aboutsummaryrefslogtreecommitdiff
path: root/src/cmd/compile/internal
diff options
context:
space:
mode:
authorCherry Mui <cherryyz@google.com>2025-11-20 14:40:43 -0500
committerCherry Mui <cherryyz@google.com>2025-11-20 14:40:43 -0500
commite3d4645693bc030b9ff9b867f1d374a1d72ef2fe (patch)
tree5d9c6783b4b1901e072ed253acc6ecdd909b23bc /src/cmd/compile/internal
parent95b4ad525fc8d70c881960ab9f75f31548023bed (diff)
parentca37d24e0b9369b8086959df5bc230b38bf98636 (diff)
downloadgo-e3d4645693bc030b9ff9b867f1d374a1d72ef2fe.tar.xz
[dev.simd] all: merge master (ca37d24) into dev.simd
Conflicts: - src/cmd/compile/internal/typecheck/builtin.go Merge List: + 2025-11-20 ca37d24e0b net/http: drop unused "broken" field from persistConn + 2025-11-20 4b740af56a cmd/internal/obj/x86: handle global reference in From3 in dynlink mode + 2025-11-20 790384c6c2 spec: adjust rule for type parameter on RHS of alias declaration + 2025-11-20 a49b0302d0 net/http: correctly close fake net.Conns + 2025-11-20 32f5aadd2f cmd/compile: stack allocate backing stores during append + 2025-11-20 a18aff8057 runtime: select GC mark workers during start-the-world + 2025-11-20 829779f4fe runtime: split findRunnableGCWorker in two + 2025-11-20 ab59569099 go/version: use "custom" as an example of a version suffix + 2025-11-19 c4bb9653ba cmd/compile: Implement LoweredZeroLoop with LSX Instruction on loong64 + 2025-11-19 7f2ae21fb4 cmd/internal/obj/loong64: add MULW.D.W[U] instructions + 2025-11-19 a2946f2385 crypto: add Encapsulator and Decapsulator interfaces + 2025-11-19 6b83bd7146 crypto/ecdh: add KeyExchanger interface + 2025-11-19 4fef9f8b55 go/types, types2: fix object path for grouped declaration statements + 2025-11-19 33529db142 spec: escape double-ampersands + 2025-11-19 dc42565a20 cmd/compile: fix control flow for unsigned divisions proof relations + 2025-11-19 e64023dcbf cmd/compile: cleanup useless if statement in prove + 2025-11-19 2239520d1c test: go fmt prove.go tests + 2025-11-19 489d3dafb7 math: switch s390x math.Pow to generic implementation + 2025-11-18 8c41a482f9 runtime: add dlog.hexdump + 2025-11-18 e912618bd2 runtime: add hexdumper + 2025-11-18 2cf9d4b62f Revert "net/http: do not discard body content when closing it within request handlers" + 2025-11-18 4d0658bb08 cmd/compile: prefer fixed registers for values + 2025-11-18 ba634ca5c7 cmd/compile: fold boolean NOT into branches + 2025-11-18 8806d53c10 cmd/link: align sections, not symbols after DWARF compress + 2025-11-18 c93766007d runtime: do not print recovered when double panic with the same value + 2025-11-18 9859b43643 cmd/asm,cmd/compile,cmd/internal/obj/riscv: use compressed instructions on riscv64 + 2025-11-17 b9ef0633f6 cmd/internal/sys,internal/goarch,runtime: enable the use of compressed instructions on riscv64 + 2025-11-17 a087dea869 debug/elf: sync new loong64 relocation types up to LoongArch ELF psABI v20250521 + 2025-11-17 e1a12c781f cmd/compile: use 32x32->64 multiplies on arm64 + 2025-11-17 6caab99026 runtime: relax TestMemoryLimit on darwin a bit more + 2025-11-17 eda2e8c683 runtime: clear frame pointer at thread entry points + 2025-11-17 6919858338 runtime: rename findrunnable references to findRunnable + 2025-11-17 8e734ec954 go/ast: fix BasicLit.End position for raw strings containing \r + 2025-11-17 592775ec7d crypto/mlkem: avoid a few unnecessary inverse NTT calls + 2025-11-17 590cf18daf crypto/mlkem/mlkemtest: add derandomized Encapsulate768/1024 + 2025-11-17 c12c337099 cmd/compile: teach prove about subtract idioms + 2025-11-17 bc15963813 cmd/compile: clean up prove pass + 2025-11-17 1297fae708 go/token: add (*File).End method + 2025-11-17 65c09eafdf runtime: hoist invariant code out of heapBitsSmallForAddrInline + 2025-11-17 594129b80c internal/runtime/maps: update doc for table.Clear + 2025-11-15 c58d075e9a crypto/rsa: deprecate PKCS#1 v1.5 encryption + 2025-11-14 d55ecea9e5 runtime: usleep before stealing runnext only if not in syscall + 2025-11-14 410ef44f00 cmd: update x/tools to 59ff18c + 2025-11-14 50128a2154 runtime: support runtime.freegc in size-specialized mallocs for noscan objects + 2025-11-14 c3708350a4 cmd/go: tests: rename git-min-vers->git-sha256 + 2025-11-14 aea881230d std: fix printf("%q", int) mistakes + 2025-11-14 120f1874ef runtime: add more precise test of assist credit handling for runtime.freegc + 2025-11-14 fecfcaa4f6 runtime: add runtime.freegc to reduce GC work + 2025-11-14 5a347b775e runtime: set GOEXPERIMENT=runtimefreegc to disabled by default + 2025-11-14 1a03d0db3f runtime: skip tests for GOEXPERIMENT=arenas that do not handle clobberfree=1 + 2025-11-14 cb0d9980f5 net/http: do not discard body content when closing it within request handlers + 2025-11-14 03ed43988f cmd/compile: allow multi-field structs to be stored directly in interfaces + 2025-11-14 1bb1f2bf0c runtime: put AddCleanup cleanup arguments in their own allocation + 2025-11-14 9fd2e44439 runtime: add AddCleanup benchmark + 2025-11-14 80c91eedbb runtime: ensure weak handles end up in their own allocation + 2025-11-14 7a8d0b5d53 runtime: add debug mode to extend _Grunning-without-P windows + 2025-11-14 710abf74da internal/runtime/cgobench: add Go function call benchmark for comparison + 2025-11-14 b24aec598b doc, cmd/internal/obj/riscv: document the riscv64 assembler + 2025-11-14 a0e738c657 cmd/compile/internal: remove incorrect riscv64 SLTI rule + 2025-11-14 2cdcc4150b cmd/compile: fold negation into multiplication + 2025-11-14 b57962b7c7 bytes: fix panic in bytes.Buffer.Peek + 2025-11-14 0a569528ea cmd/compile: optimize comparisons with single bit difference + 2025-11-14 1e5e6663e9 cmd/compile: remove unnecessary casts and types from riscv64 rules + 2025-11-14 ddd8558e61 go/types, types2: swap object.color for Checker.objPathIdx + 2025-11-14 9daaab305c cmd/link/internal/ld: make runtime.buildVersion with experiments valid + 2025-11-13 d50a571ddf test: fix tests to work with sizespecializedmalloc turned off + 2025-11-13 704f841eab cmd/trace: annotation proc start/stop with thread and proc always + 2025-11-13 17a02b9106 net/http: remove unused isLitOrSingle and isNotToken + 2025-11-13 ff61991aed cmd/go: fix flaky TestScript/mod_get_direct + 2025-11-13 129d0cb543 net/http/cgi: accept INCLUDED as protocol for server side includes + 2025-11-13 77c5130100 go/types: minor simplification + 2025-11-13 7601cd3880 go/types: generate cycles.go + 2025-11-13 7a372affd9 go/types, types2: rename definedType to declaredType and clarify docs Change-Id: Ibaa9bdb982364892f80e511c1bb12661fcd5fb86
Diffstat (limited to 'src/cmd/compile/internal')
-rw-r--r--src/cmd/compile/internal/base/debug.go1
-rw-r--r--src/cmd/compile/internal/base/flag.go2
-rw-r--r--src/cmd/compile/internal/deadlocals/deadlocals.go5
-rw-r--r--src/cmd/compile/internal/escape/leaks.go18
-rw-r--r--src/cmd/compile/internal/gc/main.go3
-rw-r--r--src/cmd/compile/internal/ir/expr.go26
-rw-r--r--src/cmd/compile/internal/ir/fmt.go2
-rw-r--r--src/cmd/compile/internal/ir/name.go2
-rw-r--r--src/cmd/compile/internal/ir/node.go1
-rw-r--r--src/cmd/compile/internal/ir/node_gen.go28
-rw-r--r--src/cmd/compile/internal/ir/op_string.go19
-rw-r--r--src/cmd/compile/internal/ir/stmt.go1
-rw-r--r--src/cmd/compile/internal/ir/symtab.go5
-rw-r--r--src/cmd/compile/internal/loong64/ssa.go153
-rw-r--r--src/cmd/compile/internal/slice/slice.go455
-rw-r--r--src/cmd/compile/internal/ssa/_gen/AMD64Ops.go3
-rw-r--r--src/cmd/compile/internal/ssa/_gen/ARM64.rules6
-rw-r--r--src/cmd/compile/internal/ssa/_gen/LOONG64.rules3
-rw-r--r--src/cmd/compile/internal/ssa/_gen/LOONG64Ops.go1
-rw-r--r--src/cmd/compile/internal/ssa/_gen/RISCV64.rules39
-rw-r--r--src/cmd/compile/internal/ssa/_gen/dec.rules9
-rw-r--r--src/cmd/compile/internal/ssa/_gen/generic.rules19
-rw-r--r--src/cmd/compile/internal/ssa/expand_calls.go9
-rw-r--r--src/cmd/compile/internal/ssa/fuse.go8
-rw-r--r--src/cmd/compile/internal/ssa/fuse_comparisons.go45
-rw-r--r--src/cmd/compile/internal/ssa/opGen.go3
-rw-r--r--src/cmd/compile/internal/ssa/prove.go223
-rw-r--r--src/cmd/compile/internal/ssa/regalloc.go9
-rw-r--r--src/cmd/compile/internal/ssa/rewrite.go14
-rw-r--r--src/cmd/compile/internal/ssa/rewriteARM64.go79
-rw-r--r--src/cmd/compile/internal/ssa/rewriteLOONG64.go39
-rw-r--r--src/cmd/compile/internal/ssa/rewriteRISCV64.go103
-rw-r--r--src/cmd/compile/internal/ssa/rewritedec.go52
-rw-r--r--src/cmd/compile/internal/ssa/rewritegeneric.go553
-rw-r--r--src/cmd/compile/internal/ssagen/ssa.go266
-rw-r--r--src/cmd/compile/internal/test/testdata/arith_test.go14
-rw-r--r--src/cmd/compile/internal/typecheck/_builtin/runtime.go6
-rw-r--r--src/cmd/compile/internal/typecheck/builtin.go212
-rw-r--r--src/cmd/compile/internal/types/type.go21
-rw-r--r--src/cmd/compile/internal/types2/check.go31
-rw-r--r--src/cmd/compile/internal/types2/cycles.go1
-rw-r--r--src/cmd/compile/internal/types2/decl.go158
-rw-r--r--src/cmd/compile/internal/types2/object.go54
-rw-r--r--src/cmd/compile/internal/types2/scope.go2
-rw-r--r--src/cmd/compile/internal/types2/sizeof_test.go16
-rw-r--r--src/cmd/compile/internal/types2/typexpr.go20
-rw-r--r--src/cmd/compile/internal/types2/universe.go8
-rw-r--r--src/cmd/compile/internal/walk/expr.go5
48 files changed, 2102 insertions, 650 deletions
diff --git a/src/cmd/compile/internal/base/debug.go b/src/cmd/compile/internal/base/debug.go
index 9e8ab2f488..b532bf435e 100644
--- a/src/cmd/compile/internal/base/debug.go
+++ b/src/cmd/compile/internal/base/debug.go
@@ -20,6 +20,7 @@ type DebugFlags struct {
Append int `help:"print information about append compilation"`
Checkptr int `help:"instrument unsafe pointer conversions\n0: instrumentation disabled\n1: conversions involving unsafe.Pointer are instrumented\n2: conversions to unsafe.Pointer force heap allocation" concurrent:"ok"`
Closure int `help:"print information about closure compilation"`
+ CompressInstructions int `help:"use compressed instructions when possible (if supported by architecture)"`
Converthash string `help:"hash value for use in debugging changes to platform-dependent float-to-[u]int conversion" concurrent:"ok"`
Defer int `help:"print information about defer compilation"`
DisableNil int `help:"disable nil checks" concurrent:"ok"`
diff --git a/src/cmd/compile/internal/base/flag.go b/src/cmd/compile/internal/base/flag.go
index 1d211e0a2d..63cae41524 100644
--- a/src/cmd/compile/internal/base/flag.go
+++ b/src/cmd/compile/internal/base/flag.go
@@ -177,6 +177,7 @@ func ParseFlags() {
Flag.WB = true
Debug.ConcurrentOk = true
+ Debug.CompressInstructions = 1
Debug.MaxShapeLen = 500
Debug.AlignHot = 1
Debug.InlFuncsWithClosures = 1
@@ -299,6 +300,7 @@ func ParseFlags() {
}
parseSpectre(Flag.Spectre) // left as string for RecordFlags
+ Ctxt.CompressInstructions = Debug.CompressInstructions != 0
Ctxt.Flag_shared = Ctxt.Flag_dynlink || Ctxt.Flag_shared
Ctxt.Flag_optimize = Flag.N == 0
Ctxt.Debugasm = int(Flag.S)
diff --git a/src/cmd/compile/internal/deadlocals/deadlocals.go b/src/cmd/compile/internal/deadlocals/deadlocals.go
index 238450416a..55ad0387a4 100644
--- a/src/cmd/compile/internal/deadlocals/deadlocals.go
+++ b/src/cmd/compile/internal/deadlocals/deadlocals.go
@@ -44,6 +44,11 @@ func Funcs(fns []*ir.Func) {
*as.lhs = ir.BlankNode
*as.rhs = zero
}
+ if len(assigns) > 0 {
+ // k.Defn might be pointing at one of the
+ // assignments we're overwriting.
+ k.Defn = nil
+ }
}
}
}
diff --git a/src/cmd/compile/internal/escape/leaks.go b/src/cmd/compile/internal/escape/leaks.go
index 942f87d2a2..176bccd847 100644
--- a/src/cmd/compile/internal/escape/leaks.go
+++ b/src/cmd/compile/internal/escape/leaks.go
@@ -124,3 +124,21 @@ func parseLeaks(s string) leaks {
copy(l[:], s[4:])
return l
}
+
+func ParseLeaks(s string) leaks {
+ return parseLeaks(s)
+}
+
+// Any reports whether the value flows anywhere at all.
+func (l leaks) Any() bool {
+ // TODO: do mutator/callee matter?
+ if l.Heap() >= 0 || l.Mutator() >= 0 || l.Callee() >= 0 {
+ return true
+ }
+ for i := range numEscResults {
+ if l.Result(i) >= 0 {
+ return true
+ }
+ }
+ return false
+}
diff --git a/src/cmd/compile/internal/gc/main.go b/src/cmd/compile/internal/gc/main.go
index 918d3f3514..6418ab9357 100644
--- a/src/cmd/compile/internal/gc/main.go
+++ b/src/cmd/compile/internal/gc/main.go
@@ -22,6 +22,7 @@ import (
"cmd/compile/internal/pkginit"
"cmd/compile/internal/reflectdata"
"cmd/compile/internal/rttype"
+ "cmd/compile/internal/slice"
"cmd/compile/internal/ssa"
"cmd/compile/internal/ssagen"
"cmd/compile/internal/staticinit"
@@ -271,6 +272,8 @@ func Main(archInit func(*ssagen.ArchInfo)) {
base.Timer.Start("fe", "escapes")
escape.Funcs(typecheck.Target.Funcs)
+ slice.Funcs(typecheck.Target.Funcs)
+
loopvar.LogTransformations(transformed)
// Collect information for go:nowritebarrierrec
diff --git a/src/cmd/compile/internal/ir/expr.go b/src/cmd/compile/internal/ir/expr.go
index 25654ca253..1a3514db6c 100644
--- a/src/cmd/compile/internal/ir/expr.go
+++ b/src/cmd/compile/internal/ir/expr.go
@@ -192,6 +192,7 @@ type CallExpr struct {
IsDDD bool
GoDefer bool // whether this call is part of a go or defer statement
NoInline bool // whether this call must not be inlined
+ UseBuf bool // use stack buffer for backing store (OAPPEND only)
}
func NewCallExpr(pos src.XPos, op Op, fun Node, args []Node) *CallExpr {
@@ -1280,3 +1281,28 @@ func MethodExprFunc(n Node) *types.Field {
base.Fatalf("unexpected node: %v (%v)", n, n.Op())
panic("unreachable")
}
+
+// A MoveToHeapExpr takes a slice as input and moves it to the
+// heap (by copying the backing store if it is not already
+// on the heap).
+type MoveToHeapExpr struct {
+ miniExpr
+ Slice Node
+ // An expression that evaluates to a *runtime._type
+ // that represents the slice element type.
+ RType Node
+ // If PreserveCapacity is true, the capacity of
+ // the resulting slice, and all of the elements in
+ // [len:cap], must be preserved.
+ // If PreserveCapacity is false, the resulting
+ // slice may have any capacity >= len, with any
+ // elements in the resulting [len:cap] range zeroed.
+ PreserveCapacity bool
+}
+
+func NewMoveToHeapExpr(pos src.XPos, slice Node) *MoveToHeapExpr {
+ n := &MoveToHeapExpr{Slice: slice}
+ n.pos = pos
+ n.op = OMOVE2HEAP
+ return n
+}
diff --git a/src/cmd/compile/internal/ir/fmt.go b/src/cmd/compile/internal/ir/fmt.go
index ae4ff62652..eb64cce47b 100644
--- a/src/cmd/compile/internal/ir/fmt.go
+++ b/src/cmd/compile/internal/ir/fmt.go
@@ -574,7 +574,7 @@ func exprFmt(n Node, s fmt.State, prec int) {
// Special case for rune constants.
if typ == types.RuneType || typ == types.UntypedRune {
if x, ok := constant.Uint64Val(val); ok && x <= utf8.MaxRune {
- fmt.Fprintf(s, "%q", x)
+ fmt.Fprintf(s, "%q", rune(x))
return
}
}
diff --git a/src/cmd/compile/internal/ir/name.go b/src/cmd/compile/internal/ir/name.go
index 01f1c0c502..63f1b1c931 100644
--- a/src/cmd/compile/internal/ir/name.go
+++ b/src/cmd/compile/internal/ir/name.go
@@ -43,7 +43,7 @@ type Name struct {
Func *Func // TODO(austin): nil for I.M
Offset_ int64
val constant.Value
- Opt any // for use by escape analysis
+ Opt any // for use by escape or slice analysis
Embed *[]Embed // list of embedded files, for ONAME var
// For a local variable (not param) or extern, the initializing assignment (OAS or OAS2).
