0, R0 - MRC 15, 0, R1, C13, C0, 2 - MOVW R0, 0x34(R1) - - MOVW 8(R4), R12 // libcall->args - - // Do we have more than 4 arguments? - MOVW 4(R4), R0 // libcall->n - SUB.S $4, R0, R2 - BLE loadregs - - // Reserve stack space for remaining args - SUB R2<<2, R13 - BIC $0x7, R13 // alignment for ABI - - // R0: count of arguments - // R1: - // R2: loop counter, from 0 to (n-4) - // R3: scratch - // R4: pointer to libcall struct - // R12: libcall->args - MOVW $0, R2 -stackargs: - ADD $4, R2, R3 // r3 = args[4 + i] - MOVW R3<<2(R12), R3 - MOVW R3, R2<<2(R13) // stack[i] = r3 - - ADD $1, R2 // i++ - SUB $4, R0, R3 // while (i < (n - 4)) - CMP R3, R2 - BLT stackargs - -loadregs: - CMP $3, R0 - MOVW.GT 12(R12), R3 - - CMP $2, R0 - MOVW.GT 8(R12), R2 - - CMP $1, R0 - MOVW.GT 4(R12), R1 - - CMP $0, R0 - MOVW.GT 0(R12), R0 - - BIC $0x7, R13 // alignment for ABI - MOVW 0(R4), R12 // branch to libcall->fn - BL (R12) - - MOVW R5, R13 // free stack space - MOVW R0, 12(R4) // save return value to libcall->r1 - MOVW R1, 16(R4) - - // GetLastError - MRC 15, 0, R1, C13, C0, 2 - MOVW 0x34(R1), R0 - MOVW R0, 20(R4) // store in libcall->err - - MOVM.IA.W (R13), [R4, R5, R15] - TEXT runtime·getlasterror(SB),NOSPLIT,$0 MRC 15, 0, R0, C13, C0, 2 MOVW 0x34(R0), R0 diff --git a/src/runtime/sys_windows_arm64.s b/src/runtime/sys_windows_arm64.s index 1f6d411b07..da3cb7e546 100644 --- a/src/runtime/sys_windows_arm64.s +++ b/src/runtime/sys_windows_arm64.s @@ -19,88 +19,6 @@ // // load_g and save_g (in tls_arm64.s) clobber R27 (REGTMP) and R0. -TEXT runtime·asmstdcall_trampoline<ABIInternal>(SB),NOSPLIT,$0 - B runtime·asmstdcall(SB) - -// void runtime·asmstdcall(void *c); -TEXT runtime·asmstdcall(SB),NOSPLIT,$16 - STP (R19, R20), 16(RSP) // save old R19, R20 - MOVD R0, R19 // save libcall pointer - MOVD RSP, R20 // save stack pointer - - // SetLastError(0) - MOVD $0, TEB_error(R18_PLATFORM) - MOVD libcall_args(R19), R12 // libcall->args - - // Do we have more than 8 arguments? - MOVD libcall_n(R19), R0 - CMP $0, R0; BEQ _0args - CMP $1, R0; BEQ _1args - CMP $2, R0; BEQ _2args - CMP $3, R0; BEQ _3args - CMP $4, R0; BEQ _4args - CMP $5, R0; BEQ _5args - CMP $6, R0; BEQ _6args - CMP $7, R0; BEQ _7args - CMP $8, R0; BEQ _8args - - // Reserve stack space for remaining args - SUB $8, R0, R2 - ADD $1, R2, R3 // make even number of words for stack alignment - AND $~1, R3 - LSL $3, R3 - SUB R3, RSP - - // R4: size of stack arguments (n-8)*8 - // R5: &args[8] - // R6: loop counter, from 0 to (n-8)*8 - // R7: scratch - // R8: copy of RSP - (R2)(RSP) assembles as (R2)(ZR) - SUB $8, R0, R4 - LSL $3, R4 - ADD $(8*8), R12, R5 - MOVD $0, R6 - MOVD RSP, R8 -stackargs: - MOVD (R6)(R5), R7 - MOVD R7, (R6)(R8) - ADD $8, R6 - CMP R6, R4 - BNE stackargs - -_8args: - MOVD (7*8)(R12), R7 -_7args: - MOVD (6*8)(R12), R6 -_6args: - MOVD (5*8)(R12), R5 -_5args: - MOVD (4*8)(R12), R4 -_4args: - MOVD (3*8)(R12), R3 -_3args: - MOVD (2*8)(R12), R2 -_2args: - MOVD (1*8)(R12), R1 -_1args: - MOVD (0*8)(R12), R0 -_0args: - - MOVD libcall_fn(R19), R12 // branch to libcall->fn - BL (R12) - - MOVD R20, RSP // free stack space - MOVD R0, libcall_r1(R19) // save return value to libcall->r1 - // TODO(rsc) floating point like amd64 in libcall->r2? - - // GetLastError - MOVD TEB_error(R18_PLATFORM), R0 - MOVD R0, libcall_err(R19) - - // Restore callee-saved registers. - LDP 16(RSP), (R19, R20) - RET - TEXT runtime·getlasterror(SB),NOSPLIT,$0 MOVD TEB_error(R18_PLATFORM), R0 MOVD R0, ret+0(FP) diff --git a/src/runtime/syscall_windows.go b/src/runtime/syscall_windows.go index 85b1b8c902..b3c3d8c0d5 100644 --- a/src/runtime/syscall_windows.go +++ b/src/runtime/syscall_windows.go @@ -7,6 +7,7 @@ package runtime import ( "internal/abi" "internal/goarch" + "internal/runtime/syscall/windows" "unsafe" ) @@ -103,7 +104,7 @@ func (p *abiDesc) assignArg(t *_type) { // registers and the stack. panic("compileCallback: argument size is larger than uintptr") } - if k := t.Kind_ & abi.KindMask; GOARCH != "386" && (k == abi.Float32 || k == abi.Float64) { + if k := t.Kind(); GOARCH != "386" && (k == abi.Float32 || k == abi.Float64) { // In fastcall, floating-point arguments in // the first four positions are passed in // floating-point registers, which we don't @@ -174,7 +175,7 @@ func (p *abiDesc) assignArg(t *_type) { // // Returns whether the assignment succeeded. func (p *abiDesc) tryRegAssignArg(t *_type, offset uintptr) bool { - switch k := t.Kind_ & abi.KindMask; k { + switch k := t.Kind(); k { case abi.Bool, abi.Int, abi.Int8, abi.Int16, abi.Int32, abi.Uint, abi.Uint8, abi.Uint16, abi.Uint32, abi.Uintptr, abi.Pointer, abi.UnsafePointer: // Assign a register for all these types. return p.assignReg(t.Size_, offset) @@ -269,7 +270,7 @@ func compileCallback(fn eface, cdecl bool) (code uintptr) { cdecl = false } - if fn._type == nil || (fn._type.Kind_&abi.KindMask) != abi.Func { + if fn._type == nil || fn._type.Kind() != abi.Func { panic("compileCallback: expected function with one uintptr-sized result") } ft := (*functype)(unsafe.Pointer(fn._type)) @@ -290,7 +291,7 @@ func compileCallback(fn eface, cdecl bool) (code uintptr) { if ft.OutSlice()[0].Size_ != goarch.PtrSize { panic("compileCallback: expected function with one uintptr-sized result") } - if k := ft.OutSlice()[0].Kind_ & abi.KindMask; k == abi.Float32 || k == abi.Float64 { + if k := ft.OutSlice()[0].Kind(); k == abi.Float32 || k == abi.Float64 { // In cdecl and stdcall, float results are returned in // ST(0). In fastcall, they're returned in XMM0. // Either way, it's not AX. @@ -411,101 +412,19 @@ func callbackWrap(a *callbackArgs) { } } -const _LOAD_LIBRARY_SEARCH_SYSTEM32 = 0x00000800 - -//go:linkname syscall_loadsystemlibrary syscall.loadsystemlibrary -func syscall_loadsystemlibrary(filename *uint16) (handle, err uintptr) { - handle, _, err = syscall_SyscallN(uintptr(unsafe.Pointer(_LoadLibraryExW)), uintptr(unsafe.Pointer(filename)), 0, _LOAD_LIBRARY_SEARCH_SYSTEM32) - KeepAlive(filename) - if handle != 0 { - err = 0 - } - return -} - -// golang.org/x/sys linknames syscall.loadlibrary -// (in addition to standard package syscall). -// Do not remove or change the type signature. -// -//go:linkname syscall_loadlibrary syscall.loadlibrary -func syscall_loadlibrary(filename *uint16) (handle, err uintptr) { - handle, _, err = syscall_SyscallN(uintptr(unsafe.Pointer(_LoadLibraryW)), uintptr(unsafe.Pointer(filename))) - KeepAlive(filename) - if handle != 0 { - err = 0 - } - return -} - -// golang.org/x/sys linknames syscall.getprocaddress -// (in addition to standard package syscall). -// Do not remove or change the type signature. -// -//go:linkname syscall_getprocaddress syscall.getprocaddress -func syscall_getprocaddress(handle uintptr, procname *byte) (outhandle, err uintptr) { - outhandle, _, err = syscall_SyscallN(uintptr(unsafe.Pointer(_GetProcAddress)), handle, uintptr(unsafe.Pointer(procname))) - KeepAlive(procname) - if outhandle != 0 { - err = 0 - } - return -} - -//go:linkname syscall_Syscall syscall.Syscall -//go:nosplit -func syscall_Syscall(fn, nargs, a1, a2, a3 uintptr) (r1, r2, err uintptr) { - return syscall_syscalln(fn, nargs, a1, a2, a3) -} - -//go:linkname syscall_Syscall6 syscall.Syscall6 -//go:nosplit -func syscall_Syscall6(fn, nargs, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2, err uintptr) { - return syscall_syscalln(fn, nargs, a1, a2, a3, a4, a5, a6) -} - -//go:linkname syscall_Syscall9 syscall.Syscall9 -//go:nosplit -func syscall_Syscall9(fn, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2, err uintptr) { - return syscall_syscalln(fn, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9) -} - -//go:linkname syscall_Syscall12 syscall.Syscall12 -//go:nosplit -func syscall_Syscall12(fn, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12 uintptr) (r1, r2, err uintptr) { - return syscall_syscalln(fn, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12) -} - -//go:linkname syscall_Syscall15 syscall.Syscall15 -//go:nosplit -func syscall_Syscall15(fn, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12, a13, a14, a15 uintptr) (r1, r2, err uintptr) { - return syscall_syscalln(fn, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12, a13, a14, a15) -} - -//go:linkname syscall_Syscall18 syscall.Syscall18 -//go:nosplit -func syscall_Syscall18(fn, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12, a13, a14, a15, a16, a17, a18 uintptr) (r1, r2, err uintptr) { - return syscall_syscalln(fn, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12, a13, a14, a15, a16, a17, a18) -} - -// maxArgs should be divisible by 2, as Windows stack -// must be kept 16-byte aligned on syscall entry. +// syscall_syscalln calls fn with args[:n]. +// It is used to implement [syscall.SyscallN]. +// It shouldn't be used in the runtime package, +// use [stdcall] instead. // -// Although it only permits maximum 42 parameters, it -// is arguably large enough. -const maxArgs = 42 - -//go:linkname syscall_SyscallN syscall.SyscallN -//go:nosplit -func syscall_SyscallN(fn uintptr, args ...uintptr) (r1, r2, err uintptr) { - return syscall_syscalln(fn, uintptr(len(args)), args...) -} - +//go:linkname syscall_syscalln syscall.syscalln //go:nosplit +//go:uintptrkeepalive func syscall_syscalln(fn, n uintptr, args ...uintptr) (r1, r2, err uintptr) { if n > uintptr(len(args)) { panic("syscall: n > len(args)") // should not be reachable from user code } - if n > maxArgs { + if n > windows.MaxArgs { panic("runtime: SyscallN has too many arguments") } @@ -513,15 +432,15 @@ func syscall_syscalln(fn, n uintptr, args ...uintptr) (r1, r2, err uintptr) { // the stack because the stack can move during fn if it // calls back into Go. c := &getg().m.winsyscall - c.fn = fn - c.n = n - if c.n != 0 { - c.args = uintptr(noescape(unsafe.Pointer(&args[0]))) + c.Fn = fn + c.N = n + if c.N != 0 { + c.Args = uintptr(noescape(unsafe.Pointer(&args[0]))) } cgocall(asmstdcallAddr, unsafe.Pointer(c)) // cgocall may reschedule us on to a different M, // but it copies the return values into the new M's // so we can read them from there. c = &getg().m.winsyscall - return c.r1, c.r2, c.err + return c.R1, c.R2, c.Err } diff --git a/src/runtime/syscall_windows_test.go b/src/runtime/syscall_windows_test.go index ad9bfb464b..6a9b165d62 100644 --- a/src/runtime/syscall_windows_test.go +++ b/src/runtime/syscall_windows_test.go @@ -8,6 +8,7 @@ import ( "fmt" "internal/abi" "internal/race" + "internal/runtime/syscall/windows" "internal/syscall/windows/sysdll" "internal/testenv" "io" @@ -776,7 +777,7 @@ func TestSyscallN(t *testing.T) { t.Skipf("skipping test: GOARCH=%s", runtime.GOARCH) } - for arglen := 0; arglen <= runtime.MaxArgs; arglen++ { + for arglen := 0; arglen <= windows.MaxArgs; arglen++ { arglen := arglen t.Run(fmt.Sprintf("arg-%d", arglen), func(t *testing.T) { t.Parallel() diff --git a/src/runtime/testdata/testprog/coro.go b/src/runtime/testdata/testprog/coro.go index 032215b801..5f3d302987 100644 --- a/src/runtime/testdata/testprog/coro.go +++ b/src/runtime/testdata/testprog/coro.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.rangefunc - package main import ( diff --git a/src/runtime/testdata/testprog/gc.go b/src/runtime/testdata/testprog/gc.go index 5dc85fbb62..bbe1453401 100644 --- a/src/runtime/testdata/testprog/gc.go +++ b/src/runtime/testdata/testprog/gc.go @@ -395,6 +395,9 @@ func gcMemoryLimit(gcPercent int) { // somewhat heavily here) this bound is kept loose. In practice the Go runtime // should do considerably better than this bound. bound := int64(myLimit + 16<<20) + if runtime.GOOS == "darwin" { + bound += 16 << 20 // Be more lax on Darwin, see issue 73136. + } start := time.Now() for time.Since(start) < 200*time.Millisecond { metrics.Read(m[:]) diff --git a/src/runtime/testdata/testprogcgo/coro.go b/src/runtime/testdata/testprogcgo/coro.go index e0cb945112..93be92cb7a 100644 --- a/src/runtime/testdata/testprogcgo/coro.go +++ b/src/runtime/testdata/testprogcgo/coro.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build goexperiment.rangefunc && !windows +//go:build !windows package main diff --git a/src/runtime/traceallocfree.go b/src/runtime/traceallocfree.go index 70e48ea3a6..b1b6c63462 100644 --- a/src/runtime/traceallocfree.go +++ b/src/runtime/traceallocfree.go @@ -37,7 +37,7 @@ func traceSnapshotMemory(gen uintptr) { } // Emit info. - w.varint(uint64(trace.minPageHeapAddr)) + w.varint(trace.minPageHeapAddr) w.varint(uint64(pageSize)) w.varint(uint64(gc.MinHeapAlign)) w.varint(uint64(fixedStack)) diff --git a/src/runtime/tracebuf.go b/src/runtime/tracebuf.go index 08a1d46838..5adaede424 100644 --- a/src/runtime/tracebuf.go +++ b/src/runtime/tracebuf.go @@ -183,7 +183,7 @@ func (w traceWriter) refill() traceWriter { // Tolerate a nil mp. mID := ^uint64(0) if w.mp != nil { - mID = uint64(w.mp.procid) + mID = w.mp.procid } // Write the buffer's header. @@ -194,7 +194,7 @@ func (w traceWriter) refill() traceWriter { w.byte(byte(w.exp)) } w.varint(uint64(w.gen)) - w.varint(uint64(mID)) + w.varint(mID) w.varint(uint64(ts)) w.traceBuf.lenPos = w.varintReserve() return w diff --git a/src/runtime/tracecpu.go b/src/runtime/tracecpu.go index 092c707f83..e64ca32cdf 100644 --- a/src/runtime/tracecpu.go +++ b/src/runtime/tracecpu.go @@ -258,7 +258,7 @@ func traceCPUSample(gp *g, mp *m, pp *p, stk []uintptr) { if gp != nil { hdr[1] = gp.goid } - hdr[2] = uint64(mp.procid) + hdr[2] = mp.procid // Allow only one writer at a time for !trace.signalLock.CompareAndSwap(0, 1) { diff --git a/src/runtime/traceevent.go b/src/runtime/traceevent.go index 263847be2e..b0bc4c017d 100644 --- a/src/runtime/traceevent.go +++ b/src/runtime/traceevent.go @@ -42,7 +42,7 @@ func (tl traceLocker) eventWriter(goStatus tracev2.GoStatus, procStatus tracev2. tl.writer().writeProcStatus(uint64(pp.id), procStatus, pp.trace.inSweep).end() } if gp := tl.mp.curg; gp != nil && !gp.trace.statusWasTraced(tl.gen) && gp.trace.acquireStatus(tl.gen) { - tl.writer().writeGoStatus(uint64(gp.goid), int64(tl.mp.procid), goStatus, gp.inMarkAssist, 0 /* no stack */).end() + tl.writer().writeGoStatus(gp.goid, int64(tl.mp.procid), goStatus, gp.inMarkAssist, 0 /* no stack */).end() } return traceEventWriter{tl} } diff --git a/src/runtime/traceruntime.go b/src/runtime/traceruntime.go index a2775a3427..06e36fd802 100644 --- a/src/runtime/traceruntime.go +++ b/src/runtime/traceruntime.go @@ -457,7 +457,7 @@ func (tl traceLocker) GoPreempt() { // GoStop emits a GoStop event with the provided reason. func (tl traceLocker) GoStop(reason traceGoStopReason) { - tl.eventWriter(tracev2.GoRunning, tracev2.ProcRunning).event(tracev2.EvGoStop, traceArg(trace.goStopReasons[tl.gen%2][reason]), tl.stack(0)) + tl.eventWriter(tracev2.GoRunning, tracev2.ProcRunning).event(tracev2.EvGoStop, trace.goStopReasons[tl.gen%2][reason], tl.stack(0)) } // GoPark emits a GoBlock event with the provided reason. @@ -465,7 +465,7 @@ func (tl traceLocker) GoStop(reason traceGoStopReason) { // TODO(mknyszek): Replace traceBlockReason with waitReason. It's silly // that we have both, and waitReason is way more descriptive. func (tl traceLocker) GoPark(reason traceBlockReason, skip int) { - tl.eventWriter(tracev2.GoRunning, tracev2.ProcRunning).event(tracev2.EvGoBlock, traceArg(trace.goBlockReasons[tl.gen%2][reason]), tl.stack(skip)) + tl.eventWriter(tracev2.GoRunning, tracev2.ProcRunning).event(tracev2.EvGoBlock, trace.goBlockReasons[tl.gen%2][reason], tl.stack(skip)) } // GoUnpark emits a GoUnblock event. diff --git a/src/runtime/tracestack.go b/src/runtime/tracestack.go index 76d6b05048..51f3c29445 100644 --- a/src/runtime/tracestack.go +++ b/src/runtime/tracestack.go @@ -190,7 +190,7 @@ func dumpStacksRec(node *traceMapNode, w traceWriter, stackBuf []uintptr) traceW // Emit stack event. w.byte(byte(tracev2.EvStack)) - w.varint(uint64(node.id)) + w.varint(node.id) w.varint(uint64(len(frames))) for _, frame := range frames { w.varint(uint64(frame.PC)) diff --git a/src/runtime/tracetype.go b/src/runtime/tracetype.go index f54f812578..613fc88202 100644 --- a/src/runtime/tracetype.go +++ b/src/runtime/tracetype.go @@ -64,7 +64,7 @@ func dumpTypesRec(node *traceMapNode, w traceWriter) traceWriter { } // Emit type. - w.varint(uint64(node.id)) + w.varint(node.id) w.varint(uint64(uintptr(unsafe.Pointer(typ)))) w.varint(uint64(typ.Size())) w.varint(uint64(typ.PtrBytes)) diff --git a/src/runtime/type.go b/src/runtime/type.go index c11c866cd8..9009119464 100644 --- a/src/runtime/type.go +++ b/src/runtime/type.go @@ -9,7 +9,6 @@ package runtime import ( "internal/abi" "internal/goarch" - "internal/goexperiment" "internal/runtime/atomic" "unsafe" ) @@ -69,7 +68,7 @@ func (t rtype) pkgpath() string { if u := t.uncommon(); u != nil { return t.nameOff(u.PkgPath).Name() } - switch t.Kind_ & abi.KindMask { + switch t.Kind() { case abi.Struct: st := (*structtype)(unsafe.Pointer(t.Type)) return st.PkgPath.Name() @@ -522,8 +521,8 @@ func typesEqual(t, v *_type, seen map[_typePair]struct{}) bool { if t == v { return true } - kind := t.Kind_ & abi.KindMask - if kind != v.Kind_&abi.KindMask { + kind := t.Kind() + if kind != v.Kind() { return false } rt, rv := toRType(t), toRType(v) @@ -605,13 +604,8 @@ func typesEqual(t, v *_type, seen map[_typePair]struct{}) bool { } return true case abi.Map: - if goexperiment.SwissMap { - mt := (*abi.SwissMapType)(unsafe.Pointer(t)) - mv := (*abi.SwissMapType)(unsafe.Pointer(v)) - return typesEqual(mt.Key, mv.Key, seen) && typesEqual(mt.Elem, mv.Elem, seen) - } - mt := (*abi.OldMapType)(unsafe.Pointer(t)) - mv := (*abi.OldMapType)(unsafe.Pointer(v)) + mt := (*abi.MapType)(unsafe.Pointer(t)) + mv := (*abi.MapType)(unsafe.Pointer(v)) return typesEqual(mt.Key, mv.Key, seen) && typesEqual(mt.Elem, mv.Elem, seen) case abi.Pointer: pt := (*ptrtype)(unsafe.Pointer(t)) diff --git a/src/runtime/typekind.go b/src/runtime/typekind.go deleted file mode 100644 index 4920a7cf14..0000000000 --- a/src/runtime/typekind.go +++ /dev/null @@ -1,12 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package runtime - -import "internal/abi" - -// isDirectIface reports whether t is stored directly in an interface value. -func isDirectIface(t *_type) bool { - return t.Kind_&abi.KindDirectIface != 0 -} diff --git a/src/runtime/vdso_test.go b/src/runtime/vdso_test.go index b0f5fbe728..cb70a040d6 100644 --- a/src/runtime/vdso_test.go +++ b/src/runtime/vdso_test.go @@ -62,7 +62,7 @@ func TestUsingVDSO(t *testing.T) { t.Logf("%s", out) } if err != nil { - if err := err.(*exec.ExitError); err != nil && err.Sys().(syscall.WaitStatus).Signaled() { + if err, ok := err.(*exec.ExitError); ok && err.Sys().(syscall.WaitStatus).Signaled() { if !bytes.Contains(out, []byte("+++ killed by")) { // strace itself occasionally crashes. // Here, it exited with a signal, but diff --git a/src/sync/hashtriemap.go b/src/sync/hashtriemap.go deleted file mode 100644 index ce30f590bb..0000000000 --- a/src/sync/hashtriemap.go +++ /dev/null @@ -1,117 +0,0 @@ -// Copyright 2024 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build goexperiment.synchashtriemap - -package sync - -import ( - isync "internal/sync" -) - -// Map is like a Go map[any]any but is safe for concurrent use -// by multiple goroutines without additional locking or coordination. -// Loads, stores, and deletes run in amortized constant time. -// -// The Map type is specialized. Most code should use a plain Go map instead, -// with separate locking or coordination, for better type safety and to make it -// easier to maintain other invariants along with the map content. -// -// The Map type is optimized for two common use cases: (1) when the entry for a given -// key is only ever written once but read many times, as in caches that only grow, -// or (2) when multiple goroutines read, write, and overwrite entries for disjoint -// sets of keys. In these two cases, use of a Map may significantly reduce lock -// contention compared to a Go map paired with a separate [Mutex] or [RWMutex]. -// -// The zero Map is empty and ready for use. A Map must not be copied after first use. -// -// In the terminology of [the Go memory model], Map arranges that a write operation -// “synchronizes before” any read operation that observes the effect of the write, where -// read and write operations are defined as follows. -// [Map.Load], [Map.LoadAndDelete], [Map.LoadOrStore], [Map.Swap], [Map.CompareAndSwap], -// and [Map.CompareAndDelete] are read operations; -// [Map.Delete], [Map.LoadAndDelete], [Map.Store], and [Map.Swap] are write operations; -// [Map.LoadOrStore] is a write operation when it returns loaded set to false; -// [Map.CompareAndSwap] is a write operation when it returns swapped set to true; -// and [Map.CompareAndDelete] is a write operation when it returns deleted set to true. -// -// [the Go memory model]: https://go.dev/ref/mem -type Map struct { - _ noCopy - - m isync.HashTrieMap[any, any] -} - -// Load returns the value stored in the map for a key, or nil if no -// value is present. -// The ok result indicates whether value was found in the map. -func (m *Map) Load(key any) (value any, ok bool) { - return m.m.Load(key) -} - -// Store sets the value for a key. -func (m *Map) Store(key, value any) { - m.m.Store(key, value) -} - -// Clear deletes all the entries, resulting in an empty Map. -func (m *Map) Clear() { - m.m.Clear() -} - -// LoadOrStore returns the existing value for the key if present. -// Otherwise, it stores and returns the given value. -// The loaded result is true if the value was loaded, false if stored. -func (m *Map) LoadOrStore(key, value any) (actual any, loaded bool) { - return m.m.LoadOrStore(key, value) -} - -// LoadAndDelete deletes the value for a key, returning the previous value if any. -// The loaded result reports whether the key was present. -func (m *Map) LoadAndDelete(key any) (value any, loaded bool) { - return m.m.LoadAndDelete(key) -} - -// Delete deletes the value for a key. -// If the key is not in the map, Delete does nothing. -func (m *Map) Delete(key any) { - m.m.Delete(key) -} - -// Swap swaps the value for a key and returns the previous value if any. -// The loaded result reports whether the key was present. -func (m *Map) Swap(key, value any) (previous any, loaded bool) { - return m.m.Swap(key, value) -} - -// CompareAndSwap swaps the old and new values for key -// if the value stored in the map is equal to old. -// The old value must be of a comparable type. -func (m *Map) CompareAndSwap(key, old, new any) (swapped bool) { - return m.m.CompareAndSwap(key, old, new) -} - -// CompareAndDelete deletes the entry for key if its value is equal to old. -// The old value must be of a comparable type. -// -// If there is no current value for key in the map, CompareAndDelete -// returns false (even if the old value is the nil interface value). -func (m *Map) CompareAndDelete(key, old any) (deleted bool) { - return m.m.CompareAndDelete(key, old) -} - -// Range calls f sequentially for each key and value present in the map. -// If f returns false, range stops the iteration. -// -// Range does not necessarily correspond to any consistent snapshot of the Map's -// contents: no key will be visited more than once, but if the value for any key -// is stored or deleted concurrently (including by f), Range may reflect any -// mapping for that key from any point during the Range call. Range does not -// block other methods on the receiver; even f itself may call any method on m. -// -// Range may be O(N) with the number of elements in the map even if f returns -// false after a constant number of calls. -func (m *Map) Range(f func(key, value any) bool) { - m.m.Range(f) -} diff --git a/src/sync/map.go b/src/sync/map.go index 25181e0c78..934a651117 100644 --- a/src/sync/map.go +++ b/src/sync/map.go @@ -1,13 +1,11 @@ -// Copyright 2016 The Go Authors. All rights reserved. +// Copyright 2024 The Go Authors. All rights reserved. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build !goexperiment.synchashtriemap - package sync import ( - "sync/atomic" + isync "internal/sync" ) // Map is like a Go map[any]any but is safe for concurrent use @@ -40,390 +38,56 @@ import ( type Map struct { _ noCopy - mu Mutex - - // read contains the portion of the map's contents that are safe for - // concurrent access (with or without mu held). - // - // The read field itself is always safe to load, but must only be stored with - // mu held. - // - // Entries stored in read may be updated concurrently without mu, but updating - // a previously-expunged entry requires that the entry be copied to the dirty - // map and unexpunged with mu held. - read atomic.Pointer[readOnly] - - // dirty contains the portion of the map's contents that require mu to be - // held. To ensure that the dirty map can be promoted to the read map quickly, - // it also includes all of the non-expunged entries in the read map. - // - // Expunged entries are not stored in the dirty map. An expunged entry in the - // clean map must be unexpunged and added to the dirty map before a new value - // can be stored to it. - // - // If the dirty map is nil, the next write to the map will initialize it by - // making a shallow copy of the clean map, omitting stale entries. - dirty map[any]*entry - - // misses counts the number of loads since the read map was last updated that - // needed to lock mu to determine whether the key was present. - // - // Once enough misses have occurred to cover the cost of copying the dirty - // map, the dirty map will be promoted to the read map (in the unamended - // state) and the next store to the map will make a new dirty copy. - misses int -} - -// readOnly is an immutable struct stored atomically in the Map.read field. -type readOnly struct { - m map[any]*entry - amended bool // true if the dirty map contains some key not in m. -} - -// expunged is an arbitrary pointer that marks entries which have been deleted -// from the dirty map. -var expunged = new(any) - -// An entry is a slot in the map corresponding to a particular key. -type entry struct { - // p points to the interface{} value stored for the entry. - // - // If p == nil, the entry has been deleted, and either m.dirty == nil or - // m.dirty[key] is e. - // - // If p == expunged, the entry has been deleted, m.dirty != nil, and the entry - // is missing from m.dirty. - // - // Otherwise, the entry is valid and recorded in m.read.m[key] and, if m.dirty - // != nil, in m.dirty[key]. - // - // An entry can be deleted by atomic replacement with nil: when m.dirty is - // next created, it will atomically replace nil with expunged and leave - // m.dirty[key] unset. - // - // An entry's associated value can be updated by atomic replacement, provided - // p != expunged. If p == expunged, an entry's associated value can be updated - // only after first setting m.dirty[key] = e so that lookups using the dirty - // map find the entry. - p atomic.Pointer[any] -} - -func newEntry(i any) *entry { - e := &entry{} - e.p.Store(&i) - return e -} - -func (m *Map) loadReadOnly() readOnly { - if p := m.read.Load(); p != nil { - return *p - } - return readOnly{} + m isync.HashTrieMap[any, any] } // Load returns the value stored in the map for a key, or nil if no // value is present. // The ok result indicates whether value was found in the