diff --git a/src/cmd/compile/internal/ir/node.go b/src/cmd/compile/internal/ir/node.go
index 8c61bb6ed5..f26f61cb18 100644
--- a/src/cmd/compile/internal/ir/node.go
+++ b/src/cmd/compile/internal/ir/node.go
@@ -293,6 +293,7 @@ const (
OLINKSYMOFFSET // offset within a name
OJUMPTABLE // A jump table structure for implementing dense expression switches
OINTERFACESWITCH // A type switch with interface cases
+ OMOVE2HEAP // Promote a stack-backed slice to heap
// opcodes for generics
ODYNAMICDOTTYPE // x = i.(T) where T is a type parameter (or derived from a type parameter)
diff --git a/src/cmd/compile/internal/ir/node_gen.go b/src/cmd/compile/internal/ir/node_gen.go
index 2221045c93..4298b3a43d 100644
--- a/src/cmd/compile/internal/ir/node_gen.go
+++ b/src/cmd/compile/internal/ir/node_gen.go
@@ -1175,6 +1175,34 @@ func (n *MakeExpr) editChildrenWithHidden(edit func(Node) Node) {
}
}
+func (n *MoveToHeapExpr) Format(s fmt.State, verb rune) { fmtNode(n, s, verb) }
+func (n *MoveToHeapExpr) copy() Node {
+ c := *n
+ c.init = copyNodes(c.init)
+ return &c
+}
+func (n *MoveToHeapExpr) doChildren(do func(Node) bool) bool {
+ if doNodes(n.init, do) {
+ return true
+ }
+ if n.Slice != nil && do(n.Slice) {
+ return true
+ }
+ return false
+}
+func (n *MoveToHeapExpr) doChildrenWithHidden(do func(Node) bool) bool {
+ return n.doChildren(do)
+}
+func (n *MoveToHeapExpr) editChildren(edit func(Node) Node) {
+ editNodes(n.init, edit)
+ if n.Slice != nil {
+ n.Slice = edit(n.Slice).(Node)
+ }
+}
+func (n *MoveToHeapExpr) editChildrenWithHidden(edit func(Node) Node) {
+ n.editChildren(edit)
+}
+
func (n *Name) Format(s fmt.State, verb rune) { fmtNode(n, s, verb) }
func (n *NilExpr) Format(s fmt.State, verb rune) { fmtNode(n, s, verb) }
diff --git a/src/cmd/compile/internal/ir/op_string.go b/src/cmd/compile/internal/ir/op_string.go
index 7494beee4c..f042ad84a4 100644
--- a/src/cmd/compile/internal/ir/op_string.go
+++ b/src/cmd/compile/internal/ir/op_string.go
@@ -151,18 +151,19 @@ func _() {
_ = x[OLINKSYMOFFSET-140]
_ = x[OJUMPTABLE-141]
_ = x[OINTERFACESWITCH-142]
- _ = x[ODYNAMICDOTTYPE-143]
- _ = x[ODYNAMICDOTTYPE2-144]
- _ = x[ODYNAMICTYPE-145]
- _ = x[OTAILCALL-146]
- _ = x[OGETG-147]
- _ = x[OGETCALLERSP-148]
- _ = x[OEND-149]
+ _ = x[OMOVE2HEAP-143]
+ _ = x[ODYNAMICDOTTYPE-144]
+ _ = x[ODYNAMICDOTTYPE2-145]
+ _ = x[ODYNAMICTYPE-146]
+ _ = x[OTAILCALL-147]
+ _ = x[OGETG-148]
+ _ = x[OGETCALLERSP-149]
+ _ = x[OEND-150]
}
-const _Op_name = "XXXNAMENONAMETYPELITERALNILADDSUBORXORADDSTRADDRANDANDAPPENDBYTES2STRBYTES2STRTMPRUNES2STRSTR2BYTESSTR2BYTESTMPSTR2RUNESSLICE2ARRSLICE2ARRPTRASAS2AS2DOTTYPEAS2FUNCAS2MAPRAS2RECVASOPCALLCALLFUNCCALLMETHCALLINTERCAPCLEARCLOSECLOSURECOMPLITMAPLITSTRUCTLITARRAYLITSLICELITPTRLITCONVCONVIFACECONVNOPCOPYDCLDCLFUNCDELETEDOTDOTPTRDOTMETHDOTINTERXDOTDOTTYPEDOTTYPE2EQNELTLEGEGTDEREFINDEXINDEXMAPKEYSTRUCTKEYLENMAKEMAKECHANMAKEMAPMAKESLICEMAKESLICECOPYMULDIVMODLSHRSHANDANDNOTNEWNOTBITNOTPLUSNEGORORPANICPRINTPRINTLNPARENSENDSLICESLICEARRSLICESTRSLICE3SLICE3ARRSLICEHEADERSTRINGHEADERRECOVERRECVRUNESTRSELRECV2MINMAXREALIMAGCOMPLEXUNSAFEADDUNSAFESLICEUNSAFESLICEDATAUNSAFESTRINGUNSAFESTRINGDATAMETHEXPRMETHVALUEBLOCKBREAKCASECONTINUEDEFERFALLFORGOTOIFLABELGORANGERETURNSELECTSWITCHTYPESWINLCALLMAKEFACEITABIDATASPTRCFUNCCHECKNILRESULTINLMARKLINKSYMOFFSETJUMPTABLEINTERFACESWITCHDYNAMICDOTTYPEDYNAMICDOTTYPE2DYNAMICTYPETAILCALLGETGGETCALLERSPEND"
+const _Op_name = "XXXNAMENONAMETYPELITERALNILADDSUBORXORADDSTRADDRANDANDAPPENDBYTES2STRBYTES2STRTMPRUNES2STRSTR2BYTESSTR2BYTESTMPSTR2RUNESSLICE2ARRSLICE2ARRPTRASAS2AS2DOTTYPEAS2FUNCAS2MAPRAS2RECVASOPCALLCALLFUNCCALLMETHCALLINTERCAPCLEARCLOSECLOSURECOMPLITMAPLITSTRUCTLITARRAYLITSLICELITPTRLITCONVCONVIFACECONVNOPCOPYDCLDCLFUNCDELETEDOTDOTPTRDOTMETHDOTINTERXDOTDOTTYPEDOTTYPE2EQNELTLEGEGTDEREFINDEXINDEXMAPKEYSTRUCTKEYLENMAKEMAKECHANMAKEMAPMAKESLICEMAKESLICECOPYMULDIVMODLSHRSHANDANDNOTNEWNOTBITNOTPLUSNEGORORPANICPRINTPRINTLNPARENSENDSLICESLICEARRSLICESTRSLICE3SLICE3ARRSLICEHEADERSTRINGHEADERRECOVERRECVRUNESTRSELRECV2MINMAXREALIMAGCOMPLEXUNSAFEADDUNSAFESLICEUNSAFESLICEDATAUNSAFESTRINGUNSAFESTRINGDATAMETHEXPRMETHVALUEBLOCKBREAKCASECONTINUEDEFERFALLFORGOTOIFLABELGORANGERETURNSELECTSWITCHTYPESWINLCALLMAKEFACEITABIDATASPTRCFUNCCHECKNILRESULTINLMARKLINKSYMOFFSETJUMPTABLEINTERFACESWITCHMOVE2HEAPDYNAMICDOTTYPEDYNAMICDOTTYPE2DYNAMICTYPETAILCALLGETGGETCALLERSPEND"
-var _Op_index = [...]uint16{0, 3, 7, 13, 17, 24, 27, 30, 33, 35, 38, 44, 48, 54, 60, 69, 81, 90, 99, 111, 120, 129, 141, 143, 146, 156, 163, 170, 177, 181, 185, 193, 201, 210, 213, 218, 223, 230, 237, 243, 252, 260, 268, 274, 278, 287, 294, 298, 301, 308, 314, 317, 323, 330, 338, 342, 349, 357, 359, 361, 363, 365, 367, 369, 374, 379, 387, 390, 399, 402, 406, 414, 421, 430, 443, 446, 449, 452, 455, 458, 461, 467, 470, 473, 479, 483, 486, 490, 495, 500, 507, 512, 516, 521, 529, 537, 543, 552, 563, 575, 582, 586, 593, 601, 604, 607, 611, 615, 622, 631, 642, 657, 669, 685, 693, 702, 707, 712, 716, 724, 729, 733, 736, 740, 742, 747, 749, 754, 760, 766, 772, 778, 785, 793, 797, 802, 806, 811, 819, 825, 832, 845, 854, 869, 883, 898, 909, 917, 921, 932, 935}
+var _Op_index = [...]uint16{0, 3, 7, 13, 17, 24, 27, 30, 33, 35, 38, 44, 48, 54, 60, 69, 81, 90, 99, 111, 120, 129, 141, 143, 146, 156, 163, 170, 177, 181, 185, 193, 201, 210, 213, 218, 223, 230, 237, 243, 252, 260, 268, 274, 278, 287, 294, 298, 301, 308, 314, 317, 323, 330, 338, 342, 349, 357, 359, 361, 363, 365, 367, 369, 374, 379, 387, 390, 399, 402, 406, 414, 421, 430, 443, 446, 449, 452, 455, 458, 461, 467, 470, 473, 479, 483, 486, 490, 495, 500, 507, 512, 516, 521, 529, 537, 543, 552, 563, 575, 582, 586, 593, 601, 604, 607, 611, 615, 622, 631, 642, 657, 669, 685, 693, 702, 707, 712, 716, 724, 729, 733, 736, 740, 742, 747, 749, 754, 760, 766, 772, 778, 785, 793, 797, 802, 806, 811, 819, 825, 832, 845, 854, 869, 878, 892, 907, 918, 926, 930, 941, 944}
func (i Op) String() string {
if i >= Op(len(_Op_index)-1) {
diff --git a/src/cmd/compile/internal/ir/stmt.go b/src/cmd/compile/internal/ir/stmt.go
index 0801ecdd9e..affa5f4551 100644
--- a/src/cmd/compile/internal/ir/stmt.go
+++ b/src/cmd/compile/internal/ir/stmt.go
@@ -42,6 +42,7 @@ func (*Decl) isStmt() {}
type Stmt interface {
Node
isStmt()
+ PtrInit() *Nodes
}
// A miniStmt is a miniNode with extra fields common to statements.
diff --git a/src/cmd/compile/internal/ir/symtab.go b/src/cmd/compile/internal/ir/symtab.go
index 344985f7be..4b5bf17a3d 100644
--- a/src/cmd/compile/internal/ir/symtab.go
+++ b/src/cmd/compile/internal/ir/symtab.go
@@ -29,6 +29,11 @@ type symsStruct struct {
GCWriteBarrier [8]*obj.LSym
Goschedguarded *obj.LSym
Growslice *obj.LSym
+ GrowsliceBuf *obj.LSym
+ MoveSlice *obj.LSym
+ MoveSliceNoScan *obj.LSym
+ MoveSliceNoCap *obj.LSym
+ MoveSliceNoCapNoScan *obj.LSym
InterfaceSwitch *obj.LSym
MallocGC *obj.LSym
MallocGCSmallNoScan [27]*obj.LSym
diff --git a/src/cmd/compile/internal/loong64/ssa.go b/src/cmd/compile/internal/loong64/ssa.go
index 84bbf9b394..71953109c4 100644
--- a/src/cmd/compile/internal/loong64/ssa.go
+++ b/src/cmd/compile/internal/loong64/ssa.go
@@ -575,6 +575,7 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
case ssa.OpLOONG64LoweredZeroLoop:
ptrReg := v.Args[0].Reg()
countReg := v.RegTmp()
+ flagReg := int16(loong64.REGTMP)
var off int64
n := v.AuxInt
loopSize := int64(64)
@@ -587,58 +588,119 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
// vs
// 16 instuctions in the straightline code
// Might as well use straightline code.
- v.Fatalf("ZeroLoop size tool small %d", n)
+ v.Fatalf("ZeroLoop size too small %d", n)
}
- // Put iteration count in a register.
- // MOVV $n/loopSize, countReg
- p := s.Prog(loong64.AMOVV)
- p.From.Type = obj.TYPE_CONST
- p.From.Offset = n / loopSize
- p.To.Type = obj.TYPE_REG
- p.To.Reg = countReg
- cntInit := p
+ // MOVV $n/loopSize, countReg
+ // MOVBU ir.Syms.Loong64HasLSX, flagReg
+ // BNE flagReg, lsxInit
+ // genericInit:
+ // for off = 0; off < loopSize; off += 8 {
+ // zero8(s, ptrReg, off)
+ // }
+ // ADDV $loopSize, ptrReg
+ // SUBV $1, countReg
+ // BNE countReg, genericInit
+ // JMP tail
+ // lsxInit:
+ // VXORV V31, V31, V31, v31 = 0
+ // for off = 0; off < loopSize; off += 16 {
+ // zero16(s, V31, ptrReg, off)
+ // }
+ // ADDV $loopSize, ptrReg
+ // SUBV $1, countReg
+ // BNE countReg, lsxInit
+ // tail:
+ // n %= loopSize
+ // for off = 0; n >= 8; off += 8, n -= 8 {
+ // zero8(s, ptrReg, off)
+ // }
+ //
+ // if n != 0 {
+ // zero8(s, ptrReg, off+n-8)
+ // }
- // Zero loopSize bytes starting at ptrReg.
- for range loopSize / 8 {
- // MOVV ZR, off(ptrReg)
+ p1 := s.Prog(loong64.AMOVV)
+ p1.From.Type = obj.TYPE_CONST
+ p1.From.Offset = n / loopSize
+ p1.To.Type = obj.TYPE_REG
+ p1.To.Reg = countReg
+
+ p2 := s.Prog(loong64.AMOVBU)
+ p2.From.Type = obj.TYPE_MEM
+ p2.From.Name = obj.NAME_EXTERN
+ p2.From.Sym = ir.Syms.Loong64HasLSX
+ p2.To.Type = obj.TYPE_REG
+ p2.To.Reg = flagReg
+
+ p3 := s.Prog(loong64.ABNE)
+ p3.From.Type = obj.TYPE_REG
+ p3.From.Reg = flagReg
+ p3.To.Type = obj.TYPE_BRANCH
+
+ for off = 0; off < loopSize; off += 8 {
zero8(s, ptrReg, off)
- off += 8
}
- // Increment ptrReg by loopSize.
- // ADDV $loopSize, ptrReg
- p = s.Prog(loong64.AADDV)
- p.From.Type = obj.TYPE_CONST
- p.From.Offset = loopSize
- p.To.Type = obj.TYPE_REG
- p.To.Reg = ptrReg
+ p4 := s.Prog(loong64.AADDV)
+ p4.From.Type = obj.TYPE_CONST
+ p4.From.Offset = loopSize
+ p4.To.Type = obj.TYPE_REG
+ p4.To.Reg = ptrReg
- // Decrement loop count.
- // SUBV $1, countReg
- p = s.Prog(loong64.ASUBV)
- p.From.Type = obj.TYPE_CONST
- p.From.Offset = 1
- p.To.Type = obj.TYPE_REG
- p.To.Reg = countReg
+ p5 := s.Prog(loong64.ASUBV)
+ p5.From.Type = obj.TYPE_CONST
+ p5.From.Offset = 1
+ p5.To.Type = obj.TYPE_REG
+ p5.To.Reg = countReg
- // Jump to loop header if we're not done yet.
- // BNE countReg, loop header
- p = s.Prog(loong64.ABNE)
- p.From.Type = obj.TYPE_REG
- p.From.Reg = countReg
- p.To.Type = obj.TYPE_BRANCH
- p.To.SetTarget(cntInit.Link)
+ p6 := s.Prog(loong64.ABNE)
+ p6.From.Type = obj.TYPE_REG
+ p6.From.Reg = countReg
+ p6.To.Type = obj.TYPE_BRANCH
+ p6.To.SetTarget(p3.Link)
+
+ p7 := s.Prog(obj.AJMP)
+ p7.To.Type = obj.TYPE_BRANCH
+
+ p8 := s.Prog(loong64.AVXORV)
+ p8.From.Type = obj.TYPE_REG
+ p8.From.Reg = loong64.REG_V31
+ p8.To.Type = obj.TYPE_REG
+ p8.To.Reg = loong64.REG_V31
+ p3.To.SetTarget(p8)
+
+ for off = 0; off < loopSize; off += 16 {
+ zero16(s, loong64.REG_V31, ptrReg, off)
+ }
+
+ p9 := s.Prog(loong64.AADDV)
+ p9.From.Type = obj.TYPE_CONST
+ p9.From.Offset = loopSize
+ p9.To.Type = obj.TYPE_REG
+ p9.To.Reg = ptrReg
+
+ p10 := s.Prog(loong64.ASUBV)
+ p10.From.Type = obj.TYPE_CONST
+ p10.From.Offset = 1
+ p10.To.Type = obj.TYPE_REG
+ p10.To.Reg = countReg
+
+ p11 := s.Prog(loong64.ABNE)
+ p11.From.Type = obj.TYPE_REG
+ p11.From.Reg = countReg
+ p11.To.Type = obj.TYPE_BRANCH
+ p11.To.SetTarget(p8.Link)
+
+ p12 := s.Prog(obj.ANOP)
+ p7.To.SetTarget(p12)
// Multiples of the loop size are now done.
n %= loopSize
-
- off = 0
// Write any fractional portion.
- for n >= 8 {
- // MOVV ZR, off(ptrReg)
+ for off = 0; n >= 8; off += 8 {
+ // MOVV ZR, off(ptrReg)
zero8(s, ptrReg, off)
- off += 8
n -= 8
}
@@ -1333,7 +1395,7 @@ func move8(s *ssagen.State, src, dst, tmp int16, off int64) {
// zero8 zeroes 8 bytes at reg+off.
func zero8(s *ssagen.State, reg int16, off int64) {
- // MOVV ZR, off(reg)
+ // MOVV ZR, off(reg)
p := s.Prog(loong64.AMOVV)
p.From.Type = obj.TYPE_REG
p.From.Reg = loong64.REGZERO
@@ -1341,3 +1403,14 @@ func zero8(s *ssagen.State, reg int16, off int64) {
p.To.Reg = reg
p.To.Offset = off
}
+
+// zero16 zeroes 16 bytes at reg+off.
+func zero16(s *ssagen.State, regZero, regBase int16, off int64) {
+ // VMOVQ regZero, off(regBase)
+ p := s.Prog(loong64.AVMOVQ)
+ p.From.Type = obj.TYPE_REG
+ p.From.Reg = regZero
+ p.To.Type = obj.TYPE_MEM
+ p.To.Reg = regBase
+ p.To.Offset = off
+}
diff --git a/src/cmd/compile/internal/slice/slice.go b/src/cmd/compile/internal/slice/slice.go
new file mode 100644
index 0000000000..7a32e7adbd
--- /dev/null
+++ b/src/cmd/compile/internal/slice/slice.go
@@ -0,0 +1,455 @@
+// Copyright 2025 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package slice
+
+// This file implements a stack-allocation optimization
+// for the backing store of slices.
+//
+// Consider the code:
+//
+// var s []int
+// for i := range ... {
+// s = append(s, i)
+// }
+// return s
+//
+// Some of the append operations will need to do an allocation
+// by calling growslice. This will happen on the 1st, 2nd, 4th,
+// 8th, etc. append calls. The allocations done by all but the
+// last growslice call will then immediately be garbage.
+//
+// We'd like to avoid doing some of those intermediate
+// allocations if possible.
+//
+// If we can determine that the "return s" statement is the
+// *only* way that the backing store for s escapes, then we
+// can rewrite the code to something like:
+//
+// var s []int
+// for i := range N {
+// s = append(s, i)
+// }
+// s = move2heap(s)
+// return s
+//
+// Using the move2heap runtime function, which does:
+//
+// move2heap(s):
+// If s is not backed by a stackframe-allocated
+// backing store, return s. Otherwise, copy s
+// to the heap and return the copy.
+//
+// Now we can treat the backing store of s allocated at the
+// append site as not escaping. Previous stack allocation
+// optimizations now apply, which can use a fixed-size
+// stack-allocated backing store for s when appending.
+// (See ../ssagen/ssa.go:(*state).append)
+//
+// It is tricky to do this optimization safely. To describe
+// our analysis, we first define what an "exclusive" slice
+// variable is.
+//
+// A slice variable (a variable of slice type) is called
+// "exclusive" if, when it has a reference to a
+// stackframe-allocated backing store, it is the only
+// variable with such a reference.
+//
+// In other words, a slice variable is exclusive if
+// any of the following holds:
+// 1) It points to a heap-allocated backing store
+// 2) It points to a stack-allocated backing store
+// for any parent frame.
+// 3) It is the only variable that references its
+// backing store.
+// 4) It is nil.
+//
+// The nice thing about exclusive slice variables is that
+// it is always safe to do
+// s = move2heap(s)
+// whenever s is an exclusive slice variable. Because no
+// one else has a reference to the backing store, no one
+// else can tell that we moved the backing store from one
+// location to another.
+//
+// Note that exclusiveness is a dynamic property. A slice
+// variable may be exclusive during some parts of execution
+// and not exclusive during others.
+//
+// The following operations set or preserve the exclusivity
+// of a slice variable s:
+// s = nil
+// s = append(s, ...)
+// s = s[i:j]
+// ... = s[i]
+// s[i] = ...
+// f(s) where f does not escape its argument
+// Other operations destroy exclusivity. A non-exhaustive list includes:
+// x = s
+// *p = s
+// f(s) where f escapes its argument
+// return s
+// To err on the safe side, we white list exclusivity-preserving
+// operations and we asssume that any other operations that mention s
+// destroy its exclusivity.
+//
+// Our strategy is to move the backing store of s to the heap before
+// any exclusive->nonexclusive transition. That way, s will only ever
+// have a reference to a stack backing store while it is exclusive.
+//
+// move2heap for a variable s is implemented with:
+// if s points to within the stack frame {
+// s2 := make([]T, s.len, s.cap)
+// copy(s2[:s.cap], s[:s.cap])
+// s = s2
+// }
+// Note that in general we need to copy all of s[:cap(s)] elements when
+// moving to the heap. As an optimization, we keep track of slice variables
+// whose capacity, and the elements in s[len(s):cap(s)], are never accessed.
+// For those slice variables, we can allocate to the next size class above
+// the length, which saves memory and copying cost.
+
+import (
+ "cmd/compile/internal/base"
+ "cmd/compile/internal/escape"
+ "cmd/compile/internal/ir"
+ "cmd/compile/internal/reflectdata"
+)
+
+func Funcs(all []*ir.Func) {
+ if base.Flag.N != 0 {
+ return
+ }
+ for _, fn := range all {
+ analyze(fn)
+ }
+}
+
+func analyze(fn *ir.Func) {
+ type sliceInfo struct {
+ // Slice variable.
+ s *ir.Name
+
+ // Count of uses that this pass understands.
+ okUses int32
+ // Count of all uses found.
+ allUses int32
+
+ // A place where the slice variable transitions from
+ // exclusive to nonexclusive.
+ // We could keep track of more than one, but one is enough for now.
+ // Currently, this can be either a return statement or
+ // an assignment.
+ // TODO: other possible transitions?
+ transition ir.Stmt
+
+ // Each s = append(s, ...) instance we found.
+ appends []*ir.CallExpr
+
+ // Weight of the number of s = append(s, ...) instances we found.
+ // The optimizations we do are only really useful if there are at
+ // least weight 2. (Note: appends in loops have weight >= 2.)
+ appendWeight int
+
+ // Whether we ever do cap(s), or other operations that use cap(s)
+ // (possibly implicitly), like s[i:j].
+ capUsed bool
+ }
+
+ // Every variable (*ir.Name) that we are tracking will have
+ // a non-nil *sliceInfo in its Opt field.
+ haveLocalSlice := false
+ maxStackSize := int64(base.Debug.VariableMakeThreshold)
+ var namedRets []*ir.Name
+ for _, s := range fn.Dcl {
+ if !s.Type().IsSlice() {
+ continue
+ }
+ if s.Type().Elem().Size() > maxStackSize {
+ continue
+ }
+ if !base.VariableMakeHash.MatchPos(s.Pos(), nil) {
+ continue
+ }
+ s.Opt = &sliceInfo{s: s} // start tracking s
+ haveLocalSlice = true
+ if s.Class == ir.PPARAMOUT {
+ namedRets = append(namedRets, s)
+ }
+ }
+ if !haveLocalSlice {
+ return
+ }
+
+ // Keep track of loop depth while walking.
+ loopDepth := 0
+
+ // tracking returns the info for the slice variable if n is a slice
+ // variable that we're still considering, or nil otherwise.
+ tracking := func(n ir.Node) *sliceInfo {
+ if n == nil || n.Op() != ir.ONAME {
+ return nil
+ }
+ s := n.(*ir.Name)
+ if s.Opt == nil {
+ return nil
+ }
+ return s.Opt.(*sliceInfo)
+ }
+
+ // addTransition(n, loc) records that s experiences an exclusive->nonexclusive
+ // transition somewhere within loc.
+ addTransition := func(i *sliceInfo, loc ir.Stmt) {
+ if i.transition != nil {
+ // We only keep track of a single exclusive->nonexclusive transition
+ // for a slice variable. If we find more than one, give up.
+ // (More than one transition location would be fine, but we would
+ // start to get worried about introducing too much additional code.)
+ i.s.Opt = nil
+ return
+ }
+ i.transition = loc
+ }
+
+ // Examine an x = y assignment that occurs somewhere within statement stmt.
+ assign := func(x, y ir.Node, stmt ir.Stmt) {
+ if i := tracking(x); i != nil {
+ // s = y. Check for understood patterns for y.
+ if y == nil || y.Op() == ir.ONIL {
+ // s = nil is ok.
+ i.okUses++
+ } else if y.Op() == ir.OSLICELIT {
+ // s = []{...} is ok.
+ // Note: this reveals capacity. Should it?
+ i.okUses++
+ i.capUsed = true
+ } else if y.Op() == ir.OSLICE {
+ y := y.(*ir.SliceExpr)
+ if y.X == i.s {
+ // s = s[...:...] is ok
+ i.okUses += 2
+ i.capUsed = true
+ }
+ } else if y.Op() == ir.OAPPEND {
+ y := y.(*ir.CallExpr)
+ if y.Args[0] == i.s {
+ // s = append(s, ...) is ok
+ i.okUses += 2
+ i.appends = append(i.appends, y)
+ i.appendWeight += 1 + loopDepth
+ }
+ // TODO: s = append(nil, ...)?
+ }
+ // Note that technically s = make([]T, ...) preserves exclusivity, but
+ // we don't track that because we assume users who wrote that know
+ // better than the compiler does.
+
+ // TODO: figure out how to handle s = fn(..., s, ...)
+ // It would be nice to maintain exclusivity of s in this situation.
+ // But unfortunately, fn can return one of its other arguments, which
+ // may be a slice with a stack-allocated backing store other than s.
+ // (which may have preexisting references to its backing store).
+ //
+ // Maybe we could do it if s is the only argument?
+ }
+
+ if i := tracking(y); i != nil {
+ // ... = s
+ // Treat this as an exclusive->nonexclusive transition.
+ i.okUses++
+ addTransition(i, stmt)
+ }
+ }
+
+ var do func(ir.Node) bool
+ do = func(n ir.Node) bool {
+ if n == nil {
+ return false
+ }
+ switch n.Op() {
+ case ir.ONAME:
+ if i := tracking(n); i != nil {
+ // A use of a slice variable. Count it.
+ i.allUses++
+ }
+ case ir.ODCL:
+ n := n.(*ir.Decl)
+ if i := tracking(n.X); i != nil {
+ i.okUses++
+ }
+ case ir.OINDEX:
+ n := n.(*ir.IndexExpr)
+ if i := tracking(n.X); i != nil {
+ // s[i] is ok.
+ i.okUses++
+ }
+ case ir.OLEN:
+ n := n.(*ir.UnaryExpr)
+ if i := tracking(n.X); i != nil {
+ // len(s) is ok
+ i.okUses++
+ }
+ case ir.OCAP:
+ n := n.(*ir.UnaryExpr)
+ if i := tracking(n.X); i != nil {
+ // cap(s) is ok
+ i.okUses++
+ i.capUsed = true
+ }
+ case ir.OADDR:
+ n := n.(*ir.AddrExpr)
+ if n.X.Op() == ir.OINDEX {
+ n := n.X.(*ir.IndexExpr)
+ if i := tracking(n.X); i != nil {
+ // &s[i] is definitely a nonexclusive transition.
+ // (We need this case because s[i] is ok, but &s[i] is not.)
+ i.s.Opt = nil
+ }
+ }
+ case ir.ORETURN:
+ n := n.(*ir.ReturnStmt)
+ for _, x := range n.Results {
+ if i := tracking(x); i != nil {
+ i.okUses++
+ // We go exclusive->nonexclusive here
+ addTransition(i, n)
+ }
+ }
+ if len(n.Results) == 0 {
+ // Uses of named result variables are implicit here.
+ for _, x := range namedRets {
+ if i := tracking(x); i != nil {
+ addTransition(i, n)
+ }
+ }
+ }
+ case ir.OCALLFUNC:
+ n := n.(*ir.CallExpr)
+ for idx, arg := range n.Args {
+ if i := tracking(arg); i != nil {
+ if !argLeak(n, idx) {
+ // Passing s to a nonescaping arg is ok.
+ i.okUses++
+ i.capUsed = true
+ }
+ }
+ }
+ case ir.ORANGE:
+ // Range over slice is ok.
+ n := n.(*ir.RangeStmt)
+ if i := tracking(n.X); i != nil {
+ i.okUses++
+ }
+ case ir.OAS:
+ n := n.(*ir.AssignStmt)
+ assign(n.X, n.Y, n)
+ case ir.OAS2:
+ n := n.(*ir.AssignListStmt)
+ for i := range len(n.Lhs) {
+ assign(n.Lhs[i], n.Rhs[i], n)
+ }
+ case ir.OCLOSURE:
+ n := n.(*ir.ClosureExpr)
+ for _, v := range n.Func.ClosureVars {
+ do(v.Outer)
+ }
+ }
+ if n.Op() == ir.OFOR || n.Op() == ir.ORANGE {
+ // Note: loopDepth isn't really right for init portion
+ // of the for statement, but that's ok. Correctness
+ // does not depend on depth info.
+ loopDepth++
+ defer func() { loopDepth-- }()
+ }
+ // Check all the children.
+ ir.DoChildren(n, do)
+ return false
+ }
+
+ // Run the analysis over the whole body.
+ for _, stmt := range fn.Body {
+ do(stmt)
+ }
+
+ // Process accumulated info to find slice variables
+ // that we can allocate on the stack.
+ for _, s := range fn.Dcl {
+ if s.Opt == nil {
+ continue
+ }
+ i := s.Opt.(*sliceInfo)
+ s.Opt = nil
+ if i.okUses != i.allUses {
+ // Some use of i.s that don't understand lurks. Give up.
+ continue
+ }
+
+ // At this point, we've decided that we *can* do
+ // the optimization.
+
+ if i.transition == nil {
+ // Exclusive for its whole lifetime. That means it
+ // didn't escape. We can already handle nonescaping
+ // slices without this pass.
+ continue
+ }
+ if i.appendWeight < 2 {
+ // This optimization only really helps if there is
+ // (dynamically) more than one append.
+ continue
+ }
+
+ // Commit point - at this point we've decided we *should*
+ // do the optimization.
+
+ // Insert a move2heap operation before the exclusive->nonexclusive
+ // transition.
+ move := ir.NewMoveToHeapExpr(i.transition.Pos(), i.s)
+ if i.capUsed {
+ move.PreserveCapacity = true
+ }
+ move.RType = reflectdata.AppendElemRType(i.transition.Pos(), i.appends[0])
+ move.SetType(i.s.Type())
+ move.SetTypecheck(1)
+ as := ir.NewAssignStmt(i.transition.Pos(), i.s, move)
+ as.SetTypecheck(1)
+ i.transition.PtrInit().Prepend(as)
+ // Note: we prepend because we need to put the move2heap
+ // operation first, before any other init work, as the transition
+ // might occur in the init work.
+
+ // Now that we've inserted a move2heap operation before every
+ // exclusive -> nonexclusive transition, appends can now use
+ // stack backing stores.
+ // (This is the whole point of this pass, to enable stack
+ // allocation of append backing stores.)
+ for _, a := range i.appends {
+ a.SetEsc(ir.EscNone)
+ if i.capUsed {
+ a.UseBuf = true
+ }
+ }
+ }
+}
+
+// argLeak reports if the idx'th argument to the call n escapes anywhere
+// (to the heap, another argument, return value, etc.)
+// If unknown returns true.
+func argLeak(n *ir.CallExpr, idx int) bool {
+ if n.Op() != ir.OCALLFUNC {
+ return true
+ }
+ fn := ir.StaticCalleeName(ir.StaticValue(n.Fun))
+ if fn == nil {
+ return true
+ }
+ fntype := fn.Type()
+ if recv := fntype.Recv(); recv != nil {
+ if idx == 0 {
+ return escape.ParseLeaks(recv.Note).Any()
+ }
+ idx--
+ }
+ return escape.ParseLeaks(fntype.Params()[idx].Note).Any()
+}
diff --git a/src/cmd/compile/internal/ssa/_gen/AMD64Ops.go b/src/cmd/compile/internal/ssa/_gen/AMD64Ops.go
index 1e9eb0146e..e77f55ab5e 100644
--- a/src/cmd/compile/internal/ssa/_gen/AMD64Ops.go
+++ b/src/cmd/compile/internal/ssa/_gen/AMD64Ops.go
@@ -156,6 +156,7 @@ func init() {
gp11sb = regInfo{inputs: []regMask{gpspsbg}, outputs: gponly}
gp21 = regInfo{inputs: []regMask{gp, gp}, outputs: gponly}
gp21sp = regInfo{inputs: []regMask{gpsp, gp}, outputs: gponly}
+ gp21sp2 = regInfo{inputs: []regMask{gp, gpsp}, outputs: gponly}
gp21sb = regInfo{inputs: []regMask{gpspsbg, gpsp}, outputs: gponly}
gp21shift = regInfo{inputs: []regMask{gp, cx}, outputs: []regMask{gp}}
gp31shift = regInfo{inputs: []regMask{gp, gp, cx}, outputs: []regMask{gp}}
@@ -361,7 +362,7 @@ func init() {
{name: "ADDQconstmodify", argLength: 2, reg: gpstoreconst, asm: "ADDQ", aux: "SymValAndOff", clobberFlags: true, faultOnNilArg0: true, symEffect: "Read,Write"},
{name: "ADDLconstmodify", argLength: 2, reg: gpstoreconst, asm: "ADDL", aux: "SymValAndOff", clobberFlags: true, faultOnNilArg0: true, symEffect: "Read,Write"},
- {name: "SUBQ", argLength: 2, reg: gp21, asm: "SUBQ", resultInArg0: true, clobberFlags: true},
+ {name: "SUBQ", argLength: 2, reg: gp21sp2, asm: "SUBQ", resultInArg0: true, clobberFlags: true},
{name: "SUBL", argLength: 2, reg: gp21, asm: "SUBL", resultInArg0: true, clobberFlags: true},
{name: "SUBQconst", argLength: 1, reg: gp11, asm: "SUBQ", aux: "Int32", resultInArg0: true, clobberFlags: true},
{name: "SUBLconst", argLength: 1, reg: gp11, asm: "SUBL", aux: "Int32", resultInArg0: true, clobberFlags: true},
diff --git a/src/cmd/compile/internal/ssa/_gen/ARM64.rules b/src/cmd/compile/internal/ssa/_gen/ARM64.rules
index f54a692725..53bb35d289 100644
--- a/src/cmd/compile/internal/ssa/_gen/ARM64.rules
+++ b/src/cmd/compile/internal/ssa/_gen/ARM64.rules
@@ -573,6 +573,8 @@
(TBNZ [0] (GreaterThanF cc) yes no) => (FGT cc yes no)
(TBNZ [0] (GreaterEqualF cc) yes no) => (FGE cc yes no)
+(TB(Z|NZ) [0] (XORconst [1] x) yes no) => (TB(NZ|Z) [0] x yes no)
+
((EQ|NE|LT|LE|GT|GE) (CMPconst [0] z:(AND x y)) yes no) && z.Uses == 1 => ((EQ|NE|LT|LE|GT|GE) (TST x y) yes no)
((EQ|NE|LT|LE|GT|GE) (CMPconst [0] x:(ANDconst [c] y)) yes no) && x.Uses == 1 => ((EQ|NE|LT|LE|GT|GE) (TSTconst [c] y) yes no)
((EQ|NE|LT|LE|GT|GE) (CMPWconst [0] z:(AND x y)) yes no) && z.Uses == 1 => ((EQ|NE|LT|LE|GT|GE) (TSTW x y) yes no)
@@ -1814,3 +1816,7 @@
(Select0 (Mul64uover x y)) => (MUL x y)
(Select1 (Mul64uover x y)) => (NotEqual (CMPconst (UMULH <typ.UInt64> x y) [0]))
+
+// 32 mul 32 -> 64
+(MUL r:(MOVWUreg x) s:(MOVWUreg y)) && r.Uses == 1 && s.Uses == 1 => (UMULL x y)
+(MUL r:(MOVWreg x) s:(MOVWreg y)) && r.Uses == 1 && s.Uses == 1 => (MULL x y)
diff --git a/src/cmd/compile/internal/ssa/_gen/LOONG64.rules b/src/cmd/compile/internal/ssa/_gen/LOONG64.rules
index 9691296043..2beba0b1c5 100644
--- a/src/cmd/compile/internal/ssa/_gen/LOONG64.rules
+++ b/src/cmd/compile/internal/ssa/_gen/LOONG64.rules
@@ -743,9 +743,6 @@
(MULV x (MOVVconst [c])) && canMulStrengthReduce(config, c) => {mulStrengthReduce(v, x, c)}
-(MULV (NEGV x) (MOVVconst [c])) => (MULV x (MOVVconst [-c]))
-(MULV (NEGV x) (NEGV y)) => (MULV x y)
-
(ADDV x0 x1:(SLLVconst [c] y)) && x1.Uses == 1 && c > 0 && c <= 4 => (ADDshiftLLV x0 y [c])
// fold constant in ADDshift op
diff --git a/src/cmd/compile/internal/ssa/_gen/LOONG64Ops.go b/src/cmd/compile/internal/ssa/_gen/LOONG64Ops.go
index 7e8b8bf497..81d3a3665b 100644
--- a/src/cmd/compile/internal/ssa/_gen/LOONG64Ops.go
+++ b/src/cmd/compile/internal/ssa/_gen/LOONG64Ops.go
@@ -388,6 +388,7 @@ func init() {
argLength: 2,
reg: regInfo{
inputs: []regMask{gp},
+ clobbers: buildReg("F31"),
clobbersArg0: true,
},
faultOnNilArg0: true,
diff --git a/src/cmd/compile/internal/ssa/_gen/RISCV64.rules b/src/cmd/compile/internal/ssa/_gen/RISCV64.rules
index 646948f2df..13a8cab3b5 100644
--- a/src/cmd/compile/internal/ssa/_gen/RISCV64.rules
+++ b/src/cmd/compile/internal/ssa/_gen/RISCV64.rules
@@ -689,36 +689,36 @@
(MOVDnop (MOVDconst [c])) => (MOVDconst [c])
// Avoid unnecessary zero and sign extension when right shifting.
-(SRAI <t> [x] (MOVWreg y)) && x >= 0 && x <= 31 => (SRAIW <t> [int64(x)] y)
-(SRLI <t> [x] (MOVWUreg y)) && x >= 0 && x <= 31 => (SRLIW <t> [int64(x)] y)
+(SRAI [x] (MOVWreg y)) && x >= 0 && x <= 31 => (SRAIW [x] y)
+(SRLI [x] (MOVWUreg y)) && x >= 0 && x <= 31 => (SRLIW [x] y)
// Replace right shifts that exceed size of signed type.
(SRAI <t> [x] (MOVBreg y)) && x >= 8 => (SRAI [63] (SLLI <t> [56] y))
(SRAI <t> [x] (MOVHreg y)) && x >= 16 => (SRAI [63] (SLLI <t> [48] y))
-(SRAI <t> [x] (MOVWreg y)) && x >= 32 => (SRAIW [31] y)
+(SRAI [x] (MOVWreg y)) && x >= 32 => (SRAIW [31] y)
// Eliminate right shifts that exceed size of unsigned type.
-(SRLI <t> [x] (MOVBUreg y)) && x >= 8 => (MOVDconst <t> [0])
-(SRLI <t> [x] (MOVHUreg y)) && x >= 16 => (MOVDconst <t> [0])
-(SRLI <t> [x] (MOVWUreg y)) && x >= 32 => (MOVDconst <t> [0])
+(SRLI [x] (MOVBUreg y)) && x >= 8 => (MOVDconst [0])
+(SRLI [x] (MOVHUreg y)) && x >= 16 => (MOVDconst [0])
+(SRLI [x] (MOVWUreg y)) && x >= 32 => (MOVDconst [0])
// Fold constant into immediate instructions where possible.
(ADD (MOVDconst <t> [val]) x) && is32Bit(val) && !t.IsPtr() => (ADDI [val] x)
(AND (MOVDconst [val]) x) && is32Bit(val) => (ANDI [val] x)
(OR (MOVDconst [val]) x) && is32Bit(val) => (ORI [val] x)
(XOR (MOVDconst [val]) x) && is32Bit(val) => (XORI [val] x)
-(ROL x (MOVDconst [val])) => (RORI [int64(int8(-val)&63)] x)
-(ROLW x (MOVDconst [val])) => (RORIW [int64(int8(-val)&31)] x)
-(ROR x (MOVDconst [val])) => (RORI [int64(val&63)] x)
-(RORW x (MOVDconst [val])) => (RORIW [int64(val&31)] x)
-(SLL x (MOVDconst [val])) => (SLLI [int64(val&63)] x)
-(SRL x (MOVDconst [val])) => (SRLI [int64(val&63)] x)
-(SLLW x (MOVDconst [val])) => (SLLIW [int64(val&31)] x)
-(SRLW x (MOVDconst [val])) => (SRLIW [int64(val&31)] x)
-(SRA x (MOVDconst [val])) => (SRAI [int64(val&63)] x)
-(SRAW x (MOVDconst [val])) => (SRAIW [int64(val&31)] x)
-(SLT x (MOVDconst [val])) && val >= -2048 && val <= 2047 => (SLTI [val] x)
-(SLTU x (MOVDconst [val])) && val >= -2048 && val <= 2047 => (SLTIU [val] x)
+(ROL x (MOVDconst [val])) => (RORI [-val&63] x)
+(ROLW x (MOVDconst [val])) => (RORIW [-val&31] x)
+(ROR x (MOVDconst [val])) => (RORI [val&63] x)
+(RORW x (MOVDconst [val])) => (RORIW [val&31] x)
+(SLL x (MOVDconst [val])) => (SLLI [val&63] x)
+(SLLW x (MOVDconst [val])) => (SLLIW [val&31] x)
+(SRL x (MOVDconst [val])) => (SRLI [val&63] x)
+(SRLW x (MOVDconst [val])) => (SRLIW [val&31] x)
+(SRA x (MOVDconst [val])) => (SRAI [val&63] x)
+(SRAW x (MOVDconst [val])) => (SRAIW [val&31] x)
+(SLT x (MOVDconst [val])) && is12Bit(val) => (SLTI [val] x)
+(SLTU x (MOVDconst [val])) && is12Bit(val) => (SLTIU [val] x)
// Replace negated left rotation with right rotation.
(ROL x (NEG y)) => (ROR x y)
@@ -782,7 +782,7 @@
(SRAI [x] (MOVDconst [y])) => (MOVDconst [int64(y) >> uint32(x)])
// Combine doubling via addition with shift.
-(SLLI <t> [c] (ADD x x)) && c < t.Size() * 8 - 1 => (SLLI <t> [c+1] x)
+(SLLI <t> [c] (ADD x x)) && c < t.Size() * 8 - 1 => (SLLI [c+1] x)
(SLLI <t> [c] (ADD x x)) && c >= t.Size() * 8 - 1 => (MOVDconst [0])
// SLTI/SLTIU with constants.
@@ -792,7 +792,6 @@
// SLTI/SLTIU with known outcomes.
(SLTI [x] (ANDI [y] _)) && y >= 0 && int64(y) < int64(x) => (MOVDconst [1])
(SLTIU [x] (ANDI [y] _)) && y >= 0 && uint64(y) < uint64(x) => (MOVDconst [1])
-(SLTI [x] (ORI [y] _)) && y >= 0 && int64(y) >= int64(x) => (MOVDconst [0])
(SLTIU [x] (ORI [y] _)) && y >= 0 && uint64(y) >= uint64(x) => (MOVDconst [0])
// SLT/SLTU with known outcomes.
diff --git a/src/cmd/compile/internal/ssa/_gen/dec.rules b/src/cmd/compile/internal/ssa/_gen/dec.rules
index 9f6dc36975..fce0026211 100644
--- a/src/cmd/compile/internal/ssa/_gen/dec.rules
+++ b/src/cmd/compile/internal/ssa/_gen/dec.rules
@@ -97,8 +97,10 @@
// Helpers for expand calls
// Some of these are copied from generic.rules
-(IMake _typ (StructMake val)) => (IMake _typ val)
-(StructSelect [0] (IData x)) => (IData x)
+(IMake _typ (StructMake ___)) => imakeOfStructMake(v)
+(StructSelect (IData x)) && v.Type.Size() > 0 => (IData x)
+(StructSelect (IData x)) && v.Type.Size() == 0 && v.Type.IsStruct() => (StructMake)
+(StructSelect (IData x)) && v.Type.Size() == 0 && v.Type.IsArray() => (ArrayMake0)
(StructSelect [i] x:(StructMake ___)) => x.Args[i]
@@ -109,7 +111,7 @@
// More annoying case: (ArraySelect[0] (StructSelect[0] isAPtr))
// There, result of the StructSelect is an Array (not a pointer) and
// the pre-rewrite input to the ArraySelect is a struct, not a pointer.
-(StructSelect [0] x) && x.Type.IsPtrShaped() => x
+(StructSelect x) && x.Type.IsPtrShaped() => x
(ArraySelect [0] x) && x.Type.IsPtrShaped() => x
// These, too. Bits is bits.