map. func (m *Map) Load(key any) (value any, ok bool) { - read := m.loadReadOnly() - e, ok := read.m[key] - if !ok && read.amended { - m.mu.Lock() - // Avoid reporting a spurious miss if m.dirty got promoted while we were - // blocked on m.mu. (If further loads of the same key will not miss, it's - // not worth copying the dirty map for this key.) - read = m.loadReadOnly() - e, ok = read.m[key] - if !ok && read.amended { - e, ok = m.dirty[key] - // Regardless of whether the entry was present, record a miss: this key - // will take the slow path until the dirty map is promoted to the read - // map. - m.missLocked() - } - m.mu.Unlock() - } - if !ok { - return nil, false - } - return e.load() -} - -func (e *entry) load() (value any, ok bool) { - p := e.p.Load() - if p == nil || p == expunged { - return nil, false - } - return *p, true + return m.m.Load(key) } // Store sets the value for a key. func (m *Map) Store(key, value any) { - _, _ = m.Swap(key, value) + m.m.Store(key, value) } // Clear deletes all the entries, resulting in an empty Map. func (m *Map) Clear() { - read := m.loadReadOnly() - if len(read.m) == 0 && !read.amended { - // Avoid allocating a new readOnly when the map is already clear. - return - } - - m.mu.Lock() - defer m.mu.Unlock() - - read = m.loadReadOnly() - if len(read.m) > 0 || read.amended { - m.read.Store(&readOnly{}) - } - - clear(m.dirty) - // Don't immediately promote the newly-cleared dirty map on the next operation. - m.misses = 0 -} - -// tryCompareAndSwap compare the entry with the given old value and swaps -// it with a new value if the entry is equal to the old value, and the entry -// has not been expunged. -// -// If the entry is expunged, tryCompareAndSwap returns false and leaves -// the entry unchanged. -func (e *entry) tryCompareAndSwap(old, new any) bool { - p := e.p.Load() - if p == nil || p == expunged || *p != old { - return false - } - - // Copy the interface after the first load to make this method more amenable - // to escape analysis: if the comparison fails from the start, we shouldn't - // bother heap-allocating an interface value to store. - nc := new - for { - if e.p.CompareAndSwap(p, &nc) { - return true - } - p = e.p.Load() - if p == nil || p == expunged || *p != old { - return false - } - } -} - -// unexpungeLocked ensures that the entry is not marked as expunged. -// -// If the entry was previously expunged, it must be added to the dirty map -// before m.mu is unlocked. -func (e *entry) unexpungeLocked() (wasExpunged bool) { - return e.p.CompareAndSwap(expunged, nil) -} - -// swapLocked unconditionally swaps a value into the entry. -// -// The entry must be known not to be expunged. -func (e *entry) swapLocked(i *any) *any { - return e.p.Swap(i) + m.m.Clear() } // LoadOrStore returns the existing value for the key if present. // Otherwise, it stores and returns the given value. // The loaded result is true if the value was loaded, false if stored. func (m *Map) LoadOrStore(key, value any) (actual any, loaded bool) { - // Avoid locking if it's a clean hit. - read := m.loadReadOnly() - if e, ok := read.m[key]; ok { - actual, loaded, ok := e.tryLoadOrStore(value) - if ok { - return actual, loaded - } - } - - m.mu.Lock() - read = m.loadReadOnly() - if e, ok := read.m[key]; ok { - if e.unexpungeLocked() { - m.dirty[key] = e - } - actual, loaded, _ = e.tryLoadOrStore(value) - } else if e, ok := m.dirty[key]; ok { - actual, loaded, _ = e.tryLoadOrStore(value) - m.missLocked() - } else { - if !read.amended { - // We're adding the first new key to the dirty map. - // Make sure it is allocated and mark the read-only map as incomplete. - m.dirtyLocked() - m.read.Store(&readOnly{m: read.m, amended: true}) - } - m.dirty[key] = newEntry(value) - actual, loaded = value, false - } - m.mu.Unlock() - - return actual, loaded -} - -// tryLoadOrStore atomically loads or stores a value if the entry is not -// expunged. -// -// If the entry is expunged, tryLoadOrStore leaves the entry unchanged and -// returns with ok==false. -func (e *entry) tryLoadOrStore(i any) (actual any, loaded, ok bool) { - p := e.p.Load() - if p == expunged { - return nil, false, false - } - if p != nil { - return *p, true, true - } - - // Copy the interface after the first load to make this method more amenable - // to escape analysis: if we hit the "load" path or the entry is expunged, we - // shouldn't bother heap-allocating. - ic := i - for { - if e.p.CompareAndSwap(nil, &ic) { - return i, false, true - } - p = e.p.Load() - if p == expunged { - return nil, false, false - } - if p != nil { - return *p, true, true - } - } + return m.m.LoadOrStore(key, value) } // LoadAndDelete deletes the value for a key, returning the previous value if any. // The loaded result reports whether the key was present. func (m *Map) LoadAndDelete(key any) (value any, loaded bool) { - read := m.loadReadOnly() - e, ok := read.m[key] - if !ok && read.amended { - m.mu.Lock() - read = m.loadReadOnly() - e, ok = read.m[key] - if !ok && read.amended { - e, ok = m.dirty[key] - delete(m.dirty, key) - // Regardless of whether the entry was present, record a miss: this key - // will take the slow path until the dirty map is promoted to the read - // map. - m.missLocked() - } - m.mu.Unlock() - } - if ok { - return e.delete() - } - return nil, false + return m.m.LoadAndDelete(key) } // Delete deletes the value for a key. +// If the key is not in the map, Delete does nothing. func (m *Map) Delete(key any) { - m.LoadAndDelete(key) -} - -func (e *entry) delete() (value any, ok bool) { - for { - p := e.p.Load() - if p == nil || p == expunged { - return nil, false - } - if e.p.CompareAndSwap(p, nil) { - return *p, true - } - } -} - -// trySwap swaps a value if the entry has not been expunged. -// -// If the entry is expunged, trySwap returns false and leaves the entry -// unchanged. -func (e *entry) trySwap(i *any) (*any, bool) { - for { - p := e.p.Load() - if p == expunged { - return nil, false - } - if e.p.CompareAndSwap(p, i) { - return p, true - } - } + m.m.Delete(key) } // Swap swaps the value for a key and returns the previous value if any. // The loaded result reports whether the key was present. func (m *Map) Swap(key, value any) (previous any, loaded bool) { - read := m.loadReadOnly() - if e, ok := read.m[key]; ok { - if v, ok := e.trySwap(&value); ok { - if v == nil { - return nil, false - } - return *v, true - } - } - - m.mu.Lock() - read = m.loadReadOnly() - if e, ok := read.m[key]; ok { - if e.unexpungeLocked() { - // The entry was previously expunged, which implies that there is a - // non-nil dirty map and this entry is not in it. - m.dirty[key] = e - } - if v := e.swapLocked(&value); v != nil { - loaded = true - previous = *v - } - } else if e, ok := m.dirty[key]; ok { - if v := e.swapLocked(&value); v != nil { - loaded = true - previous = *v - } - } else { - if !read.amended { - // We're adding the first new key to the dirty map. - // Make sure it is allocated and mark the read-only map as incomplete. - m.dirtyLocked() - m.read.Store(&readOnly{m: read.m, amended: true}) - } - m.dirty[key] = newEntry(value) - } - m.mu.Unlock() - return previous, loaded + return m.m.Swap(key, value) } // CompareAndSwap swaps the old and new values for key // if the value stored in the map is equal to old. // The old value must be of a comparable type. func (m *Map) CompareAndSwap(key, old, new any) (swapped bool) { - read := m.loadReadOnly() - if e, ok := read.m[key]; ok { - return e.tryCompareAndSwap(old, new) - } else if !read.amended { - return false // No existing value for key. - } - - m.mu.Lock() - defer m.mu.Unlock() - read = m.loadReadOnly() - swapped = false - if e, ok := read.m[key]; ok { - swapped = e.tryCompareAndSwap(old, new) - } else if e, ok := m.dirty[key]; ok { - swapped = e.tryCompareAndSwap(old, new) - // We needed to lock mu in order to load the entry for key, - // and the operation didn't change the set of keys in the map - // (so it would be made more efficient by promoting the dirty - // map to read-only). - // Count it as a miss so that we will eventually switch to the - // more efficient steady state. - m.missLocked() - } - return swapped + return m.m.CompareAndSwap(key, old, new) } // CompareAndDelete deletes the entry for key if its value is equal to old. @@ -432,35 +96,7 @@ func (m *Map) CompareAndSwap(key, old, new any) (swapped bool) { // If there is no current value for key in the map, CompareAndDelete // returns false (even if the old value is the nil interface value). func (m *Map) CompareAndDelete(key, old any) (deleted bool) { - read := m.loadReadOnly() - e, ok := read.m[key] - if !ok && read.amended { - m.mu.Lock() - read = m.loadReadOnly() - e, ok = read.m[key] - if !ok && read.amended { - e, ok = m.dirty[key] - // Don't delete key from m.dirty: we still need to do the “compare” part - // of the operation. The entry will eventually be expunged when the - // dirty map is promoted to the read map. - // - // Regardless of whether the entry was present, record a miss: this key - // will take the slow path until the dirty map is promoted to the read - // map. - m.missLocked() - } - m.mu.Unlock() - } - for ok { - p := e.p.Load() - if p == nil || p == expunged || *p != old { - return false - } - if e.p.CompareAndSwap(p, nil) { - return true - } - } - return false + return m.m.CompareAndDelete(key, old) } // Range calls f sequentially for each key and value present in the map. @@ -475,70 +111,5 @@ func (m *Map) CompareAndDelete(key, old any) (deleted bool) { // Range may be O(N) with the number of elements in the map even if f returns // false after a constant number of calls. func (m *Map) Range(f func(key, value any) bool) { - // We need to be able to iterate over all of the keys that were already - // present at the start of the call to Range. - // If read.amended is false, then read.m satisfies that property without - // requiring us to hold m.mu for a long time. - read := m.loadReadOnly() - if read.amended { - // m.dirty contains keys not in read.m. Fortunately, Range is already O(N) - // (assuming the caller does not break out early), so a call to Range - // amortizes an entire copy of the map: we can promote the dirty copy - // immediately! - m.mu.Lock() - read = m.loadReadOnly() - if read.amended { - read = readOnly{m: m.dirty} - copyRead := read - m.read.Store(©Read) - m.dirty = nil - m.misses = 0 - } - m.mu.Unlock() - } - - for k, e := range read.m { - v, ok := e.load() - if !ok { - continue - } - if !f(k, v) { - break - } - } -} - -func (m *Map) missLocked() { - m.misses++ - if m.misses < len(m.dirty) { - return - } - m.read.Store(&readOnly{m: m.dirty}) - m.dirty = nil - m.misses = 0 -} - -func (m *Map) dirtyLocked() { - if m.dirty != nil { - return - } - - read := m.loadReadOnly() - m.dirty = make(map[any]*entry, len(read.m)) - for k, e := range read.m { - if !e.tryExpungeLocked() { - m.dirty[k] = e - } - } -} - -func (e *entry) tryExpungeLocked() (isExpunged bool) { - p := e.p.Load() - for p == nil { - if e.p.CompareAndSwap(nil, expunged) { - return true - } - p = e.p.Load() - } - return p == expunged + m.m.Range(f) } diff --git a/src/sync/map_test.go b/src/sync/map_test.go index 05c81354c8..0d6690c746 100644 --- a/src/sync/map_test.go +++ b/src/sync/map_test.go @@ -161,7 +161,7 @@ func TestConcurrentRange(t *testing.T) { m := new(sync.Map) for n := int64(1); n <= mapSize; n++ { - m.Store(n, int64(n)) + m.Store(n, n) } done := make(chan struct{}) diff --git a/src/syscall/dirent.go b/src/syscall/dirent.go index f6e78d9bb5..c12b119335 100644 --- a/src/syscall/dirent.go +++ b/src/syscall/dirent.go @@ -33,7 +33,7 @@ func readIntBE(b []byte, size uintptr) uint64 { case 4: return uint64(byteorder.BEUint32(b)) case 8: - return uint64(byteorder.BEUint64(b)) + return byteorder.BEUint64(b) default: panic("syscall: readInt with unsupported size") } @@ -48,7 +48,7 @@ func readIntLE(b []byte, size uintptr) uint64 { case 4: return uint64(byteorder.LEUint32(b)) case 8: - return uint64(byteorder.LEUint64(b)) + return byteorder.LEUint64(b) default: panic("syscall: readInt with unsupported size") } diff --git a/src/syscall/dll_windows.go b/src/syscall/dll_windows.go index a7873e6ad8..9d77986953 100644 --- a/src/syscall/dll_windows.go +++ b/src/syscall/dll_windows.go @@ -11,6 +11,15 @@ import ( "unsafe" ) +// Use double underscore to avoid name collision autogenerated functions. +//go:cgo_import_dynamic syscall.__LoadLibraryExW LoadLibraryExW%3 "kernel32.dll" +//go:cgo_import_dynamic syscall.__GetProcAddress GetProcAddress%2 "kernel32.dll" + +var ( + __LoadLibraryExW unsafe.Pointer + __GetProcAddress unsafe.Pointer +) + // DLLError describes reasons for DLL load failures. type DLLError struct { Err error @@ -22,31 +31,111 @@ func (e *DLLError) Error() string { return e.Msg } func (e *DLLError) Unwrap() error { return e.Err } -// Implemented in ../runtime/syscall_windows.go. +// N.B. For the Syscall functions below: +// +// //go:uintptrkeepalive because the uintptr argument may be converted pointers +// that need to be kept alive in the caller. +// +// //go:nosplit because stack copying does not account for uintptrkeepalive, so +// the stack must not grow. Stack copying cannot blindly assume that all +// uintptr arguments are pointers, because some values may look like pointers, +// but not really be pointers, and adjusting their value would break the call. // Deprecated: Use [SyscallN] instead. -func Syscall(trap, nargs, a1, a2, a3 uintptr) (r1, r2 uintptr, err Errno) +// +//go:nosplit +//go:uintptrkeepalive +func Syscall(trap, nargs, a1, a2, a3 uintptr) (r1, r2 uintptr, err Errno) { + return