@@ -119,6 +121,7 @@
(Store _ (StructMake ___) _) => rewriteStructStore(v)
+(IMake _typ (ArrayMake1 val)) => (IMake _typ val)
(ArraySelect (ArrayMake1 x)) => x
(ArraySelect [0] (IData x)) => (IData x)
diff --git a/src/cmd/compile/internal/ssa/_gen/generic.rules b/src/cmd/compile/internal/ssa/_gen/generic.rules
index ccdf0bf50d..6a213cd03a 100644
--- a/src/cmd/compile/internal/ssa/_gen/generic.rules
+++ b/src/cmd/compile/internal/ssa/_gen/generic.rules
@@ -195,6 +195,11 @@
// Convert x * -1 to -x.
(Mul(8|16|32|64) (Const(8|16|32|64) [-1]) x) => (Neg(8|16|32|64) x)
+// Convert -x * c to x * -c
+(Mul(8|16|32|64) (Const(8|16|32|64) <t> [c]) (Neg(8|16|32|64) x)) => (Mul(8|16|32|64) x (Const(8|16|32|64) <t> [-c]))
+
+(Mul(8|16|32|64) (Neg(8|16|32|64) x) (Neg(8|16|32|64) y)) => (Mul(8|16|32|64) x y)
+
// DeMorgan's Laws
(And(8|16|32|64) <t> (Com(8|16|32|64) x) (Com(8|16|32|64) y)) => (Com(8|16|32|64) (Or(8|16|32|64) <t> x y))
(Or(8|16|32|64) <t> (Com(8|16|32|64) x) (Com(8|16|32|64) y)) => (Com(8|16|32|64) (And(8|16|32|64) <t> x y))
@@ -337,6 +342,12 @@
(OrB ((Less|Leq)16U (Const16 [c]) x) (Leq16U x (Const16 [d]))) && uint16(c) >= uint16(d+1) && uint16(d+1) > uint16(d) => ((Less|Leq)16U (Const16 <x.Type> [c-d-1]) (Sub16 <x.Type> x (Const16 <x.Type> [d+1])))
(OrB ((Less|Leq)8U (Const8 [c]) x) (Leq8U x (Const8 [d]))) && uint8(c) >= uint8(d+1) && uint8(d+1) > uint8(d) => ((Less|Leq)8U (Const8 <x.Type> [c-d-1]) (Sub8 <x.Type> x (Const8 <x.Type> [d+1])))
+// single bit difference: ( x != c && x != d ) -> ( x|(c^d) != c )
+(AndB (Neq(64|32|16|8) x cv:(Const(64|32|16|8) [c])) (Neq(64|32|16|8) x (Const(64|32|16|8) [d]))) && c|d == c && oneBit(c^d) => (Neq(64|32|16|8) (Or(64|32|16|8) <x.Type> x (Const(64|32|16|8) <x.Type> [c^d])) cv)
+
+// single bit difference: ( x == c || x == d ) -> ( x|(c^d) == c )
+(OrB (Eq(64|32|16|8) x cv:(Const(64|32|16|8) [c])) (Eq(64|32|16|8) x (Const(64|32|16|8) [d]))) && c|d == c && oneBit(c^d) => (Eq(64|32|16|8) (Or(64|32|16|8) <x.Type> x (Const(64|32|16|8) <x.Type> [c^d])) cv)
+
// NaN check: ( x != x || x (>|>=|<|<=) c ) -> ( !(c (>=|>|<=|<) x) )
(OrB (Neq64F x x) ((Less|Leq)64F x y:(Const64F [c]))) => (Not ((Leq|Less)64F y x))
(OrB (Neq64F x x) ((Less|Leq)64F y:(Const64F [c]) x)) => (Not ((Leq|Less)64F x y))
@@ -933,8 +944,10 @@
@x.Block (Load <v.Type> (OffPtr <v.Type.PtrTo()> [t.FieldOff(int(i))] ptr) mem)
// Putting struct{*byte} and similar into direct interfaces.
-(IMake _typ (StructMake val)) => (IMake _typ val)
-(StructSelect [0] (IData x)) => (IData x)
+(IMake _typ (StructMake ___)) => imakeOfStructMake(v)
+(StructSelect (IData x)) && v.Type.Size() > 0 => (IData x)
+(StructSelect (IData x)) && v.Type.Size() == 0 && v.Type.IsStruct() => (StructMake)
+(StructSelect (IData x)) && v.Type.Size() == 0 && v.Type.IsArray() => (ArrayMake0)
// un-SSAable values use mem->mem copies
(Store {t} dst (Load src mem) mem) && !CanSSA(t) =>
@@ -2222,4 +2235,4 @@
(Neq(64|32|16) (SignExt8to(64|32|16) (CvtBoolToUint8 x)) (Const(64|32|16) [0])) => x
(Neq(64|32|16) (SignExt8to(64|32|16) (CvtBoolToUint8 x)) (Const(64|32|16) [1])) => (Not x)
(Eq(64|32|16) (SignExt8to(64|32|16) (CvtBoolToUint8 x)) (Const(64|32|16) [1])) => x
-(Eq(64|32|16) (SignExt8to(64|32|16) (CvtBoolToUint8 x)) (Const(64|32|16) [0])) => (Not x) \ No newline at end of file
+(Eq(64|32|16) (SignExt8to(64|32|16) (CvtBoolToUint8 x)) (Const(64|32|16) [0])) => (Not x)
diff --git a/src/cmd/compile/internal/ssa/expand_calls.go b/src/cmd/compile/internal/ssa/expand_calls.go
index c1726b2797..1a2985d5af 100644
--- a/src/cmd/compile/internal/ssa/expand_calls.go
+++ b/src/cmd/compile/internal/ssa/expand_calls.go
@@ -426,7 +426,14 @@ func (x *expandState) decomposeAsNecessary(pos src.XPos, b *Block, a, m0 *Value,
if a.Op == OpIMake {
data := a.Args[1]
for data.Op == OpStructMake || data.Op == OpArrayMake1 {
- data = data.Args[0]
+ // A struct make might have a few zero-sized fields.
+ // Use the pointer-y one we know is there.
+ for _, a := range data.Args {
+ if a.Type.Size() > 0 {
+ data = a
+ break
+ }
+ }
}
return x.decomposeAsNecessary(pos, b, data, mem, rc.next(data.Type))
}
diff --git a/src/cmd/compile/internal/ssa/fuse.go b/src/cmd/compile/internal/ssa/fuse.go
index 0cee91b532..e95064c1df 100644
--- a/src/cmd/compile/internal/ssa/fuse.go
+++ b/src/cmd/compile/internal/ssa/fuse.go
@@ -10,7 +10,9 @@ import (
)
// fuseEarly runs fuse(f, fuseTypePlain|fuseTypeIntInRange|fuseTypeNanCheck).
-func fuseEarly(f *Func) { fuse(f, fuseTypePlain|fuseTypeIntInRange|fuseTypeNanCheck) }
+func fuseEarly(f *Func) {
+ fuse(f, fuseTypePlain|fuseTypeIntInRange|fuseTypeSingleBitDifference|fuseTypeNanCheck)
+}
// fuseLate runs fuse(f, fuseTypePlain|fuseTypeIf|fuseTypeBranchRedirect).
func fuseLate(f *Func) { fuse(f, fuseTypePlain|fuseTypeIf|fuseTypeBranchRedirect) }
@@ -21,6 +23,7 @@ const (
fuseTypePlain fuseType = 1 << iota
fuseTypeIf
fuseTypeIntInRange
+ fuseTypeSingleBitDifference
fuseTypeNanCheck
fuseTypeBranchRedirect
fuseTypeShortCircuit
@@ -41,6 +44,9 @@ func fuse(f *Func, typ fuseType) {
if typ&fuseTypeIntInRange != 0 {
changed = fuseIntInRange(b) || changed
}
+ if typ&fuseTypeSingleBitDifference != 0 {
+ changed = fuseSingleBitDifference(b) || changed
+ }
if typ&fuseTypeNanCheck != 0 {
changed = fuseNanCheck(b) || changed
}
diff --git a/src/cmd/compile/internal/ssa/fuse_comparisons.go b/src/cmd/compile/internal/ssa/fuse_comparisons.go
index b6eb8fcb90..898c034485 100644
--- a/src/cmd/compile/internal/ssa/fuse_comparisons.go
+++ b/src/cmd/compile/internal/ssa/fuse_comparisons.go
@@ -19,6 +19,14 @@ func fuseNanCheck(b *Block) bool {
return fuseComparisons(b, canOptNanCheck)
}
+// fuseSingleBitDifference replaces the short-circuit operators between equality checks with
+// constants that only differ by a single bit. For example, it would convert
+// `if x == 4 || x == 6 { ... }` into `if (x == 4) | (x == 6) { ... }`. Rewrite rules can
+// then optimize these using a bitwise operation, in this case generating `if x|2 == 6 { ... }`.
+func fuseSingleBitDifference(b *Block) bool {
+ return fuseComparisons(b, canOptSingleBitDifference)
+}
+
// fuseComparisons looks for control graphs that match this pattern:
//
// p - predecessor
@@ -229,3 +237,40 @@ func canOptNanCheck(x, y *Value, op Op) bool {
}
return false
}
+
+// canOptSingleBitDifference returns true if x op y matches either:
+//
+// v == c || v == d
+// v != c && v != d
+//
+// Where c and d are constant values that differ by a single bit.
+func canOptSingleBitDifference(x, y *Value, op Op) bool {
+ if x.Op != y.Op {
+ return false
+ }
+ switch x.Op {
+ case OpEq64, OpEq32, OpEq16, OpEq8:
+ if op != OpOrB {
+ return false
+ }
+ case OpNeq64, OpNeq32, OpNeq16, OpNeq8:
+ if op != OpAndB {
+ return false
+ }
+ default:
+ return false
+ }
+
+ xi := getConstIntArgIndex(x)
+ if xi < 0 {
+ return false
+ }
+ yi := getConstIntArgIndex(y)
+ if yi < 0 {
+ return false
+ }
+ if x.Args[xi^1] != y.Args[yi^1] {
+ return false
+ }
+ return oneBit(x.Args[xi].AuxInt ^ y.Args[yi].AuxInt)
+}
diff --git a/src/cmd/compile/internal/ssa/opGen.go b/src/cmd/compile/internal/ssa/opGen.go
index 9c5d79fa56..ea5491362f 100644
--- a/src/cmd/compile/internal/ssa/opGen.go
+++ b/src/cmd/compile/internal/ssa/opGen.go
@@ -11481,7 +11481,7 @@ var opcodeTable = [...]opInfo{
reg: regInfo{
inputs: []inputInfo{
{0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
- {1, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
+ {1, 49151}, // AX CX DX BX SP BP SI DI R8 R9 R10 R11 R12 R13 R15
},
outputs: []outputInfo{
{0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
@@ -68770,6 +68770,7 @@ var opcodeTable = [...]opInfo{
inputs: []inputInfo{
{0, 1071644664}, // R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19 R20 R21 R23 R24 R25 R26 R27 R28 R29 R31
},
+ clobbers: 2305843009213693952, // F31
clobbersArg0: true,
},
},
diff --git a/src/cmd/compile/internal/ssa/prove.go b/src/cmd/compile/internal/ssa/prove.go
index 4919d6ad37..d4e7ed14b1 100644
--- a/src/cmd/compile/internal/ssa/prove.go
+++ b/src/cmd/compile/internal/ssa/prove.go
@@ -466,57 +466,56 @@ func (ft *factsTable) initLimitForNewValue(v *Value) {
// signedMin records the fact that we know v is at least
// min in the signed domain.
-func (ft *factsTable) signedMin(v *Value, min int64) bool {
- return ft.newLimit(v, limit{min: min, max: math.MaxInt64, umin: 0, umax: math.MaxUint64})
+func (ft *factsTable) signedMin(v *Value, min int64) {
+ ft.newLimit(v, limit{min: min, max: math.MaxInt64, umin: 0, umax: math.MaxUint64})
}
// signedMax records the fact that we know v is at most
// max in the signed domain.
-func (ft *factsTable) signedMax(v *Value, max int64) bool {
- return ft.newLimit(v, limit{min: math.MinInt64, max: max, umin: 0, umax: math.MaxUint64})
+func (ft *factsTable) signedMax(v *Value, max int64) {
+ ft.newLimit(v, limit{min: math.MinInt64, max: max, umin: 0, umax: math.MaxUint64})
}
-func (ft *factsTable) signedMinMax(v *Value, min, max int64) bool {
- return ft.newLimit(v, limit{min: min, max: max, umin: 0, umax: math.MaxUint64})
+func (ft *factsTable) signedMinMax(v *Value, min, max int64) {
+ ft.newLimit(v, limit{min: min, max: max, umin: 0, umax: math.MaxUint64})
}
// setNonNegative records the fact that v is known to be non-negative.
-func (ft *factsTable) setNonNegative(v *Value) bool {
- return ft.signedMin(v, 0)
+func (ft *factsTable) setNonNegative(v *Value) {
+ ft.signedMin(v, 0)
}
// unsignedMin records the fact that we know v is at least
// min in the unsigned domain.
-func (ft *factsTable) unsignedMin(v *Value, min uint64) bool {
- return ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: min, umax: math.MaxUint64})
+func (ft *factsTable) unsignedMin(v *Value, min uint64) {
+ ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: min, umax: math.MaxUint64})
}
// unsignedMax records the fact that we know v is at most
// max in the unsigned domain.
-func (ft *factsTable) unsignedMax(v *Value, max uint64) bool {
- return ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: 0, umax: max})
+func (ft *factsTable) unsignedMax(v *Value, max uint64) {
+ ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: 0, umax: max})
}
-func (ft *factsTable) unsignedMinMax(v *Value, min, max uint64) bool {
- return ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: min, umax: max})
+func (ft *factsTable) unsignedMinMax(v *Value, min, max uint64) {
+ ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: min, umax: max})
}
-func (ft *factsTable) booleanFalse(v *Value) bool {
- return ft.newLimit(v, limit{min: 0, max: 0, umin: 0, umax: 0})
+func (ft *factsTable) booleanFalse(v *Value) {
+ ft.newLimit(v, limit{min: 0, max: 0, umin: 0, umax: 0})
}
-func (ft *factsTable) booleanTrue(v *Value) bool {
- return ft.newLimit(v, limit{min: 1, max: 1, umin: 1, umax: 1})
+func (ft *factsTable) booleanTrue(v *Value) {
+ ft.newLimit(v, limit{min: 1, max: 1, umin: 1, umax: 1})
}
-func (ft *factsTable) pointerNil(v *Value) bool {
- return ft.newLimit(v, limit{min: 0, max: 0, umin: 0, umax: 0})
+func (ft *factsTable) pointerNil(v *Value) {
+ ft.newLimit(v, limit{min: 0, max: 0, umin: 0, umax: 0})
}
-func (ft *factsTable) pointerNonNil(v *Value) bool {
+func (ft *factsTable) pointerNonNil(v *Value) {
l := noLimit
l.umin = 1
- return ft.newLimit(v, l)
+ ft.newLimit(v, l)
}
// newLimit adds new limiting information for v.
-// Returns true if the new limit added any new information.
-func (ft *factsTable) newLimit(v *Value, newLim limit) bool {
+func (ft *factsTable) newLimit(v *Value, newLim limit) {
oldLim := ft.limits[v.ID]
// Merge old and new information.
@@ -531,13 +530,12 @@ func (ft *factsTable) newLimit(v *Value, newLim limit) bool {
}
if lim == oldLim {
- return false // nothing new to record
+ return // nothing new to record
}
if lim.unsat() {
- r := !ft.unsat
ft.unsat = true
- return r
+ return
}
// Check for recursion. This normally happens because in unsatisfiable
@@ -548,7 +546,7 @@ func (ft *factsTable) newLimit(v *Value, newLim limit) bool {
// the posets will not notice.
if ft.recurseCheck[v.ID] {
// This should only happen for unsatisfiable cases. TODO: check
- return false
+ return
}
ft.recurseCheck[v.ID] = true
defer func() {
@@ -713,8 +711,6 @@ func (ft *factsTable) newLimit(v *Value, newLim limit) bool {
}
}
}
-
- return true
}
func (ft *factsTable) addOrdering(v, w *Value, d domain, r relation) {
@@ -1825,7 +1821,7 @@ func initLimit(v *Value) limit {
return lim
}
-// flowLimit updates the known limits of v in ft. Returns true if anything changed.
+// flowLimit updates the known limits of v in ft.
// flowLimit can use the ranges of input arguments.
//
// Note: this calculation only happens at the point the value is defined. We do not reevaluate
@@ -1838,10 +1834,10 @@ func initLimit(v *Value) limit {
// block. We could recompute the range of v once we enter the block so
// we know that it is 0 <= v <= 8, but we don't have a mechanism to do
// that right now.
-func (ft *factsTable) flowLimit(v *Value) bool {
+func (ft *factsTable) flowLimit(v *Value) {
if !v.Type.IsInteger() {
// TODO: boolean?
- return false
+ return
}
// Additional limits based on opcode and argument.
@@ -1851,36 +1847,36 @@ func (ft *factsTable) flowLimit(v *Value) bool {
// extensions
case OpZeroExt8to64, OpZeroExt8to32, OpZeroExt8to16, OpZeroExt16to64, OpZeroExt16to32, OpZeroExt32to64:
a := ft.limits[v.Args[0].ID]
- return ft.unsignedMinMax(v, a.umin, a.umax)
+ ft.unsignedMinMax(v, a.umin, a.umax)
case OpSignExt8to64, OpSignExt8to32, OpSignExt8to16, OpSignExt16to64, OpSignExt16to32, OpSignExt32to64:
a := ft.limits[v.Args[0].ID]
- return ft.signedMinMax(v, a.min, a.max)
+ ft.signedMinMax(v, a.min, a.max)
case OpTrunc64to8, OpTrunc64to16, OpTrunc64to32, OpTrunc32to8, OpTrunc32to16, OpTrunc16to8:
a := ft.limits[v.Args[0].ID]
if a.umax <= 1<<(uint64(v.Type.Size())*8)-1 {
- return ft.unsignedMinMax(v, a.umin, a.umax)
+ ft.unsignedMinMax(v, a.umin, a.umax)
}
// math/bits
case OpCtz64:
a := ft.limits[v.Args[0].ID]
if a.nonzero() {
- return ft.unsignedMax(v, uint64(bits.Len64(a.umax)-1))
+ ft.unsignedMax(v, uint64(bits.Len64(a.umax)-1))
}
case OpCtz32:
a := ft.limits[v.Args[0].ID]
if a.nonzero() {
- return ft.unsignedMax(v, uint64(bits.Len32(uint32(a.umax))-1))
+ ft.unsignedMax(v, uint64(bits.Len32(uint32(a.umax))-1))
}
case OpCtz16:
a := ft.limits[v.Args[0].ID]
if a.nonzero() {
- return ft.unsignedMax(v, uint64(bits.Len16(uint16(a.umax))-1))
+ ft.unsignedMax(v, uint64(bits.Len16(uint16(a.umax))-1))
}
case OpCtz8:
a := ft.limits[v.Args[0].ID]
if a.nonzero() {
- return ft.unsignedMax(v, uint64(bits.Len8(uint8(a.umax))-1))
+ ft.unsignedMax(v, uint64(bits.Len8(uint8(a.umax))-1))
}
case OpPopCount64, OpPopCount32, OpPopCount16, OpPopCount8:
@@ -1889,26 +1885,26 @@ func (ft *factsTable) flowLimit(v *Value) bool {
sharedLeadingMask := ^(uint64(1)<<changingBitsCount - 1)
fixedBits := a.umax & sharedLeadingMask
min := uint64(bits.OnesCount64(fixedBits))
- return ft.unsignedMinMax(v, min, min+changingBitsCount)
+ ft.unsignedMinMax(v, min, min+changingBitsCount)
case OpBitLen64:
a := ft.limits[v.Args[0].ID]
- return ft.unsignedMinMax(v,
+ ft.unsignedMinMax(v,
uint64(bits.Len64(a.umin)),
uint64(bits.Len64(a.umax)))
case OpBitLen32:
a := ft.limits[v.Args[0].ID]
- return ft.unsignedMinMax(v,
+ ft.unsignedMinMax(v,
uint64(bits.Len32(uint32(a.umin))),
uint64(bits.Len32(uint32(a.umax))))
case OpBitLen16:
a := ft.limits[v.Args[0].ID]
- return ft.unsignedMinMax(v,
+ ft.unsignedMinMax(v,
uint64(bits.Len16(uint16(a.umin))),
uint64(bits.Len16(uint16(a.umax))))
case OpBitLen8:
a := ft.limits[v.Args[0].ID]
- return ft.unsignedMinMax(v,
+ ft.unsignedMinMax(v,
uint64(bits.Len8(uint8(a.umin))),
uint64(bits.Len8(uint8(a.umax))))
@@ -1921,43 +1917,43 @@ func (ft *factsTable) flowLimit(v *Value) bool {
// AND can only make the value smaller.
a := ft.limits[v.Args[0].ID]
b := ft.limits[v.Args[1].ID]
- return ft.unsignedMax(v, min(a.umax, b.umax))
+ ft.unsignedMax(v, min(a.umax, b.umax))
case OpOr64, OpOr32, OpOr16, OpOr8:
// OR can only make the value bigger and can't flip bits proved to be zero in both inputs.
a := ft.limits[v.Args[0].ID]
b := ft.limits[v.Args[1].ID]
- return ft.unsignedMinMax(v,
+ ft.unsignedMinMax(v,
max(a.umin, b.umin),
1<<bits.Len64(a.umax|b.umax)-1)
case OpXor64, OpXor32, OpXor16, OpXor8:
// XOR can't flip bits that are proved to be zero in both inputs.
a := ft.limits[v.Args[0].ID]
b := ft.limits[v.Args[1].ID]
- return ft.unsignedMax(v, 1<<bits.Len64(a.umax|b.umax)-1)
+ ft.unsignedMax(v, 1<<bits.Len64(a.umax|b.umax)-1)
case OpCom64, OpCom32, OpCom16, OpCom8:
a := ft.limits[v.Args[0].ID]
- return ft.newLimit(v, a.com(uint(v.Type.Size())*8))
+ ft.newLimit(v, a.com(uint(v.Type.Size())*8))
// Arithmetic.
case OpAdd64, OpAdd32, OpAdd16, OpAdd8:
a := ft.limits[v.Args[0].ID]
b := ft.limits[v.Args[1].ID]
- return ft.newLimit(v, a.add(b, uint(v.Type.Size())*8))
+ ft.newLimit(v, a.add(b, uint(v.Type.Size())*8))
case OpSub64, OpSub32, OpSub16, OpSub8:
a := ft.limits[v.Args[0].ID]
b := ft.limits[v.Args[1].ID]
- sub := ft.newLimit(v, a.sub(b, uint(v.Type.Size())*8))
- mod := ft.detectMod(v)
- inferred := ft.detectSliceLenRelation(v)
- return sub || mod || inferred
+ ft.newLimit(v, a.sub(b, uint(v.Type.Size())*8))
+ ft.detectMod(v)
+ ft.detectSliceLenRelation(v)
+ ft.detectSubRelations(v)
case OpNeg64, OpNeg32, OpNeg16, OpNeg8:
a := ft.limits[v.Args[0].ID]
bitsize := uint(v.Type.Size()) * 8
- return ft.newLimit(v, a.com(bitsize).add(limit{min: 1, max: 1, umin: 1, umax: 1}, bitsize))
+ ft.newLimit(v, a.com(bitsize).add(limit{min: 1, max: 1, umin: 1, umax: 1}, bitsize))
case OpMul64, OpMul32, OpMul16, OpMul8:
a := ft.limits[v.Args[0].ID]
b := ft.limits[v.Args[1].ID]
- return ft.newLimit(v, a.mul(b, uint(v.Type.Size())*8))
+ ft.newLimit(v, a.mul(b, uint(v.Type.Size())*8))
case OpLsh64x64, OpLsh64x32, OpLsh64x16, OpLsh64x8,
OpLsh32x64, OpLsh32x32, OpLsh32x16, OpLsh32x8,
OpLsh16x64, OpLsh16x32, OpLsh16x16, OpLsh16x8,
@@ -1965,7 +1961,7 @@ func (ft *factsTable) flowLimit(v *Value) bool {
a := ft.limits[v.Args[0].ID]
b := ft.limits[v.Args[1].ID]
bitsize := uint(v.Type.Size()) * 8
- return ft.newLimit(v, a.mul(b.exp2(bitsize), bitsize))
+ ft.newLimit(v, a.mul(b.exp2(bitsize), bitsize))
case OpRsh64x64, OpRsh64x32, OpRsh64x16, OpRsh64x8,
OpRsh32x64, OpRsh32x32, OpRsh32x16, OpRsh32x8,
OpRsh16x64, OpRsh16x32, OpRsh16x16, OpRsh16x8,
@@ -1979,7 +1975,7 @@ func (ft *factsTable) flowLimit(v *Value) bool {
// Easier to compute min and max of both than to write sign logic.
vmin := min(a.min>>b.min, a.min>>b.max)
vmax := max(a.max>>b.min, a.max>>b.max)
- return ft.signedMinMax(v, vmin, vmax)
+ ft.signedMinMax(v, vmin, vmax)
}
case OpRsh64Ux64, OpRsh64Ux32, OpRsh64Ux16, OpRsh64Ux8,
OpRsh32Ux64, OpRsh32Ux32, OpRsh32Ux16, OpRsh32Ux8,
@@ -1988,7 +1984,7 @@ func (ft *factsTable) flowLimit(v *Value) bool {
a := ft.limits[v.Args[0].ID]
b := ft.limits[v.Args[1].ID]
if b.min >= 0 {
- return ft.unsignedMinMax(v, a.umin>>b.max, a.umax>>b.min)
+ ft.unsignedMinMax(v, a.umin>>b.max, a.umax>>b.min)
}
case OpDiv64, OpDiv32, OpDiv16, OpDiv8:
a := ft.limits[v.Args[0].ID]
@@ -2008,11 +2004,11 @@ func (ft *factsTable) flowLimit(v *Value) bool {
if b.umin > 0 {
lim = lim.unsignedMax(a.umax / b.umin)
}
- return ft.newLimit(v, lim)
+ ft.newLimit(v, lim)
case OpMod64, OpMod32, OpMod16, OpMod8:
- return ft.modLimit(true, v, v.Args[0], v.Args[1])
+ ft.modLimit(true, v, v.Args[0], v.Args[1])
case OpMod64u, OpMod32u, OpMod16u, OpMod8u:
- return ft.modLimit(false, v, v.Args[0], v.Args[1])
+ ft.modLimit(false, v, v.Args[0], v.Args[1])
case OpPhi:
// Compute the union of all the input phis.
@@ -2032,9 +2028,8 @@ func (ft *factsTable) flowLimit(v *Value) bool {
l.umin = min(l.umin, l2.umin)
l.umax = max(l.umax, l2.umax)
}
- return ft.newLimit(v, l)
+ ft.newLimit(v, l)
}
- return false
}
// detectSliceLenRelation matches the pattern where
@@ -2047,13 +2042,13 @@ func (ft *factsTable) flowLimit(v *Value) bool {
//
// Note that "index" is not useed for indexing in this pattern, but
// in the motivating example (chunked slice iteration) it is.
-func (ft *factsTable) detectSliceLenRelation(v *Value) (inferred bool) {
+func (ft *factsTable) detectSliceLenRelation(v *Value) {
if v.Op != OpSub64 {
- return false
+ return
}
if !(v.Args[0].Op == OpSliceLen || v.Args[0].Op == OpSliceCap) {
- return false
+ return
}
slice := v.Args[0].Args[0]
@@ -2093,13 +2088,54 @@ func (ft *factsTable) detectSliceLenRelation(v *Value) (inferred bool) {
if K < 0 { // We hate thinking about overflow
continue
}
- inferred = inferred || ft.signedMin(v, K)
+ ft.signedMin(v, K)
+ }
+}
+
+// v must be Sub{64,32,16,8}.
+func (ft *factsTable) detectSubRelations(v *Value) {
+ // v = x-y
+ x := v.Args[0]
+ y := v.Args[1]
+ if x == y {
+ ft.signedMinMax(v, 0, 0)
+ return
+ }
+ xLim := ft.limits[x.ID]
+ yLim := ft.limits[y.ID]
+
+ // Check if we might wrap around. If so, give up.
+ width := uint(v.Type.Size()) * 8
+ if _, ok := safeSub(xLim.min, yLim.max, width); !ok {
+ return // x-y might underflow
+ }
+ if _, ok := safeSub(xLim.max, yLim.min, width); !ok {
+ return // x-y might overflow
+ }
+
+ // Subtracting a positive number only makes
+ // things smaller.
+ if yLim.min >= 0 {
+ ft.update(v.Block, v, x, signed, lt|eq)
+ // TODO: is this worth it?
+ //if yLim.min > 0 {
+ // ft.update(v.Block, v, x, signed, lt)
+ //}
+ }
+
+ // Subtracting a number from a bigger one
+ // can't go below 0.
+ if ft.orderS.OrderedOrEqual(y, x) {
+ ft.setNonNegative(v)
+ // TODO: is this worth it?
+ //if ft.orderS.Ordered(y, x) {
+ // ft.signedMin(v, 1)
+ //}
}
- return inferred
}
// x%d has been rewritten to x - (x/d)*d.
-func (ft *factsTable) detectMod(v *Value) bool {
+func (ft *factsTable) detectMod(v *Value) {
var opDiv, opDivU, opMul, opConst Op
switch v.Op {
case OpSub64:
@@ -2126,36 +2162,37 @@ func (ft *factsTable) detectMod(v *Value) bool {
mul := v.Args[1]
if mul.Op != opMul {
- return false
+ return
}
div, con := mul.Args[0], mul.Args[1]
if div.Op == opConst {
div, con = con, div
}
if con.Op != opConst || (div.Op != opDiv && div.Op != opDivU) || div.Args[0] != v.Args[0] || div.Args[1].Op != opConst || div.Args[1].AuxInt != con.AuxInt {
- return false
+ return
}
- return ft.modLimit(div.Op == opDiv, v, v.Args[0], con)
+ ft.modLimit(div.Op == opDiv, v, v.Args[0], con)
}
// modLimit sets v with facts derived from v = p % q.
-func (ft *factsTable) modLimit(signed bool, v, p, q *Value) bool {
+func (ft *factsTable) modLimit(signed bool, v, p, q *Value) {
a := ft.limits[p.ID]
b := ft.limits[q.ID]
if signed {
if a.min < 0 && b.min > 0 {
- return ft.signedMinMax(v, -(b.max - 1), b.max-1)
+ ft.signedMinMax(v, -(b.max - 1), b.max-1)
+ return
}
if !(a.nonnegative() && b.nonnegative()) {
// TODO: we could handle signed limits but I didn't bother.
- return false
+ return
}
if a.min >= 0 && b.min > 0 {
ft.setNonNegative(v)
}
}
// Underflow in the arithmetic below is ok, it gives to MaxUint64 which does nothing to the limit.
- return ft.unsignedMax(v, min(a.umax, b.umax-1))
+ ft.unsignedMax(v, min(a.umax, b.umax-1))
}
// getBranch returns the range restrictions added by p
@@ -2466,15 +2503,13 @@ func addLocalFacts(ft *factsTable, b *Block) {
xl := ft.limits[x.ID]
y := add.Args[1]
yl := ft.limits[y.ID]
- if unsignedAddOverflows(xl.umax, yl.umax, add.Type) {
- continue
- }
-
- if xl.umax < uminDivisor {
- ft.update(b, v, y, unsigned, lt|eq)
- }
- if yl.umax < uminDivisor {
- ft.update(b, v, x, unsigned, lt|eq)
+ if !unsignedAddOverflows(xl.umax, yl.umax, add.Type) {
+ if xl.umax < uminDivisor {
+ ft.update(b, v, y, unsigned, lt|eq)
+ }
+ if yl.umax < uminDivisor {
+ ft.update(b, v, x, unsigned, lt|eq)
+ }
}
}
ft.update(b, v, v.Args[0], unsigned, lt|eq)
@@ -2993,16 +3028,14 @@ func (ft *factsTable) topoSortValuesInBlock(b *Block) {
want := f.NumValues()
scores := ft.reusedTopoSortScoresTable
- if len(scores) < want {
- if want <= cap(scores) {
- scores = scores[:want]
- } else {
- if cap(scores) > 0 {
- f.Cache.freeUintSlice(scores)
- }
- scores = f.Cache.allocUintSlice(want)
- ft.reusedTopoSortScoresTable = scores
+ if want <= cap(scores) {
+ scores = scores[:want]
+ } else {
+ if cap(scores) > 0 {
+ f.Cache.freeUintSlice(scores)
}
+ scores = f.Cache.allocUintSlice(want)
+ ft.reusedTopoSortScoresTable = scores
}
for _, v := range b.Values {
diff --git a/src/cmd/compile/internal/ssa/regalloc.go b/src/cmd/compile/internal/ssa/regalloc.go
index 4d022555b7..11dd53bfc7 100644
--- a/src/cmd/compile/internal/ssa/regalloc.go
+++ b/src/cmd/compile/internal/ssa/regalloc.go
@@ -596,17 +596,18 @@ func (s *regAllocState) allocValToReg(v *Value, mask regMask, nospill bool, pos
var c *Value
if vi.regs != 0 {
// Copy from a register that v is already in.
- r2 := pickReg(vi.regs)
var current *Value
- if !s.allocatable.contains(r2) {
- current = v // v is in a fixed register
+ if vi.regs&^s.allocatable != 0 {
+ // v is in a fixed register, prefer that
+ current = v
} else {
+ r2 := pickReg(vi.regs)
if s.regs[r2].v != v {
panic("bad register state")
}
current = s.regs[r2].c
+ s.usedSinceBlockStart |= regMask(1) << r2
}
- s.usedSinceBlockStart |= regMask(1) << r2
c = s.curBlock.NewValue1(pos, OpCopy, v.Type, current)
} else if v.rematerializeable() {
// Rematerialize instead of loading from the spill location.
diff --git a/src/cmd/compile/internal/ssa/rewrite.go b/src/cmd/compile/internal/ssa/rewrite.go
index 07308973b1..af2568ae89 100644
--- a/src/cmd/compile/internal/ssa/rewrite.go
+++ b/src/cmd/compile/internal/ssa/rewrite.go
@@ -2772,3 +2772,17 @@ func panicBoundsCCToAux(p PanicBoundsCC) Aux {
func isDictArgSym(sym Sym) bool {
return sym.(*ir.Name).Sym().Name == typecheck.LocalDictName
}
+
+// When v is (IMake typ (StructMake ...)), convert to
+// (IMake typ arg) where arg is the pointer-y argument to
+// the StructMake (there must be exactly one).
+func imakeOfStructMake(v *Value) *Value {
+ var arg *Value
+ for _, a := range v.Args[1].Args {
+ if a.Type.Size() > 0 {
+ arg = a
+ break
+ }
+ }
+ return v.Block.NewValue2(v.Pos, OpIMake, v.Type, v.Args[0], arg)
+}
diff --git a/src/cmd/compile/internal/ssa/rewriteARM64.go b/src/cmd/compile/internal/ssa/rewriteARM64.go
index 6af1558833..b3f790dbda 100644
--- a/src/cmd/compile/internal/ssa/rewriteARM64.go
+++ b/src/cmd/compile/internal/ssa/rewriteARM64.go
@@ -12556,6 +12556,54 @@ func rewriteValueARM64_OpARM64MUL(v *Value) bool {
}
break
}
+ // match: (MUL r:(MOVWUreg x) s:(MOVWUreg y))
+ // cond: r.Uses == 1 && s.Uses == 1
+ // result: (UMULL x y)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ r := v_0
+ if r.Op != OpARM64MOVWUreg {
+ continue
+ }
+ x := r.Args[0]
+ s := v_1
+ if s.Op != OpARM64MOVWUreg {
+ continue
+ }
+ y := s.Args[0]
+ if !(r.Uses == 1 && s.Uses == 1) {
+ continue
+ }
+ v.reset(OpARM64UMULL)
+ v.AddArg2(x, y)
+ return true
+ }
+ break
+ }
+ // match: (MUL r:(MOVWreg x) s:(MOVWreg y))
+ // cond: r.Uses == 1 && s.Uses == 1
+ // result: (MULL x y)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ r := v_0
+ if r.Op != OpARM64MOVWreg {
+ continue
+ }
+ x := r.Args[0]
+ s := v_1
+ if s.Op != OpARM64MOVWreg {
+ continue
+ }
+ y := s.Args[0]
+ if !(r.Uses == 1 && s.Uses == 1) {
+ continue
+ }
+ v.reset(OpARM64MULL)
+ v.AddArg2(x, y)
+ return true
+ }
+ break
+ }
return false
}
func rewriteValueARM64_OpARM64MULW(v *Value) bool {
@@ -25273,6 +25321,37 @@ func rewriteBlockARM64(b *Block) bool {
b.resetWithControl(BlockARM64FGE, cc)
return true
}
+ // match: (TBNZ [0] (XORconst [1] x) yes no)
+ // result: (TBZ [0] x yes no)
+ for b.Controls[0].Op == OpARM64XORconst {
+ v_0 := b.Controls[0]
+ if auxIntToInt64(v_0.AuxInt) != 1 {
+ break
+ }
+ x := v_0.Args[0]
+ if auxIntToInt64(b.AuxInt) != 0 {
+ break
+ }
+ b.resetWithControl(BlockARM64TBZ, x)
+ b.AuxInt = int64ToAuxInt(0)
+ return true
+ }
+ case BlockARM64TBZ:
+ // match: (TBZ [0] (XORconst [1] x) yes no)
+ // result: (TBNZ [0] x yes no)
+ for b.Controls[0].Op == OpARM64XORconst {
+ v_0 := b.Controls[0]
+ if auxIntToInt64(v_0.AuxInt) != 1 {
+ break
+ }
+ x := v_0.Args[0]
+ if auxIntToInt64(b.AuxInt) != 0 {
+ break
+ }
+ b.resetWithControl(BlockARM64TBNZ, x)
+ b.AuxInt = int64ToAuxInt(0)
+ return true
+ }
case BlockARM64UGE:
// match: (UGE (FlagConstant [fc]) yes no)
// cond: fc.uge()
diff --git a/src/cmd/compile/internal/ssa/rewriteLOONG64.go b/src/cmd/compile/internal/ssa/rewriteLOONG64.go
index 4262d4e0fb..bf2dd114a9 100644
--- a/src/cmd/compile/internal/ssa/rewriteLOONG64.go
+++ b/src/cmd/compile/internal/ssa/rewriteLOONG64.go
@@ -5866,7 +5866,6 @@ func rewriteValueLOONG64_OpLOONG64MULV(v *Value) bool {
v_0 := v.Args[0]
b := v.Block
config := b.Func.Config
- typ := &b.Func.Config.Types
// match: (MULV _ (MOVVconst [0]))
// result: (MOVVconst [0])
for {
@@ -5911,44 +5910,6 @@ func rewriteValueLOONG64_OpLOONG64MULV(v *Value) bool {
}
break
}
- // match: (MULV (NEGV x) (MOVVconst [c]))
- // result: (MULV x (MOVVconst [-c]))
- for {
- for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
- if v_0.Op != OpLOONG64NEGV {
- continue
- }
- x := v_0.Args[0]
- if v_1.Op != OpLOONG64MOVVconst {
- continue
- }
- c := auxIntToInt64(v_1.AuxInt)
- v.reset(OpLOONG64MULV)
- v0 := b.NewValue0(v.Pos, OpLOONG64MOVVconst, typ.UInt64)
- v0.AuxInt = int64ToAuxInt(-c)
- v.AddArg2(x, v0)
- return true
- }
- break
- }
- // match: (MULV (NEGV x) (NEGV y))
- // result: (MULV x y)
- for {
- for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
- if v_0.Op != OpLOONG64NEGV {
- continue
- }
- x := v_0.Args[0]
- if v_1.Op != OpLOONG64NEGV {
- continue
- }
- y := v_1.Args[0]
- v.reset(OpLOONG64MULV)
- v.AddArg2(x, y)
- return true
- }
- break
- }
// match: (MULV (MOVVconst [c]) (MOVVconst [d]))
// result: (MOVVconst [c*d])
for {
diff --git a/src/cmd/compile/internal/ssa/rewriteRISCV64.go b/src/cmd/compile/internal/ssa/rewriteRISCV64.go
index 191c7b3d48..284d88967b 100644
--- a/src/cmd/compile/internal/ssa/rewriteRISCV64.go
+++ b/src/cmd/compile/internal/ssa/rewriteRISCV64.go
@@ -7027,7 +7027,7 @@ func rewriteValueRISCV64_OpRISCV64ROL(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (ROL x (MOVDconst [val]))
- // result: (RORI [int64(int8(-val)&63)] x)
+ // result: (RORI [-val&63] x)
for {
x := v_0
if v_1.Op != OpRISCV64MOVDconst {
@@ -7035,7 +7035,7 @@ func rewriteValueRISCV64_OpRISCV64ROL(v *Value) bool {
}
val := auxIntToInt64(v_1.AuxInt)
v.reset(OpRISCV64RORI)
- v.AuxInt = int64ToAuxInt(int64(int8(-val) & 63))
+ v.AuxInt = int64ToAuxInt(-val & 63)
v.AddArg(x)
return true
}
@@ -7057,7 +7057,7 @@ func rewriteValueRISCV64_OpRISCV64ROLW(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (ROLW x (MOVDconst [val]))
- // result: (RORIW [int64(int8(-val)&31)] x)
+ // result: (RORIW [-val&31] x)
for {
x := v_0
if v_1.Op != OpRISCV64MOVDconst {
@@ -7065,7 +7065,7 @@ func rewriteValueRISCV64_OpRISCV64ROLW(v *Value) bool {
}
val := auxIntToInt64(v_1.AuxInt)
v.reset(OpRISCV64RORIW)
- v.AuxInt = int64ToAuxInt(int64(int8(-val) & 31))
+ v.AuxInt = int64ToAuxInt(-val & 31)
v.AddArg(x)
return true
}
@@ -7087,7 +7087,7 @@ func rewriteValueRISCV64_OpRISCV64ROR(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (ROR x (MOVDconst [val]))
- // result: (RORI [int64(val&63)] x)
+ // result: (RORI [val&63] x)
for {
x := v_0
if v_1.Op != OpRISCV64MOVDconst {
@@ -7095,7 +7095,7 @@ func rewriteValueRISCV64_OpRISCV64ROR(v *Value) bool {
}
val := auxIntToInt64(v_1.AuxInt)
v.reset(OpRISCV64RORI)
- v.AuxInt = int64ToAuxInt(int64(val & 63))
+ v.AuxInt = int64ToAuxInt(val & 63)
v.AddArg(x)
return true
}
@@ -7105,7 +7105,7 @@ func rewriteValueRISCV64_OpRISCV64RORW(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (RORW x (MOVDconst [val]))
- // result: (RORIW [int64(val&31)] x)
+ // result: (RORIW [val&31] x)
for {
x := v_0
if v_1.Op != OpRISCV64MOVDconst {
@@ -7113,7 +7113,7 @@ func rewriteValueRISCV64_OpRISCV64RORW(v *Value) bool {
}
val := auxIntToInt64(v_1.AuxInt)
v.reset(OpRISCV64RORIW)
- v.AuxInt = int64ToAuxInt(int64(val & 31))
+ v.AuxInt = int64ToAuxInt(val & 31)
v.AddArg(x)
return true
}
@@ -7212,7 +7212,7 @@ func rewriteValueRISCV64_OpRISCV64SLL(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (SLL x (MOVDconst [val]))
- // result: (SLLI [int64(val&63)] x)
+ // result: (SLLI [val&63] x)
for {
x := v_0
if v_1.Op != OpRISCV64MOVDconst {
@@ -7220,7 +7220,7 @@ func rewriteValueRISCV64_OpRISCV64SLL(v *Value) bool {
}
val := auxIntToInt64(v_1.AuxInt)
v.reset(OpRISCV64SLLI)
- v.AuxInt = int64ToAuxInt(int64(val & 63))
+ v.AuxInt = int64ToAuxInt(val & 63)
v.AddArg(x)
return true
}