syscalln(trap, nargs, a1, a2, a3) +} // Deprecated: Use [SyscallN] instead. -func Syscall6(trap, nargs, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2 uintptr, err Errno) +// +//go:nosplit +//go:uintptrkeepalive +func Syscall6(trap, nargs, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2 uintptr, err Errno) { + return syscalln(trap, nargs, a1, a2, a3, a4, a5, a6) +} // Deprecated: Use [SyscallN] instead. -func Syscall9(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err Errno) +// +//go:nosplit +//go:uintptrkeepalive +func Syscall9(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err Errno) { + return syscalln(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9) +} // Deprecated: Use [SyscallN] instead. -func Syscall12(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12 uintptr) (r1, r2 uintptr, err Errno) +// +//go:nosplit +//go:uintptrkeepalive +func Syscall12(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12 uintptr) (r1, r2 uintptr, err Errno) { + return syscalln(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12) +} // Deprecated: Use [SyscallN] instead. -func Syscall15(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12, a13, a14, a15 uintptr) (r1, r2 uintptr, err Errno) +// +//go:nosplit +//go:uintptrkeepalive +func Syscall15(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12, a13, a14, a15 uintptr) (r1, r2 uintptr, err Errno) { + return syscalln(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12, a13, a14, a15) +} // Deprecated: Use [SyscallN] instead. -func Syscall18(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12, a13, a14, a15, a16, a17, a18 uintptr) (r1, r2 uintptr, err Errno) +// +//go:nosplit +//go:uintptrkeepalive +func Syscall18(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12, a13, a14, a15, a16, a17, a18 uintptr) (r1, r2 uintptr, err Errno) { + return syscalln(trap, nargs, a1, a2, a3, a4, a5, a6, a7, a8, a9, a10, a11, a12, a13, a14, a15, a16, a17, a18) +} +// SyscallN executes procedure p with arguments args. +// +// See [Proc.Call] for more information. +// +//go:nosplit +//go:uintptrkeepalive +func SyscallN(p uintptr, args ...uintptr) (r1, r2 uintptr, err Errno) { + return syscalln(p, uintptr(len(args)), args...) +} + +// syscalln is implemented in runtime/syscall_windows.go. +// //go:noescape -func SyscallN(trap uintptr, args ...uintptr) (r1, r2 uintptr, err Errno) -func loadlibrary(filename *uint16) (handle uintptr, err Errno) -func loadsystemlibrary(filename *uint16) (handle uintptr, err Errno) -func getprocaddress(handle uintptr, procname *uint8) (proc uintptr, err Errno) +func syscalln(fn, n uintptr, args ...uintptr) (r1, r2 uintptr, err Errno) + +// N.B. For the loadlibrary, loadlibrary, and getprocaddress functions below: +// +// //go:linkname to act as an allowlist for linker's -checklinkname, as +// golang.org/x/sys/windows linknames these functions. + +//go:linkname loadlibrary +func loadlibrary(filename *uint16) (uintptr, Errno) { + handle, _, err := SyscallN(uintptr(__LoadLibraryExW), uintptr(unsafe.Pointer(filename)), 0, 0) + if handle != 0 { + err = 0 + } + return handle, err +} + +//go:linkname loadsystemlibrary +func loadsystemlibrary(filename *uint16) (uintptr, Errno) { + const _LOAD_LIBRARY_SEARCH_SYSTEM32 = 0x00000800 + handle, _, err := SyscallN(uintptr(__LoadLibraryExW), uintptr(unsafe.Pointer(filename)), 0, _LOAD_LIBRARY_SEARCH_SYSTEM32) + if handle != 0 { + err = 0 + } + return handle, err +} + +//go:linkname getprocaddress +func getprocaddress(handle uintptr, procname *uint8) (uintptr, Errno) { + proc, _, err := SyscallN(uintptr(__GetProcAddress), handle, uintptr(unsafe.Pointer(procname))) + if proc != 0 { + err = 0 + } + return proc, err +} // A DLL implements access to a single DLL. type DLL struct { diff --git a/src/syscall/syscall_linux.go b/src/syscall/syscall_linux.go index d733ca9bf9..ec9f771daa 100644 --- a/src/syscall/syscall_linux.go +++ b/src/syscall/syscall_linux.go @@ -13,7 +13,7 @@ package syscall import ( "internal/itoa" - runtimesyscall "internal/runtime/syscall" + "internal/runtime/syscall/linux" "runtime" "slices" "unsafe" @@ -62,7 +62,7 @@ func RawSyscall(trap, a1, a2, a3 uintptr) (r1, r2 uintptr, err Errno) { //go:linkname RawSyscall6 func RawSyscall6(trap, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2 uintptr, err Errno) { var errno uintptr - r1, r2, errno = runtimesyscall.Syscall6(trap, a1, a2, a3, a4, a5, a6) + r1, r2, errno = linux.Syscall6(trap, a1, a2, a3, a4, a5, a6) err = Errno(errno) return } diff --git a/src/time/example_test.go b/src/time/example_test.go index eeadcdb1c1..05eac86738 100644 --- a/src/time/example_test.go +++ b/src/time/example_test.go @@ -735,8 +735,8 @@ func ExampleTime_String() { timeWithoutNanoseconds := time.Date(2000, 2, 1, 12, 13, 14, 0, time.UTC) withoutNanoseconds := timeWithoutNanoseconds.String() - fmt.Printf("withNanoseconds = %v\n", string(withNanoseconds)) - fmt.Printf("withoutNanoseconds = %v\n", string(withoutNanoseconds)) + fmt.Printf("withNanoseconds = %v\n", withNanoseconds) + fmt.Printf("withoutNanoseconds = %v\n", withoutNanoseconds) // Output: // withNanoseconds = 2000-02-01 12:13:14.000000015 +0000 UTC diff --git a/src/time/sleep.go b/src/time/sleep.go index e9cd483be5..4b7750eb94 100644 --- a/src/time/sleep.go +++ b/src/time/sleep.go @@ -142,7 +142,7 @@ func (t *Timer) Stop() bool { // in Go 1.27 or later. func NewTimer(d Duration) *Timer { c := make(chan Time, 1) - t := (*Timer)(newTimer(when(d), 0, sendTime, c, syncTimer(c))) + t := newTimer(when(d), 0, sendTime, c, syncTimer(c)) t.C = c return t } @@ -208,7 +208,7 @@ func After(d Duration) <-chan Time { // be used to cancel the call using its Stop method. // The returned Timer's C field is not used and will be nil. func AfterFunc(d Duration, f func()) *Timer { - return (*Timer)(newTimer(when(d), 0, goFunc, f, nil)) + return newTimer(when(d), 0, goFunc, f, nil) } func goFunc(arg any, seq uintptr, delta int64) { diff --git a/src/time/time.go b/src/time/time.go index bcaeee407e..cf9abc7196 100644 --- a/src/time/time.go +++ b/src/time/time.go @@ -667,7 +667,7 @@ func (days absDays) split() (century absCentury, cyear absCyear, ayday absYday) // so do that instead, saving a few cycles. // See Neri and Schneider, section 8.3 // for more about this optimization. - hi, lo := bits.Mul32(2939745, uint32(cd)) + hi, lo := bits.Mul32(2939745, cd) cyear = absCyear(hi) ayday = absYday(lo / 2939745 / 4) return diff --git a/src/unicode/utf8/utf8.go b/src/unicode/utf8/utf8.go index 82fa7c0d4d..01cad1cc81 100644 --- a/src/unicode/utf8/utf8.go +++ b/src/unicode/utf8/utf8.go @@ -263,7 +263,7 @@ func DecodeLastRune(p []byte) (r rune, size int) { // guard against O(n^2) behavior when traversing // backwards through strings with long sequences of // invalid UTF-8. - lim := max(end - UTFMax, 0) + lim := max(end-UTFMax, 0) for start--; start >= lim; start-- { if RuneStart(p[start]) { break @@ -300,7 +300,7 @@ func DecodeLastRuneInString(s string) (r rune, size int) { // guard against O(n^2) behavior when traversing // backwards through strings with long sequences of // invalid UTF-8. - lim := max(end - UTFMax, 0) + lim := max(end-UTFMax, 0) for start--; start >= lim; start-- { if RuneStart(s[start]) { break @@ -430,99 +430,111 @@ func RuneCountInString(s string) (n int) { // bits set to 10. func RuneStart(b byte) bool { return b&0xC0 != 0x80 } +const ptrSize = 4 << (^uintptr(0) >> 63) +const hiBits = 0x8080808080808080 >> (64 - 8*ptrSize) + +func word[T string | []byte](s T) uintptr { + if ptrSize == 4 { + return uintptr(s[0]) | uintptr(s[1])<<8 | uintptr(s[2])<<16 | uintptr(s[3])<<24 + } + return uintptr(uint64(s[0]) | uint64(s[1])<<8 | uint64(s[2])<<16 | uint64(s[3])<<24 | uint64(s[4])<<32 | uint64(s[5])<<40 | uint64(s[6])<<48 | uint64(s[7])<<56) +} + // Valid reports whether p consists entirely of valid UTF-8-encoded runes. func Valid(p []byte) bool { // This optimization avoids the need to recompute the capacity - // when generating code for p[8:], bringing it to parity with + // when generating code for slicing p, bringing it to parity with // ValidString, which was 20% faster on long ASCII strings. p = p[:len(p):len(p)] - // Fast path. Check for and skip 8 bytes of ASCII characters per iteration. - for len(p) >= 8 { - // Combining two 32 bit loads allows the same code to be used - // for 32 and 64 bit platforms. - // The compiler can generate a 32bit load for first32 and second32 - // on many platforms. See test/codegen/memcombine.go. - first32 := uint32(p[0]) | uint32(p[1])<<8 | uint32(p[2])<<16 | uint32(p[3])<<24 - second32 := uint32(p[4]) | uint32(p[5])<<8 | uint32(p[6])<<16 | uint32(p[7])<<24 - if (first32|second32)&0x80808080 != 0 { - // Found a non ASCII byte (>= RuneSelf). - break - } - p = p[8:] - } - n := len(p) - for i := 0; i < n; { - pi := p[i] - if pi < RuneSelf { - i++ + for len(p) > 0 { + p0 := p[0] + if p0 < RuneSelf { + p = p[1:] + // If there's one ASCII byte, there are probably more. + // Advance quickly through ASCII-only data. + // Note: using > instead of >= here is intentional. That avoids + // needing pointing-past-the-end fixup on the slice operations. + if len(p) > ptrSize && word(p)&hiBits == 0 { + p = p[ptrSize:] + if len(p) > 2*ptrSize && (word(p)|word(p[ptrSize:]))&hiBits == 0 { + p = p[2*ptrSize:] + for len(p) > 4*ptrSize && ((word(p)|word(p[ptrSize:]))|(word(p[2*ptrSize:])|word(p[3*ptrSize:])))&hiBits == 0 { + p = p[4*ptrSize:] + } + } + } continue } - x := first[pi] - if x == xx { - return false // Illegal starter byte. - } + x := first[p0] size := int(x & 7) - if i+size > n { - return false // Short or invalid. - } accept := acceptRanges[x>>4] - if c := p[i+1]; c < accept.lo || accept.hi < c { - return false - } else if size == 2 { - } else if c := p[i+2]; c < locb || hicb < c { - return false - } else if size == 3 { - } else if c := p[i+3]; c < locb || hicb < c { - return false + switch size { + case 2: + if len(p) < 2 || p[1] < accept.lo || accept.hi < p[1] { + return false + } + p = p[2:] + case 3: + if len(p) < 3 || p[1] < accept.lo || accept.hi < p[1] || p[2] < locb || hicb < p[2] { + return false + } + p = p[3:] + case 4: + if len(p) < 4 || p[1] < accept.lo || accept.hi < p[1] || p[2] < locb || hicb < p[2] || p[3] < locb || hicb < p[3] { + return false + } + p = p[4:] + default: + return false // illegal starter byte } - i += size } return true } // ValidString reports whether s consists entirely of valid UTF-8-encoded runes. func ValidString(s string) bool { - // Fast path. Check for and skip 8 bytes of ASCII characters per iteration. - for len(s) >= 8 { - // Combining two 32 bit loads allows the same code to be used - // for 32 and 64 bit platforms. - // The compiler can generate a 32bit load for first32 and second32 - // on many platforms. See test/codegen/memcombine.go. - first32 := uint32(s[0]) | uint32(s[1])<<8 | uint32(s[2])<<16 | uint32(s[3])<<24 - second32 := uint32(s[4]) | uint32(s[5])<<8 | uint32(s[6])<<16 | uint32(s[7])<<24 - if (first32|second32)&0x80808080 != 0 { - // Found a non ASCII byte (>= RuneSelf). - break - } - s = s[8:] - } - n := len(s) - for i := 0; i < n; { - si := s[i] - if si < RuneSelf { - i++ + for len(s) > 0 { + s0 := s[0] + if s0 < RuneSelf { + s = s[1:] + // If there's one ASCII byte, there are probably more. + // Advance quickly through ASCII-only data. + // Note: using > instead of >= here is intentional. That avoids + // needing pointing-past-the-end fixup on the slice operations. + if len(s) > ptrSize && word(s)&hiBits == 0 { + s = s[ptrSize:] + if len(s) > 2*ptrSize && (word(s)|word(s[ptrSize:]))&hiBits == 0 { + s = s[2*ptrSize:] + for len(s) > 4*ptrSize && ((word(s)|word(s[ptrSize:]))|(word(s[2*ptrSize:])|word(s[3*ptrSize:])))&hiBits == 0 { + s = s[4*ptrSize:] + } + } + } continue } - x := first[si] - if x == xx { - return false // Illegal starter byte. - } + x := first[s0] size := int(x & 7) - if i+size > n { - return false // Short or invalid. - } accept := acceptRanges[x>>4] - if c := s[i+1]; c < accept.lo || accept.hi < c { - return false - } else if size == 2 { - } else if c := s[i+2]; c < locb || hicb < c { - return false - } else if size == 3 { - } else if c := s[i+3]; c < locb || hicb < c { - return false + switch size { + case 2: + if len(s) < 2 || s[1] < accept.lo || accept.hi < s[1] { + return false + } + s = s[2:] + case 3: + if len(s) < 3 || s[1] < accept.lo || accept.hi < s[1] || s[2] < locb || hicb < s[2] { + return false + } + s = s[3:] + case 4: + if len(s) < 4 || s[1] < accept.lo || accept.hi < s[1] || s[2] < locb || hicb < s[2] || s[3] < locb || hicb < s[3] { + return false + } + s = s[4:] + default: + return false // illegal starter byte } - i += size } return true } diff --git a/src/unicode/utf8/utf8_test.go b/src/unicode/utf8/utf8_test.go index 865167731f..aece0fab73 100644 --- a/src/unicode/utf8/utf8_test.go +++ b/src/unicode/utf8/utf8_test.go @@ -489,6 +489,16 @@ var validTests = []ValidTest{ {string("\xed\xbf\xbf"), false}, // U+DFFF low surrogate (sic) } +func init() { + for i := range 100 { + validTests = append(validTests, ValidTest{in: strings.Repeat("a", i), out: true}) + validTests = append(validTests, ValidTest{in: strings.Repeat("a", i) + "Ж", out: true}) + validTests = append(validTests, ValidTest{in: strings.Repeat("a", i) + "\xe2", out: false}) + validTests = append(validTests, ValidTest{in: strings.Repeat("a", i) + "Ж" + strings.Repeat("b", i), out: true}) + validTests = append(validTests, ValidTest{in: strings.Repeat("a", i) + "\xe2" + strings.Repeat("b", i), out: false}) + } +} + func TestValid(t *testing.T) { for _, tt := range validTests { if Valid([]byte(tt.in)) != tt.out { |