@@ -7246,7 +7246,7 @@ func rewriteValueRISCV64_OpRISCV64SLLI(v *Value) bool {
}
// match: (SLLI <t> [c] (ADD x x))
// cond: c < t.Size() * 8 - 1
- // result: (SLLI <t> [c+1] x)
+ // result: (SLLI [c+1] x)
for {
t := v.Type
c := auxIntToInt64(v.AuxInt)
@@ -7258,7 +7258,6 @@ func rewriteValueRISCV64_OpRISCV64SLLI(v *Value) bool {
break
}
v.reset(OpRISCV64SLLI)
- v.Type = t
v.AuxInt = int64ToAuxInt(c + 1)
v.AddArg(x)
return true
@@ -7286,7 +7285,7 @@ func rewriteValueRISCV64_OpRISCV64SLLW(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (SLLW x (MOVDconst [val]))
- // result: (SLLIW [int64(val&31)] x)
+ // result: (SLLIW [val&31] x)
for {
x := v_0
if v_1.Op != OpRISCV64MOVDconst {
@@ -7294,7 +7293,7 @@ func rewriteValueRISCV64_OpRISCV64SLLW(v *Value) bool {
}
val := auxIntToInt64(v_1.AuxInt)
v.reset(OpRISCV64SLLIW)
- v.AuxInt = int64ToAuxInt(int64(val & 31))
+ v.AuxInt = int64ToAuxInt(val & 31)
v.AddArg(x)
return true
}
@@ -7304,7 +7303,7 @@ func rewriteValueRISCV64_OpRISCV64SLT(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (SLT x (MOVDconst [val]))
- // cond: val >= -2048 && val <= 2047
+ // cond: is12Bit(val)
// result: (SLTI [val] x)
for {
x := v_0
@@ -7312,7 +7311,7 @@ func rewriteValueRISCV64_OpRISCV64SLT(v *Value) bool {
break
}
val := auxIntToInt64(v_1.AuxInt)
- if !(val >= -2048 && val <= 2047) {
+ if !(is12Bit(val)) {
break
}
v.reset(OpRISCV64SLTI)
@@ -7363,22 +7362,6 @@ func rewriteValueRISCV64_OpRISCV64SLTI(v *Value) bool {
v.AuxInt = int64ToAuxInt(1)
return true
}
- // match: (SLTI [x] (ORI [y] _))
- // cond: y >= 0 && int64(y) >= int64(x)
- // result: (MOVDconst [0])
- for {
- x := auxIntToInt64(v.AuxInt)
- if v_0.Op != OpRISCV64ORI {
- break
- }
- y := auxIntToInt64(v_0.AuxInt)
- if !(y >= 0 && int64(y) >= int64(x)) {
- break
- }
- v.reset(OpRISCV64MOVDconst)
- v.AuxInt = int64ToAuxInt(0)
- return true
- }
return false
}
func rewriteValueRISCV64_OpRISCV64SLTIU(v *Value) bool {
@@ -7433,7 +7416,7 @@ func rewriteValueRISCV64_OpRISCV64SLTU(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (SLTU x (MOVDconst [val]))
- // cond: val >= -2048 && val <= 2047
+ // cond: is12Bit(val)
// result: (SLTIU [val] x)
for {
x := v_0
@@ -7441,7 +7424,7 @@ func rewriteValueRISCV64_OpRISCV64SLTU(v *Value) bool {
break
}
val := auxIntToInt64(v_1.AuxInt)
- if !(val >= -2048 && val <= 2047) {
+ if !(is12Bit(val)) {
break
}
v.reset(OpRISCV64SLTIU)
@@ -7555,7 +7538,7 @@ func rewriteValueRISCV64_OpRISCV64SRA(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (SRA x (MOVDconst [val]))
- // result: (SRAI [int64(val&63)] x)
+ // result: (SRAI [val&63] x)
for {
x := v_0
if v_1.Op != OpRISCV64MOVDconst {
@@ -7563,7 +7546,7 @@ func rewriteValueRISCV64_OpRISCV64SRA(v *Value) bool {
}
val := auxIntToInt64(v_1.AuxInt)
v.reset(OpRISCV64SRAI)
- v.AuxInt = int64ToAuxInt(int64(val & 63))
+ v.AuxInt = int64ToAuxInt(val & 63)
v.AddArg(x)
return true
}
@@ -7572,11 +7555,10 @@ func rewriteValueRISCV64_OpRISCV64SRA(v *Value) bool {
func rewriteValueRISCV64_OpRISCV64SRAI(v *Value) bool {
v_0 := v.Args[0]
b := v.Block
- // match: (SRAI <t> [x] (MOVWreg y))
+ // match: (SRAI [x] (MOVWreg y))
// cond: x >= 0 && x <= 31
- // result: (SRAIW <t> [int64(x)] y)
+ // result: (SRAIW [x] y)
for {
- t := v.Type
x := auxIntToInt64(v.AuxInt)
if v_0.Op != OpRISCV64MOVWreg {
break
@@ -7586,8 +7568,7 @@ func rewriteValueRISCV64_OpRISCV64SRAI(v *Value) bool {
break
}
v.reset(OpRISCV64SRAIW)
- v.Type = t
- v.AuxInt = int64ToAuxInt(int64(x))
+ v.AuxInt = int64ToAuxInt(x)
v.AddArg(y)
return true
}
@@ -7633,7 +7614,7 @@ func rewriteValueRISCV64_OpRISCV64SRAI(v *Value) bool {
v.AddArg(v0)
return true
}
- // match: (SRAI <t> [x] (MOVWreg y))
+ // match: (SRAI [x] (MOVWreg y))
// cond: x >= 32
// result: (SRAIW [31] y)
for {
@@ -7668,7 +7649,7 @@ func rewriteValueRISCV64_OpRISCV64SRAW(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (SRAW x (MOVDconst [val]))
- // result: (SRAIW [int64(val&31)] x)
+ // result: (SRAIW [val&31] x)
for {
x := v_0
if v_1.Op != OpRISCV64MOVDconst {
@@ -7676,7 +7657,7 @@ func rewriteValueRISCV64_OpRISCV64SRAW(v *Value) bool {
}
val := auxIntToInt64(v_1.AuxInt)
v.reset(OpRISCV64SRAIW)
- v.AuxInt = int64ToAuxInt(int64(val & 31))
+ v.AuxInt = int64ToAuxInt(val & 31)
v.AddArg(x)
return true
}
@@ -7686,7 +7667,7 @@ func rewriteValueRISCV64_OpRISCV64SRL(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (SRL x (MOVDconst [val]))
- // result: (SRLI [int64(val&63)] x)
+ // result: (SRLI [val&63] x)
for {
x := v_0
if v_1.Op != OpRISCV64MOVDconst {
@@ -7694,7 +7675,7 @@ func rewriteValueRISCV64_OpRISCV64SRL(v *Value) bool {
}
val := auxIntToInt64(v_1.AuxInt)
v.reset(OpRISCV64SRLI)
- v.AuxInt = int64ToAuxInt(int64(val & 63))
+ v.AuxInt = int64ToAuxInt(val & 63)
v.AddArg(x)
return true
}
@@ -7702,11 +7683,10 @@ func rewriteValueRISCV64_OpRISCV64SRL(v *Value) bool {
}
func rewriteValueRISCV64_OpRISCV64SRLI(v *Value) bool {
v_0 := v.Args[0]
- // match: (SRLI <t> [x] (MOVWUreg y))
+ // match: (SRLI [x] (MOVWUreg y))
// cond: x >= 0 && x <= 31
- // result: (SRLIW <t> [int64(x)] y)
+ // result: (SRLIW [x] y)
for {
- t := v.Type
x := auxIntToInt64(v.AuxInt)
if v_0.Op != OpRISCV64MOVWUreg {
break
@@ -7716,16 +7696,14 @@ func rewriteValueRISCV64_OpRISCV64SRLI(v *Value) bool {
break
}
v.reset(OpRISCV64SRLIW)
- v.Type = t
- v.AuxInt = int64ToAuxInt(int64(x))
+ v.AuxInt = int64ToAuxInt(x)
v.AddArg(y)
return true
}
- // match: (SRLI <t> [x] (MOVBUreg y))
+ // match: (SRLI [x] (MOVBUreg y))
// cond: x >= 8
- // result: (MOVDconst <t> [0])
+ // result: (MOVDconst [0])
for {
- t := v.Type
x := auxIntToInt64(v.AuxInt)
if v_0.Op != OpRISCV64MOVBUreg {
break
@@ -7734,15 +7712,13 @@ func rewriteValueRISCV64_OpRISCV64SRLI(v *Value) bool {
break
}
v.reset(OpRISCV64MOVDconst)
- v.Type = t
v.AuxInt = int64ToAuxInt(0)
return true
}
- // match: (SRLI <t> [x] (MOVHUreg y))
+ // match: (SRLI [x] (MOVHUreg y))
// cond: x >= 16
- // result: (MOVDconst <t> [0])
+ // result: (MOVDconst [0])
for {
- t := v.Type
x := auxIntToInt64(v.AuxInt)
if v_0.Op != OpRISCV64MOVHUreg {
break
@@ -7751,15 +7727,13 @@ func rewriteValueRISCV64_OpRISCV64SRLI(v *Value) bool {
break
}
v.reset(OpRISCV64MOVDconst)
- v.Type = t
v.AuxInt = int64ToAuxInt(0)
return true
}
- // match: (SRLI <t> [x] (MOVWUreg y))
+ // match: (SRLI [x] (MOVWUreg y))
// cond: x >= 32
- // result: (MOVDconst <t> [0])
+ // result: (MOVDconst [0])
for {
- t := v.Type
x := auxIntToInt64(v.AuxInt)
if v_0.Op != OpRISCV64MOVWUreg {
break
@@ -7768,7 +7742,6 @@ func rewriteValueRISCV64_OpRISCV64SRLI(v *Value) bool {
break
}
v.reset(OpRISCV64MOVDconst)
- v.Type = t
v.AuxInt = int64ToAuxInt(0)
return true
}
@@ -7790,7 +7763,7 @@ func rewriteValueRISCV64_OpRISCV64SRLW(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
// match: (SRLW x (MOVDconst [val]))
- // result: (SRLIW [int64(val&31)] x)
+ // result: (SRLIW [val&31] x)
for {
x := v_0
if v_1.Op != OpRISCV64MOVDconst {
@@ -7798,7 +7771,7 @@ func rewriteValueRISCV64_OpRISCV64SRLW(v *Value) bool {
}
val := auxIntToInt64(v_1.AuxInt)
v.reset(OpRISCV64SRLIW)
- v.AuxInt = int64ToAuxInt(int64(val & 31))
+ v.AuxInt = int64ToAuxInt(val & 31)
v.AddArg(x)
return true
}
diff --git a/src/cmd/compile/internal/ssa/rewritedec.go b/src/cmd/compile/internal/ssa/rewritedec.go
index 16d0269210..c45034ead0 100644
--- a/src/cmd/compile/internal/ssa/rewritedec.go
+++ b/src/cmd/compile/internal/ssa/rewritedec.go
@@ -279,11 +279,20 @@ func rewriteValuedec_OpIData(v *Value) bool {
func rewriteValuedec_OpIMake(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
- // match: (IMake _typ (StructMake val))
+ // match: (IMake _typ (StructMake ___))
+ // result: imakeOfStructMake(v)
+ for {
+ if v_1.Op != OpStructMake {
+ break
+ }
+ v.copyOf(imakeOfStructMake(v))
+ return true
+ }
+ // match: (IMake _typ (ArrayMake1 val))
// result: (IMake _typ val)
for {
_typ := v_0
- if v_1.Op != OpStructMake || len(v_1.Args) != 1 {
+ if v_1.Op != OpArrayMake1 {
break
}
val := v_1.Args[0]
@@ -839,17 +848,47 @@ func rewriteValuedec_OpStructMake(v *Value) bool {
func rewriteValuedec_OpStructSelect(v *Value) bool {
v_0 := v.Args[0]
b := v.Block
- // match: (StructSelect [0] (IData x))
+ // match: (StructSelect (IData x))
+ // cond: v.Type.Size() > 0
// result: (IData x)
for {
- if auxIntToInt64(v.AuxInt) != 0 || v_0.Op != OpIData {
+ if v_0.Op != OpIData {
break
}
x := v_0.Args[0]
+ if !(v.Type.Size() > 0) {
+ break
+ }
v.reset(OpIData)
v.AddArg(x)
return true
}
+ // match: (StructSelect (IData x))
+ // cond: v.Type.Size() == 0 && v.Type.IsStruct()
+ // result: (StructMake)
+ for {
+ if v_0.Op != OpIData {
+ break
+ }
+ if !(v.Type.Size() == 0 && v.Type.IsStruct()) {
+ break
+ }
+ v.reset(OpStructMake)
+ return true
+ }
+ // match: (StructSelect (IData x))
+ // cond: v.Type.Size() == 0 && v.Type.IsArray()
+ // result: (ArrayMake0)
+ for {
+ if v_0.Op != OpIData {
+ break
+ }
+ if !(v.Type.Size() == 0 && v.Type.IsArray()) {
+ break
+ }
+ v.reset(OpArrayMake0)
+ return true
+ }
// match: (StructSelect [i] x:(StructMake ___))
// result: x.Args[i]
for {
@@ -861,13 +900,10 @@ func rewriteValuedec_OpStructSelect(v *Value) bool {
v.copyOf(x.Args[i])
return true
}
- // match: (StructSelect [0] x)
+ // match: (StructSelect x)
// cond: x.Type.IsPtrShaped()
// result: x
for {
- if auxIntToInt64(v.AuxInt) != 0 {
- break
- }
x := v_0
if !(x.Type.IsPtrShaped()) {
break
diff --git a/src/cmd/compile/internal/ssa/rewritegeneric.go b/src/cmd/compile/internal/ssa/rewritegeneric.go
index 5b5494f43a..5c183fc2a6 100644
--- a/src/cmd/compile/internal/ssa/rewritegeneric.go
+++ b/src/cmd/compile/internal/ssa/rewritegeneric.go
@@ -5332,6 +5332,182 @@ func rewriteValuegeneric_OpAndB(v *Value) bool {
}
break
}
+ // match: (AndB (Neq64 x cv:(Const64 [c])) (Neq64 x (Const64 [d])))
+ // cond: c|d == c && oneBit(c^d)
+ // result: (Neq64 (Or64 <x.Type> x (Const64 <x.Type> [c^d])) cv)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpNeq64 {
+ continue
+ }
+ _ = v_0.Args[1]
+ v_0_0 := v_0.Args[0]
+ v_0_1 := v_0.Args[1]
+ for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
+ x := v_0_0
+ cv := v_0_1
+ if cv.Op != OpConst64 {
+ continue
+ }
+ c := auxIntToInt64(cv.AuxInt)
+ if v_1.Op != OpNeq64 {
+ continue
+ }
+ _ = v_1.Args[1]
+ v_1_0 := v_1.Args[0]
+ v_1_1 := v_1.Args[1]
+ for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
+ if x != v_1_0 || v_1_1.Op != OpConst64 {
+ continue
+ }
+ d := auxIntToInt64(v_1_1.AuxInt)
+ if !(c|d == c && oneBit(c^d)) {
+ continue
+ }
+ v.reset(OpNeq64)
+ v0 := b.NewValue0(v.Pos, OpOr64, x.Type)
+ v1 := b.NewValue0(v.Pos, OpConst64, x.Type)
+ v1.AuxInt = int64ToAuxInt(c ^ d)
+ v0.AddArg2(x, v1)
+ v.AddArg2(v0, cv)
+ return true
+ }
+ }
+ }
+ break
+ }
+ // match: (AndB (Neq32 x cv:(Const32 [c])) (Neq32 x (Const32 [d])))
+ // cond: c|d == c && oneBit(c^d)
+ // result: (Neq32 (Or32 <x.Type> x (Const32 <x.Type> [c^d])) cv)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpNeq32 {
+ continue
+ }
+ _ = v_0.Args[1]
+ v_0_0 := v_0.Args[0]
+ v_0_1 := v_0.Args[1]
+ for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
+ x := v_0_0
+ cv := v_0_1
+ if cv.Op != OpConst32 {
+ continue
+ }
+ c := auxIntToInt32(cv.AuxInt)
+ if v_1.Op != OpNeq32 {
+ continue
+ }
+ _ = v_1.Args[1]
+ v_1_0 := v_1.Args[0]
+ v_1_1 := v_1.Args[1]
+ for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
+ if x != v_1_0 || v_1_1.Op != OpConst32 {
+ continue
+ }
+ d := auxIntToInt32(v_1_1.AuxInt)
+ if !(c|d == c && oneBit(c^d)) {
+ continue
+ }
+ v.reset(OpNeq32)
+ v0 := b.NewValue0(v.Pos, OpOr32, x.Type)
+ v1 := b.NewValue0(v.Pos, OpConst32, x.Type)
+ v1.AuxInt = int32ToAuxInt(c ^ d)
+ v0.AddArg2(x, v1)
+ v.AddArg2(v0, cv)
+ return true
+ }
+ }
+ }
+ break
+ }
+ // match: (AndB (Neq16 x cv:(Const16 [c])) (Neq16 x (Const16 [d])))
+ // cond: c|d == c && oneBit(c^d)
+ // result: (Neq16 (Or16 <x.Type> x (Const16 <x.Type> [c^d])) cv)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpNeq16 {
+ continue
+ }
+ _ = v_0.Args[1]
+ v_0_0 := v_0.Args[0]
+ v_0_1 := v_0.Args[1]
+ for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
+ x := v_0_0
+ cv := v_0_1
+ if cv.Op != OpConst16 {
+ continue
+ }
+ c := auxIntToInt16(cv.AuxInt)
+ if v_1.Op != OpNeq16 {
+ continue
+ }
+ _ = v_1.Args[1]
+ v_1_0 := v_1.Args[0]
+ v_1_1 := v_1.Args[1]
+ for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
+ if x != v_1_0 || v_1_1.Op != OpConst16 {
+ continue
+ }
+ d := auxIntToInt16(v_1_1.AuxInt)
+ if !(c|d == c && oneBit(c^d)) {
+ continue
+ }
+ v.reset(OpNeq16)
+ v0 := b.NewValue0(v.Pos, OpOr16, x.Type)
+ v1 := b.NewValue0(v.Pos, OpConst16, x.Type)
+ v1.AuxInt = int16ToAuxInt(c ^ d)
+ v0.AddArg2(x, v1)
+ v.AddArg2(v0, cv)
+ return true
+ }
+ }
+ }
+ break
+ }
+ // match: (AndB (Neq8 x cv:(Const8 [c])) (Neq8 x (Const8 [d])))
+ // cond: c|d == c && oneBit(c^d)
+ // result: (Neq8 (Or8 <x.Type> x (Const8 <x.Type> [c^d])) cv)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpNeq8 {
+ continue
+ }
+ _ = v_0.Args[1]
+ v_0_0 := v_0.Args[0]
+ v_0_1 := v_0.Args[1]
+ for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
+ x := v_0_0
+ cv := v_0_1
+ if cv.Op != OpConst8 {
+ continue
+ }
+ c := auxIntToInt8(cv.AuxInt)
+ if v_1.Op != OpNeq8 {
+ continue
+ }
+ _ = v_1.Args[1]
+ v_1_0 := v_1.Args[0]
+ v_1_1 := v_1.Args[1]
+ for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
+ if x != v_1_0 || v_1_1.Op != OpConst8 {
+ continue
+ }
+ d := auxIntToInt8(v_1_1.AuxInt)
+ if !(c|d == c && oneBit(c^d)) {
+ continue
+ }
+ v.reset(OpNeq8)
+ v0 := b.NewValue0(v.Pos, OpOr8, x.Type)
+ v1 := b.NewValue0(v.Pos, OpConst8, x.Type)
+ v1.AuxInt = int8ToAuxInt(c ^ d)
+ v0.AddArg2(x, v1)
+ v.AddArg2(v0, cv)
+ return true
+ }
+ }
+ }
+ break
+ }
return false
}
func rewriteValuegeneric_OpArraySelect(v *Value) bool {
@@ -8809,16 +8985,13 @@ func rewriteValuegeneric_OpFloor(v *Value) bool {
func rewriteValuegeneric_OpIMake(v *Value) bool {
v_1 := v.Args[1]
v_0 := v.Args[0]
- // match: (IMake _typ (StructMake val))
- // result: (IMake _typ val)
+ // match: (IMake _typ (StructMake ___))
+ // result: imakeOfStructMake(v)
for {
- _typ := v_0
- if v_1.Op != OpStructMake || len(v_1.Args) != 1 {
+ if v_1.Op != OpStructMake {
break
}
- val := v_1.Args[0]
- v.reset(OpIMake)
- v.AddArg2(_typ, val)
+ v.copyOf(imakeOfStructMake(v))
return true
}
// match: (IMake _typ (ArrayMake1 val))
@@ -16610,6 +16783,45 @@ func rewriteValuegeneric_OpMul16(v *Value) bool {
}
break
}
+ // match: (Mul16 (Const16 <t> [c]) (Neg16 x))
+ // result: (Mul16 x (Const16 <t> [-c]))
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpConst16 {
+ continue
+ }
+ t := v_0.Type
+ c := auxIntToInt16(v_0.AuxInt)
+ if v_1.Op != OpNeg16 {
+ continue
+ }
+ x := v_1.Args[0]
+ v.reset(OpMul16)
+ v0 := b.NewValue0(v.Pos, OpConst16, t)
+ v0.AuxInt = int16ToAuxInt(-c)
+ v.AddArg2(x, v0)
+ return true
+ }
+ break
+ }
+ // match: (Mul16 (Neg16 x) (Neg16 y))
+ // result: (Mul16 x y)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpNeg16 {
+ continue
+ }
+ x := v_0.Args[0]
+ if v_1.Op != OpNeg16 {
+ continue
+ }
+ y := v_1.Args[0]
+ v.reset(OpMul16)
+ v.AddArg2(x, y)
+ return true
+ }
+ break
+ }
// match: (Mul16 (Const16 <t> [c]) (Add16 <t> (Const16 <t> [d]) x))
// cond: !isPowerOfTwo(c)
// result: (Add16 (Const16 <t> [c*d]) (Mul16 <t> (Const16 <t> [c]) x))
@@ -16821,6 +17033,45 @@ func rewriteValuegeneric_OpMul32(v *Value) bool {
}
break
}
+ // match: (Mul32 (Const32 <t> [c]) (Neg32 x))
+ // result: (Mul32 x (Const32 <t> [-c]))
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpConst32 {
+ continue
+ }
+ t := v_0.Type
+ c := auxIntToInt32(v_0.AuxInt)
+ if v_1.Op != OpNeg32 {
+ continue
+ }
+ x := v_1.Args[0]
+ v.reset(OpMul32)
+ v0 := b.NewValue0(v.Pos, OpConst32, t)
+ v0.AuxInt = int32ToAuxInt(-c)
+ v.AddArg2(x, v0)
+ return true
+ }
+ break
+ }
+ // match: (Mul32 (Neg32 x) (Neg32 y))
+ // result: (Mul32 x y)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpNeg32 {
+ continue
+ }
+ x := v_0.Args[0]
+ if v_1.Op != OpNeg32 {
+ continue
+ }
+ y := v_1.Args[0]
+ v.reset(OpMul32)
+ v.AddArg2(x, y)
+ return true
+ }
+ break
+ }
// match: (Mul32 (Const32 <t> [c]) (Add32 <t> (Const32 <t> [d]) x))
// cond: !isPowerOfTwo(c)
// result: (Add32 (Const32 <t> [c*d]) (Mul32 <t> (Const32 <t> [c]) x))
@@ -17193,6 +17444,45 @@ func rewriteValuegeneric_OpMul64(v *Value) bool {
}
break
}
+ // match: (Mul64 (Const64 <t> [c]) (Neg64 x))
+ // result: (Mul64 x (Const64 <t> [-c]))
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpConst64 {
+ continue
+ }
+ t := v_0.Type
+ c := auxIntToInt64(v_0.AuxInt)
+ if v_1.Op != OpNeg64 {
+ continue
+ }
+ x := v_1.Args[0]
+ v.reset(OpMul64)
+ v0 := b.NewValue0(v.Pos, OpConst64, t)
+ v0.AuxInt = int64ToAuxInt(-c)
+ v.AddArg2(x, v0)
+ return true
+ }
+ break
+ }
+ // match: (Mul64 (Neg64 x) (Neg64 y))
+ // result: (Mul64 x y)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpNeg64 {
+ continue
+ }
+ x := v_0.Args[0]
+ if v_1.Op != OpNeg64 {
+ continue
+ }
+ y := v_1.Args[0]
+ v.reset(OpMul64)
+ v.AddArg2(x, y)
+ return true
+ }
+ break
+ }
// match: (Mul64 (Const64 <t> [c]) (Add64 <t> (Const64 <t> [d]) x))
// cond: !isPowerOfTwo(c)
// result: (Add64 (Const64 <t> [c*d]) (Mul64 <t> (Const64 <t> [c]) x))
@@ -17565,6 +17855,45 @@ func rewriteValuegeneric_OpMul8(v *Value) bool {
}
break
}
+ // match: (Mul8 (Const8 <t> [c]) (Neg8 x))
+ // result: (Mul8 x (Const8 <t> [-c]))
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpConst8 {
+ continue
+ }
+ t := v_0.Type
+ c := auxIntToInt8(v_0.AuxInt)
+ if v_1.Op != OpNeg8 {
+ continue
+ }
+ x := v_1.Args[0]
+ v.reset(OpMul8)
+ v0 := b.NewValue0(v.Pos, OpConst8, t)
+ v0.AuxInt = int8ToAuxInt(-c)
+ v.AddArg2(x, v0)
+ return true
+ }
+ break
+ }
+ // match: (Mul8 (Neg8 x) (Neg8 y))
+ // result: (Mul8 x y)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpNeg8 {
+ continue
+ }
+ x := v_0.Args[0]
+ if v_1.Op != OpNeg8 {
+ continue
+ }
+ y := v_1.Args[0]
+ v.reset(OpMul8)
+ v.AddArg2(x, y)
+ return true
+ }
+ break
+ }
// match: (Mul8 (Const8 <t> [c]) (Add8 <t> (Const8 <t> [d]) x))
// cond: !isPowerOfTwo(c)
// result: (Add8 (Const8 <t> [c*d]) (Mul8 <t> (Const8 <t> [c]) x))
@@ -23242,6 +23571,182 @@ func rewriteValuegeneric_OpOrB(v *Value) bool {
}
break
}
+ // match: (OrB (Eq64 x cv:(Const64 [c])) (Eq64 x (Const64 [d])))
+ // cond: c|d == c && oneBit(c^d)
+ // result: (Eq64 (Or64 <x.Type> x (Const64 <x.Type> [c^d])) cv)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpEq64 {
+ continue
+ }
+ _ = v_0.Args[1]
+ v_0_0 := v_0.Args[0]
+ v_0_1 := v_0.Args[1]
+ for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
+ x := v_0_0
+ cv := v_0_1
+ if cv.Op != OpConst64 {
+ continue
+ }
+ c := auxIntToInt64(cv.AuxInt)
+ if v_1.Op != OpEq64 {
+ continue
+ }
+ _ = v_1.Args[1]
+ v_1_0 := v_1.Args[0]
+ v_1_1 := v_1.Args[1]
+ for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
+ if x != v_1_0 || v_1_1.Op != OpConst64 {
+ continue
+ }
+ d := auxIntToInt64(v_1_1.AuxInt)
+ if !(c|d == c && oneBit(c^d)) {
+ continue
+ }
+ v.reset(OpEq64)
+ v0 := b.NewValue0(v.Pos, OpOr64, x.Type)
+ v1 := b.NewValue0(v.Pos, OpConst64, x.Type)
+ v1.AuxInt = int64ToAuxInt(c ^ d)
+ v0.AddArg2(x, v1)
+ v.AddArg2(v0, cv)
+ return true
+ }
+ }
+ }
+ break
+ }
+ // match: (OrB (Eq32 x cv:(Const32 [c])) (Eq32 x (Const32 [d])))
+ // cond: c|d == c && oneBit(c^d)
+ // result: (Eq32 (Or32 <x.Type> x (Const32 <x.Type> [c^d])) cv)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpEq32 {
+ continue
+ }
+ _ = v_0.Args[1]
+ v_0_0 := v_0.Args[0]
+ v_0_1 := v_0.Args[1]
+ for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
+ x := v_0_0
+ cv := v_0_1
+ if cv.Op != OpConst32 {
+ continue
+ }
+ c := auxIntToInt32(cv.AuxInt)
+ if v_1.Op != OpEq32 {
+ continue
+ }
+ _ = v_1.Args[1]
+ v_1_0 := v_1.Args[0]
+ v_1_1 := v_1.Args[1]
+ for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
+ if x != v_1_0 || v_1_1.Op != OpConst32 {
+ continue
+ }
+ d := auxIntToInt32(v_1_1.AuxInt)
+ if !(c|d == c && oneBit(c^d)) {
+ continue
+ }
+ v.reset(OpEq32)
+ v0 := b.NewValue0(v.Pos, OpOr32, x.Type)
+ v1 := b.NewValue0(v.Pos, OpConst32, x.Type)
+ v1.AuxInt = int32ToAuxInt(c ^ d)
+ v0.AddArg2(x, v1)
+ v.AddArg2(v0, cv)
+ return true
+ }
+ }
+ }
+ break
+ }
+ // match: (OrB (Eq16 x cv:(Const16 [c])) (Eq16 x (Const16 [d])))
+ // cond: c|d == c && oneBit(c^d)
+ // result: (Eq16 (Or16 <x.Type> x (Const16 <x.Type> [c^d])) cv)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpEq16 {
+ continue
+ }
+ _ = v_0.Args[1]
+ v_0_0 := v_0.Args[0]
+ v_0_1 := v_0.Args[1]
+ for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
+ x := v_0_0
+ cv := v_0_1
+ if cv.Op != OpConst16 {
+ continue
+ }
+ c := auxIntToInt16(cv.AuxInt)
+ if v_1.Op != OpEq16 {
+ continue
+ }
+ _ = v_1.Args[1]
+ v_1_0 := v_1.Args[0]
+ v_1_1 := v_1.Args[1]
+ for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
+ if x != v_1_0 || v_1_1.Op != OpConst16 {
+ continue
+ }
+ d := auxIntToInt16(v_1_1.AuxInt)
+ if !(c|d == c && oneBit(c^d)) {
+ continue
+ }
+ v.reset(OpEq16)
+ v0 := b.NewValue0(v.Pos, OpOr16, x.Type)
+ v1 := b.NewValue0(v.Pos, OpConst16, x.Type)
+ v1.AuxInt = int16ToAuxInt(c ^ d)
+ v0.AddArg2(x, v1)
+ v.AddArg2(v0, cv)
+ return true
+ }
+ }
+ }
+ break
+ }
+ // match: (OrB (Eq8 x cv:(Const8 [c])) (Eq8 x (Const8 [d])))
+ // cond: c|d == c && oneBit(c^d)
+ // result: (Eq8 (Or8 <x.Type> x (Const8 <x.Type> [c^d])) cv)
+ for {
+ for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
+ if v_0.Op != OpEq8 {
+ continue
+ }
+ _ = v_0.Args[1]
+ v_0_0 := v_0.Args[0]
+ v_0_1 := v_0.Args[1]
+ for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
+ x := v_0_0
+ cv := v_0_1
+ if cv.Op != OpConst8 {
+ continue
+ }
+ c := auxIntToInt8(cv.AuxInt)
+ if v_1.Op != OpEq8 {
+ continue
+ }
+ _ = v_1.Args[1]
+ v_1_0 := v_1.Args[0]
+ v_1_1 := v_1.Args[1]
+ for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
+ if x != v_1_0 || v_1_1.Op != OpConst8 {
+ continue
+ }
+ d := auxIntToInt8(v_1_1.AuxInt)
+ if !(c|d == c && oneBit(c^d)) {
+ continue
+ }
+ v.reset(OpEq8)
+ v0 := b.NewValue0(v.Pos, OpOr8, x.Type)
+ v1 := b.NewValue0(v.Pos, OpConst8, x.Type)
+ v1.AuxInt = int8ToAuxInt(c ^ d)
+ v0.AddArg2(x, v1)
+ v.AddArg2(v0, cv)
+ return true
+ }
+ }
+ }
+ break
+ }
// match: (OrB (Neq64F x x) (Less64F x y:(Const64F [c])))
// result: (Not (Leq64F y x))
for {
@@ -31601,17 +32106,47 @@ func rewriteValuegeneric_OpStructSelect(v *Value) bool {
v0.AddArg2(v1, mem)
return true
}
- // match: (StructSelect [0] (IData x))
+ // match: (StructSelect (IData x))
+ // cond: v.Type.Size() > 0
// result: (IData x)
for {
- if auxIntToInt64(v.AuxInt) != 0 || v_0.Op != OpIData {
+ if v_0.Op != OpIData {
break
}
x := v_0.Args[0]
+ if !(v.Type.Size() > 0) {
+ break
+ }
v.reset(OpIData)
v.AddArg(x)
return true
}
+ // match: (StructSelect (IData x))
+ // cond: v.Type.Size() == 0 && v.Type.IsStruct()
+ // result: (StructMake)
+ for {
+ if v_0.Op != OpIData {
+ break
+ }
+ if !(v.Type.Size() == 0 && v.Type.IsStruct()) {
+ break
+ }
+ v.reset(OpStructMake)
+ return true
+ }
+ // match: (StructSelect (IData x))
+ // cond: v.Type.Size() == 0 && v.Type.IsArray()
+ // result: (ArrayMake0)
+ for {
+ if v_0.Op != OpIData {
+ break
+ }
+ if !(v.Type.Size() == 0 && v.Type.IsArray()) {
+ break
+ }
+ v.reset(OpArrayMake0)
+ return true
+ }
return false
}
func rewriteValuegeneric_OpSub16(v *Value) bool {
diff --git a/src/cmd/compile/internal/ssagen/ssa.go b/src/cmd/compile/internal/ssagen/ssa.go
index e854cd9895..e59451c773 100644
--- a/src/cmd/compile/internal/ssagen/ssa.go
+++ b/src/cmd/compile/internal/ssagen/ssa.go
@@ -124,6 +124,11 @@ func InitConfig() {
ir.Syms.GCWriteBarrier[7] = typecheck.LookupRuntimeFunc("gcWriteBarrier8")
ir.Syms.Goschedguarded = typecheck.LookupRuntimeFunc("goschedguarded")
ir.Syms.Growslice = typecheck.LookupRuntimeFunc("growslice")
+ ir.Syms.GrowsliceBuf = typecheck.LookupRuntimeFunc("growsliceBuf")
+ ir.Syms.MoveSlice = typecheck.LookupRuntimeFunc("moveSlice")
+ ir.Syms.MoveSliceNoScan = typecheck.LookupRuntimeFunc("moveSliceNoScan")
+ ir.Syms.MoveSliceNoCap = typecheck.LookupRuntimeFunc("moveSliceNoCap")
+ ir.Syms.MoveSliceNoCapNoScan = typecheck.LookupRuntimeFunc("moveSliceNoCapNoScan")
ir.Syms.InterfaceSwitch = typecheck.LookupRuntimeFunc("interfaceSwitch")
for i := 1; i < len(ir.Syms.MallocGCSmallNoScan); i++ {
ir.Syms.MallocGCSmallNoScan[i] = typecheck.LookupRuntimeFunc(fmt.Sprintf("mallocgcSmallNoScanSC%d", i))
@@ -1096,6 +1101,23 @@ type state struct {
// Block starting position, indexed by block id.
blockStarts []src.XPos
+
+ // Information for stack allocation. Indexed by the first argument
+ // to an append call. Normally a slice-typed variable, but not always.
+ backingStores map[ir.Node]*backingStoreInfo
+}
+
+type backingStoreInfo struct {
+ // Size of backing store array (in elements)
+ K int64
+ // Stack-allocated backing store variable.
+ store *ir.Name
+ // Dynamic boolean variable marking the fact that we used this backing store.
+ used *ir.Name
+ // Have we used this variable statically yet? This is just a hint
+ // to avoid checking the dynamic variable if the answer is obvious.
+ // (usedStatic == true implies used == true)
+ usedStatic bool
}
type funcLine struct {
@@ -3683,6 +3705,9 @@ func (s *state) exprCheckPtr(n ir.Node, checkPtrOK bool) *ssa.Value {
case ir.OAPPEND:
return s.append(n.(*ir.CallExpr), false)
+ case ir.OMOVE2HEAP:
+ return s.move2heap(n.(*ir.MoveToHeapExpr))
+
case ir.OMIN, ir.OMAX:
return s.minMax(n.(*ir.CallExpr))
@@ -3744,6 +3769,68 @@ func (s *state) resultAddrOfCall(c *ssa.Value, which int64, t *types.Type) *ssa.
return addr
}
+// Get backing store information for an append call.
+func (s *state) getBackingStoreInfoForAppend(n *ir.CallExpr) *backingStoreInfo {
+ if n.Esc() != ir.EscNone {
+ return nil
+ }
+ return s.getBackingStoreInfo(n.Args[0])
+}
+func (s *state) getBackingStoreInfo(n ir.Node) *backingStoreInfo {
+ t := n.Type()
+ et := t.Elem()
+ maxStackSize := int64(base.Debug.VariableMakeThreshold)
+ if et.Size() == 0 || et.Size() > maxStackSize {
+ return nil
+ }
+ if base.Flag.N != 0 {
+ return nil
+ }
+ if !base.VariableMakeHash.MatchPos(n.Pos(), nil) {
+ return nil
+ }
+ i := s.backingStores[n]
+ if i != nil {
+ return i
+ }
+
+ // Build type of backing store.
+ K := maxStackSize / et.Size() // rounds down
+ KT := types.NewArray(et, K)
+ KT.SetNoalg(true)
+ types.CalcArraySize(KT)
+ // Align more than naturally for the type KT. See issue 73199.
+ align := types.NewArray(types.Types[types.TUINTPTR], 0)
+ types.CalcArraySize(align)
+ storeTyp := types.NewStruct([]*types.Field{
+ {Sym: types.BlankSym, Type: align},
+ {Sym: types.BlankSym, Type: KT},
+ })
+ storeTyp.SetNoalg(true)
+ types.CalcStructSize(storeTyp)
+
+ // Make backing store variable.
+ backingStore := typecheck.TempAt(n.Pos(), s.curfn, storeTyp)
+ backingStore.SetAddrtaken(true)
+
+ // Make "used" boolean.
+ used := typecheck.TempAt(n.Pos(), s.curfn, types.Types[types.TBOOL])
+ if s.curBlock == s.f.Entry {
+ s.vars[used] = s.constBool(false)
+ } else {
+ // initialize this variable at end of entry block
+ s.defvars[s.f.Entry.ID][used] = s.constBool(false)
+ }
+
+ // Initialize an info structure.
+ if s.backingStores == nil {
+ s.backingStores = map[ir.Node]*backingStoreInfo{}
+ }
+ i = &backingStoreInfo{K: K, store: backingStore, used: used, usedStatic: false}
+ s.backingStores[n] = i
+ return i
+}
+
// append converts an OAPPEND node to SSA.
// If inplace is false, it converts the OAPPEND expression n to an ssa.Value,
// adds it to s, and returns the Value.
@@ -3834,9 +3921,29 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
// A stack-allocated backing store could be used at every
// append that qualifies, but we limit it in some cases to
// avoid wasted code and stack space.
- // TODO: handle ... append case.
- maxStackSize := int64(base.Debug.VariableMakeThreshold)
- if !inplace && n.Esc() == ir.EscNone && et.Size() > 0 && et.Size() <= maxStackSize && base.Flag.N == 0 && base.VariableMakeHash.MatchPos(n.Pos(), nil) && !s.appendTargets[sn] {
+ //
+ // Note that we have two different strategies.
+ // 1. The standard strategy is just to allocate the full
+ // backing store at the first append.
+ // 2. An alternate strategy is used when
+ // a. The backing store eventually escapes via move2heap
+ // and b. The capacity is used somehow
+ // In this case, we don't want to just allocate
+ // the full buffer at the first append, because when
+ // we move2heap the buffer to the heap when it escapes,
+ // we might end up wasting memory because we can't
+ // change the capacity.
+ // So in this case we use growsliceBuf to reuse the buffer
+ // and walk one step up the size class ladder each time.
+ //
+ // TODO: handle ... append case? Currently we handle only
+ // a fixed number of appended elements.
+ var info *backingStoreInfo
+ if !inplace {
+ info = s.getBackingStoreInfoForAppend(n)
+ }
+
+ if !inplace && info != nil && !n.UseBuf && !info.usedStatic {
// if l <= K {
// if !used {
// if oldLen == 0 {
@@ -3860,43 +3967,19 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
// It is ok to do it more often, but it is probably helpful only for
// the first instance. TODO: this could use more tuning. Using ir.Node
// as the key works for *ir.Name instances but probably nothing else.
- if s.appendTargets == nil {
- s.appendTargets = map[ir.Node]bool{}
- }
- s.appendTargets[sn] = true
-
- K := maxStackSize / et.Size() // rounds down
- KT := types.NewArray(et, K)
- KT.SetNoalg(true)
- types.CalcArraySize(KT)
- // Align more than naturally for the type KT. See issue 73199.
- align := types.NewArray(types.Types[types.TUINTPTR], 0)
- types.CalcArraySize(align)
- storeTyp := types.NewStruct([]*types.Field{
- {Sym: types.BlankSym, Type: align},
- {Sym: types.BlankSym, Type: KT},
- })
- storeTyp.SetNoalg(true)
- types.CalcStructSize(storeTyp)
+ info.usedStatic = true
+ // TODO: unset usedStatic somehow?
usedTestBlock := s.f.NewBlock(ssa.BlockPlain)
oldLenTestBlock := s.f.NewBlock(ssa.BlockPlain)
bodyBlock := s.f.NewBlock(ssa.BlockPlain)
growSlice := s.f.NewBlock(ssa.BlockPlain)
-
- // Make "used" boolean.
- tBool := types.Types[types.TBOOL]
- used := typecheck.TempAt(n.Pos(), s.curfn, tBool)
- s.defvars[s.f.Entry.ID][used] = s.constBool(false) // initialize this variable at fn entry
-
- // Make backing store variable.
tInt := types.Types[types.TINT]
- backingStore := typecheck.TempAt(n.Pos(), s.curfn, storeTyp)
- backingStore.SetAddrtaken(true)
+ tBool := types.Types[types.TBOOL]
// if l <= K
s.startBlock(grow)
- kTest := s.newValue2(s.ssaOp(ir.OLE, tInt), tBool, l, s.constInt(tInt, K))
+ kTest := s.newValue2(s.ssaOp(ir.OLE, tInt), tBool, l, s.constInt(tInt, info.K))
b := s.endBlock()
b.Kind = ssa.BlockIf
b.SetControl(kTest)
@@ -3906,7 +3989,7 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
// if !used
s.startBlock(usedTestBlock)
- usedTest := s.newValue1(ssa.OpNot, tBool, s.expr(used))
+ usedTest := s.newValue1(ssa.OpNot, tBool, s.expr(info.used))
b = s.endBlock()
b.Kind = ssa.BlockIf
b.SetControl(usedTest)
@@ -3927,18 +4010,18 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
// var store struct { _ [0]uintptr; arr [K]T }
s.startBlock(bodyBlock)
if et.HasPointers() {
- s.vars[memVar] = s.newValue1A(ssa.OpVarDef, types.TypeMem, backingStore, s.mem())
+ s.vars[memVar] = s.newValue1A(ssa.OpVarDef, types.TypeMem, info.store, s.mem())
}
- addr := s.addr(backingStore)
- s.zero(storeTyp, addr)
+ addr := s.addr(info.store)
+ s.zero(info.store.Type(), addr)
// s = store.arr[:l:K]
s.vars[ptrVar] = addr
s.vars[lenVar] = l // nargs would also be ok because of the oldLen==0 test.
- s.vars[capVar] = s.constInt(tInt, K)
+ s.vars[capVar] = s.constInt(tInt, info.K)
// used = true
- s.assign(used, s.constBool(true), false, 0)
+ s.assign(info.used, s.constBool(true), false, 0)
b = s.endBlock()
b.AddEdgeTo(assign)
@@ -3949,7 +4032,25 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
// Call growslice
s.startBlock(grow)
taddr := s.expr(n.Fun)
- r := s.rtcall(ir.Syms.Growslice, true, []*types.Type{n.Type()}, p, l, c, nargs, taddr)
+ var r []*ssa.Value
+ if info != nil && n.UseBuf {
+ // Use stack-allocated buffer as backing store, if we can.
+ if et.HasPointers() && !info.usedStatic {
+ // Initialize in the function header. Not the best place,
+ // but it makes sure we don't scan this area before it is
+ // initialized.
+ mem := s.defvars[s.f.Entry.ID][memVar]
+ mem = s.f.Entry.NewValue1A(n.Pos(), ssa.OpVarDef, types.TypeMem, info.store, mem)
+ addr := s.f.Entry.NewValue2A(n.Pos(), ssa.OpLocalAddr, types.NewPtr(info.store.Type()), info.store, s.sp, mem)
+ mem = s.f.Entry.NewValue2I(n.Pos(), ssa.OpZero, types.TypeMem, info.store.Type().Size(), addr, mem)
+ mem.Aux = info.store.Type()
+ s.defvars[s.f.Entry.ID][memVar] = mem
+ info.usedStatic = true
+ }
+ r = s.rtcall(ir.Syms.GrowsliceBuf, true, []*types.Type{n.Type()}, p, l, c, nargs, taddr, s.addr(info.store), s.constInt(types.Types[types.TINT], info.K))
+ } else {
+ r = s.rtcall(ir.Syms.Growslice, true, []*types.Type{n.Type()}, p, l, c, nargs, taddr)
+ }
// Decompose output slice
p = s.newValue1(ssa.OpSlicePtr, pt, r[0])
@@ -4036,6 +4137,95 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
return s.newValue3(ssa.OpSliceMake, n.Type(), p, l, c)
}
+func (s *state) move2heap(n *ir.MoveToHeapExpr) *ssa.Value {
+ // s := n.Slice
+ // if s.ptr points to current stack frame {
+ // s2 := make([]T, s.len, s.cap)
+ // copy(s2[:cap], s[:cap])
+ // s = s2
+ // }
+ // return s
+
+ slice := s.expr(n.Slice)
+ et := slice.Type.Elem()
+ pt := types.NewPtr(et)
+
+ info := s.getBackingStoreInfo(n)
+ if info == nil {
+ // Backing store will never be stack allocated, so
+ // move2heap is a no-op.
+ return slice
+ }
+
+ // Decomposse input slice.
+ p := s.newValue1(ssa.OpSlicePtr, pt, slice)
+ l := s.newValue1(ssa.OpSliceLen, types.Types[types.TINT], slice)
+ c := s.newValue1(ssa.OpSliceCap, types.Types[types.TINT], slice)
+
+ moveBlock := s.f.NewBlock(ssa.BlockPlain)
+ mergeBlock := s.f.NewBlock(ssa.BlockPlain)
+
+ s.vars[ptrVar] = p
+ s.vars[lenVar] = l
+ s.vars[capVar] = c
+
+ // Decide if we need to move the slice backing store.
+ // It needs to be moved if it is currently on the stack.
+ sub := ssa.OpSub64
+ less := ssa.OpLess64U
+ if s.config.PtrSize == 4 {
+ sub = ssa.OpSub32
+ less = ssa.OpLess32U
+ }
+ callerSP := s.newValue1(ssa.OpGetCallerSP, types.Types[types.TUINTPTR], s.mem())
+ frameSize := s.newValue2(sub, types.Types[types.TUINTPTR], callerSP, s.sp)
+ pInt := s.newValue2(ssa.OpConvert, types.Types[types.TUINTPTR], p, s.mem())
+ off := s.newValue2(sub, types.Types[types.TUINTPTR], pInt, s.sp)
+ cond := s.newValue2(less, types.Types[types.TBOOL], off, frameSize)
+
+ b := s.endBlock()
+ b.Kind = ssa.BlockIf
+ b.Likely = ssa.BranchUnlikely // fast path is to not have to call into runtime
+ b.SetControl(cond)
+ b.AddEdgeTo(moveBlock)
+ b.AddEdgeTo(mergeBlock)
+
+ // Move the slice to heap
+ s.startBlock(moveBlock)
+ var newSlice *ssa.Value
+ if et.HasPointers() {
+ typ := s.expr(n.RType)
+ if n.PreserveCapacity {
+ newSlice = s.rtcall(ir.Syms.MoveSlice, true, []*types.Type{slice.Type}, typ, p, l, c)[0]
+ } else {
+ newSlice = s.rtcall(ir.Syms.MoveSliceNoCap, true, []*types.Type{slice.Type}, typ, p, l)[0]
+ }
+ } else {
+ elemSize := s.constInt(types.Types[types.TUINTPTR], et.Size())
+ if n.PreserveCapacity {
+ newSlice = s.rtcall(ir.Syms.MoveSliceNoScan, true, []*types.Type{slice.Type}, elemSize, p, l, c)[0]
+ } else {
+ newSlice = s.rtcall(ir.Syms.MoveSliceNoCapNoScan, true, []*types.Type{slice.Type}, elemSize, p, l)[0]
+ }
+ }
+ // Decompose output slice
+ s.vars[ptrVar] = s.newValue1(ssa.OpSlicePtr, pt, newSlice)
+ s.vars[lenVar] = s.newValue1(ssa.OpSliceLen, types.Types[types.TINT], newSlice)
+ s.vars[capVar] = s.newValue1(ssa.OpSliceCap, types.Types[types.TINT], newSlice)
+ b = s.endBlock()
+ b.AddEdgeTo(mergeBlock)
+
+ // Merge fast path (no moving) and slow path (moved)
+ s.startBlock(mergeBlock)
+ p = s.variable(ptrVar, pt) // generates phi for ptr
+ l = s.variable(lenVar, types.Types[types.TINT]) // generates phi for len
+ c = s.variable(capVar, types.Types[types.TINT]) // generates phi for cap
+ delete(s.vars, ptrVar)
+ delete(s.vars, lenVar)
+ delete(s.vars, capVar)
+ return s.newValue3(ssa.OpSliceMake, slice.Type, p, l, c)
+}
+
// minMax converts an OMIN/OMAX builtin call into SSA.
func (s *state) minMax(n *ir.CallExpr) *ssa.Value {
// The OMIN/OMAX builtin is variadic, but its semantics are
diff --git a/src/cmd/compile/internal/test/testdata/arith_test.go b/src/cmd/compile/internal/test/testdata/arith_test.go
index 8984cd3e26..34ac73c068 100644
--- a/src/cmd/compile/internal/test/testdata/arith_test.go
+++ b/src/cmd/compile/internal/test/testdata/arith_test.go
@@ -445,6 +445,19 @@ func testBitwiseRshU_ssa(a uint32, b, c uint32) uint32 {
}
//go:noinline
+func orLt_ssa(x int) bool {
+ y := x - x
+ return (x | 2) < y
+}
+
+// test riscv64 SLTI rules
+func testSetIfLessThan(t *testing.T) {
+ if want, got := true, orLt_ssa(-7); got != want {
+ t.Errorf("orLt_ssa(-7) = %t want %t", got, want)
+ }
+}
+
+//go:noinline
func testShiftCX_ssa() int {
v1 := uint8(3)
v4 := (v1 * v1) ^ v1 | v1 - v1 - v1&v1 ^ uint8(3+2) + v1*1>>0 - v1 | 1 | v1<<(2*3|0-0*0^1)
@@ -977,6 +990,7 @@ func TestArithmetic(t *testing.T) {
testRegallocCVSpill(t)
testSubqToNegq(t)
testBitwiseLogic(t)
+ testSetIfLessThan(t)
testOcom(t)
testLrot(t)
testShiftCX(t)
diff --git a/src/cmd/compile/internal/typecheck/_builtin/runtime.go b/src/cmd/compile/internal/typecheck/_builtin/runtime.go
index 3c9707252e..3e2324b528 100644
--- a/src/cmd/compile/internal/typecheck/_builtin/runtime.go
+++ b/src/cmd/compile/internal/typecheck/_builtin/runtime.go
@@ -195,6 +195,7 @@ func makeslice(typ *byte, len int, cap int) unsafe.Pointer
func makeslice64(typ *byte, len int64, cap int64) unsafe.Pointer
func makeslicecopy(typ *byte, tolen int, fromlen int, from unsafe.Pointer) unsafe.Pointer
func growslice(oldPtr *any, newLen, oldCap, num int, et *byte) (ary []any)
+func growsliceBuf(oldPtr *any, newLen, oldCap, num int, et *byte, buf *any, bufLen int) (ary []any)
func unsafeslicecheckptr(typ *byte, ptr unsafe.Pointer, len int64)
func panicunsafeslicelen()
func panicunsafeslicenilptr()
@@ -202,6 +203,11 @@ func unsafestringcheckptr(ptr unsafe.Pointer, len int64)
func panicunsafestringlen()
func panicunsafestringnilptr()
+func moveSlice(typ *byte, old *byte, len, cap int) (*byte, int, int)
+func moveSliceNoScan(elemSize uintptr, old *byte, len, cap int) (*byte, int, int)
+func moveSliceNoCap(typ *byte, old *byte, len int) (*byte, int, int)
+func moveSliceNoCapNoScan(elemSize uintptr, old *byte, len int) (*byte, int, int)
+
func memmove(to *any, frm *any, length uintptr)
func memclrNoHeapPointers(ptr unsafe.Pointer, n uintptr)
func memclrHasPointers(ptr unsafe.Pointer, n uintptr)
diff --git a/src/cmd/compile/internal/typecheck/builtin.go b/src/cmd/compile/internal/typecheck/builtin.go
index eea7fd7d05..537de2cbe9 100644
--- a/src/cmd/compile/internal/typecheck/builtin.go
+++ b/src/cmd/compile/internal/typecheck/builtin.go
@@ -160,80 +160,85 @@ var runtimeDecls = [...]struct {
{"makeslice64", funcTag, 124},
{"makeslicecopy", funcTag, 125},
{"growslice", funcTag, 127},
- {"unsafeslicecheckptr", funcTag, 128},
+ {"growsliceBuf", funcTag, 128},
+ {"unsafeslicecheckptr", funcTag, 129},
{"panicunsafeslicelen", funcTag, 9},
{"panicunsafeslicenilptr", funcTag, 9},
- {"unsafestringcheckptr", funcTag, 129},
+ {"unsafestringcheckptr", funcTag, 130},
{"panicunsafestringlen", funcTag, 9},
{"panicunsafestringnilptr", funcTag, 9},
- {"memmove", funcTag, 130},
- {"memclrNoHeapPointers", funcTag, 131},
- {"memclrHasPointers", funcTag, 131},
- {"memequal", funcTag, 132},
- {"memequal0", funcTag, 133},
- {"memequal8", funcTag, 133},
- {"memequal16", funcTag, 133},
- {"memequal32", funcTag, 133},
- {"memequal64", funcTag, 133},
- {"memequal128", funcTag, 133},
- {"f32equal", funcTag, 134},
- {"f64equal", funcTag, 134},
- {"c64equal", funcTag, 134},
- {"c128equal", funcTag, 134},
- {"strequal", funcTag, 134},
- {"interequal", funcTag, 134},
- {"nilinterequal", funcTag, 134},
- {"memhash", funcTag, 135},
- {"memhash0", funcTag, 136},
- {"memhash8", funcTag, 136},
- {"memhash16", funcTag, 136},
- {"memhash32", funcTag, 136},
- {"memhash64", funcTag, 136},
- {"memhash128", funcTag, 136},
- {"f32hash", funcTag, 137},
- {"f64hash", funcTag, 137},
- {"c64hash", funcTag, 137},
- {"c128hash", funcTag, 137},
- {"strhash", funcTag, 137},
- {"interhash", funcTag, 137},
- {"nilinterhash", funcTag, 137},
- {"int64div", funcTag, 138},
- {"uint64div", funcTag, 139},
- {"int64mod", funcTag, 138},
- {"uint64mod", funcTag, 139},
- {"float64toint64", funcTag, 140},
- {"float64touint64", funcTag, 141},
- {"float64touint32", funcTag, 142},
- {"int64tofloat64", funcTag, 143},
- {"int64tofloat32", funcTag, 144},
- {"uint64tofloat64", funcTag, 145},
- {"uint64tofloat32", funcTag, 146},
- {"uint32tofloat64", funcTag, 147},
- {"complex128div", funcTag, 148},
+ {"moveSlice", funcTag, 131},
+ {"moveSliceNoScan", funcTag, 132},
+ {"moveSliceNoCap", funcTag, 133},
+ {"moveSliceNoCapNoScan", funcTag, 134},
+ {"memmove", funcTag, 135},
+ {"memclrNoHeapPointers", funcTag, 136},
+ {"memclrHasPointers", funcTag, 136},
+ {"memequal", funcTag, 137},
+ {"memequal0", funcTag, 138},
+ {"memequal8", funcTag, 138},
+ {"memequal16", funcTag, 138},
+ {"memequal32", funcTag, 138},
+ {"memequal64", funcTag, 138},
+ {"memequal128", funcTag, 138},
+ {"f32equal", funcTag, 139},
+ {"f64equal", funcTag, 139},
+ {"c64equal", funcTag, 139},
+ {"c128equal", funcTag, 139},
+ {"strequal", funcTag, 139},
+ {"interequal", funcTag, 139},
+ {"nilinterequal", funcTag, 139},
+ {"memhash", funcTag, 140},
+ {"memhash0", funcTag, 141},
+ {"memhash8", funcTag, 141},
+ {"memhash16", funcTag, 141},
+ {"memhash32", funcTag, 141},
+ {"memhash64", funcTag, 141},
+ {"memhash128", funcTag, 141},
+ {"f32hash", funcTag, 142},
+ {"f64hash", funcTag, 142},
+ {"c64hash", funcTag, 142},
+ {"c128hash", funcTag, 142},
+ {"strhash", funcTag, 142},
+ {"interhash", funcTag, 142},
+ {"nilinterhash", funcTag, 142},
+ {"int64div", funcTag, 143},
+ {"uint64div", funcTag, 144},
+ {"int64mod", funcTag, 143},
+ {"uint64mod", funcTag, 144},
+ {"float64toint64", funcTag, 145},
+ {"float64touint64", funcTag, 146},
+ {"float64touint32", funcTag, 147},
+ {"int64tofloat64", funcTag, 148},
+ {"int64tofloat32", funcTag, 149},
+ {"uint64tofloat64", funcTag, 150},
+ {"uint64tofloat32", funcTag, 151},
+ {"uint32tofloat64", funcTag, 152},
+ {"complex128div", funcTag, 153},
{"racefuncenter", funcTag, 33},
{"racefuncexit", funcTag, 9},
{"raceread", funcTag, 33},
{"racewrite", funcTag, 33},
- {"racereadrange", funcTag, 149},
- {"racewriterange", funcTag, 149},
- {"msanread", funcTag, 149},
- {"msanwrite", funcTag, 149},
- {"msanmove", funcTag, 150},
- {"asanread", funcTag, 149},
- {"asanwrite", funcTag, 149},
- {"checkptrAlignment", funcTag, 151},
- {"checkptrArithmetic", funcTag, 153},
- {"libfuzzerTraceCmp1", funcTag, 154},
- {"libfuzzerTraceCmp2", funcTag, 155},
- {"libfuzzerTraceCmp4", funcTag, 156},
- {"libfuzzerTraceCmp8", funcTag, 157},
- {"libfuzzerTraceConstCmp1", funcTag, 154},
- {"libfuzzerTraceConstCmp2", funcTag, 155},
- {"libfuzzerTraceConstCmp4", funcTag, 156},
- {"libfuzzerTraceConstCmp8", funcTag, 157},
- {"libfuzzerHookStrCmp", funcTag, 158},
- {"libfuzzerHookEqualFold", funcTag, 158},
- {"addCovMeta", funcTag, 160},
+ {"racereadrange", funcTag, 154},
+ {"racewriterange", funcTag, 154},
+ {"msanread", funcTag, 154},
+ {"msanwrite", funcTag, 154},
+ {"msanmove", funcTag, 155},
+ {"asanread", funcTag, 154},
+ {"asanwrite", funcTag, 154},
+ {"checkptrAlignment", funcTag, 156},
+ {"checkptrArithmetic", funcTag, 158},
+ {"libfuzzerTraceCmp1", funcTag, 159},
+ {"libfuzzerTraceCmp2", funcTag, 160},
+ {"libfuzzerTraceCmp4", funcTag, 161},
+ {"libfuzzerTraceCmp8", funcTag, 162},
+ {"libfuzzerTraceConstCmp1", funcTag, 159},
+ {"libfuzzerTraceConstCmp2", funcTag, 160},
+ {"libfuzzerTraceConstCmp4", funcTag, 161},
+ {"libfuzzerTraceConstCmp8", funcTag, 162},
+ {"libfuzzerHookStrCmp", funcTag, 163},
+ {"libfuzzerHookEqualFold", funcTag, 163},
+ {"addCovMeta", funcTag, 165},
{"x86HasAVX", varTag, 6},
{"x86HasFMA", varTag, 6},
{"x86HasPOPCNT", varTag, 6},
@@ -244,11 +249,11 @@ var runtimeDecls = [...]struct {
{"loong64HasLAM_BH", varTag, 6},
{"loong64HasLSX", varTag, 6},
{"riscv64HasZbb", varTag, 6},
- {"asanregisterglobals", funcTag, 131},
+ {"asanregisterglobals", funcTag, 136},
}
func runtimeTypes() []*types.Type {
- var typs [161]*types.Type
+ var typs [166]*types.Type
typs[0] = types.ByteType
typs[1] = types.NewPtr(typs[0])
typs[2] = types.Types[types.TANY]
@@ -377,39 +382,44 @@ func runtimeTypes() []*types.Type {
typs[125] = newSig(params(typs[1], typs[13], typs[13], typs[7]), params(typs[7]))
typs[126] = types.NewSlice(typs[2])
typs[127] = newSig(params(typs[3], typs[13], typs[13], typs[13], typs[1]), params(typs[126]))
- typs[128] = newSig(params(typs[1], typs[7], typs[22]), nil)
- typs[129] = newSig(params(typs[7], typs[22]), nil)
- typs[130] = newSig(params(typs[3], typs[3], typs[5]), nil)
- typs[131] = newSig(params(typs[7], typs[5]), nil)
- typs[132] = newSig(params(typs[3], typs[3], typs[5]), params(typs[6]))
- typs[133] = newSig(params(typs[3], typs[3]), params(typs[6]))
- typs[134] = newSig(params(typs[7], typs[7]), params(typs[6]))
- typs[135] = newSig(params(typs[3], typs[5], typs[5]), params(typs[5]))
- typs[136] = newSig(params(typs[7], typs[5]), params(typs[5]))
- typs[137] = newSig(params(typs[3], typs[5]), params(typs[5]))
- typs[138] = newSig(params(typs[22], typs[22]), params(typs[22]))
- typs[139] = newSig(params(typs[24], typs[24]), params(typs[24]))
- typs[140] = newSig(params(typs[18]), params(typs[22]))
- typs[141] = newSig(params(typs[18]), params(typs[24]))
- typs[142] = newSig(params(typs[18]), params(typs[67]))
- typs[143] = newSig(params(typs[22]), params(typs[18]))
- typs[144] = newSig(params(typs[22]), params(typs[20]))
- typs[145] = newSig(params(typs[24]), params(typs[18]))
- typs[146] = newSig(params(typs[24]), params(typs[20]))
- typs[147] = newSig(params(typs[67]), params(typs[18]))
- typs[148] = newSig(params(typs[26], typs[26]), params(typs[26]))
- typs[149] = newSig(params(typs[5], typs[5]), nil)
- typs[150] = newSig(params(typs[5], typs[5], typs[5]), nil)
- typs[151] = newSig(params(typs[7], typs[1], typs[5]), nil)
- typs[152] = types.NewSlice(typs[7])
- typs[153] = newSig(params(typs[7], typs[152]), nil)
- typs[154] = newSig(params(typs[71], typs[71], typs[15]), nil)
- typs[155] = newSig(params(typs[65], typs[65], typs[15]), nil)
- typs[156] = newSig(params(typs[67], typs[67], typs[15]), nil)
- typs[157] = newSig(params(typs[24], typs[24], typs[15]), nil)
- typs[158] = newSig(params(typs[30], typs[30], typs[15]), nil)
- typs[159] = types.NewArray(typs[0], 16)
- typs[160] = newSig(params(typs[7], typs[67], typs[159], typs[30], typs[13], typs[71], typs[71]), params(typs[67]))
+ typs[128] = newSig(params(typs[3], typs[13], typs[13], typs[13], typs[1], typs[3], typs[13]), params(typs[126]))
+ typs[129] = newSig(params(typs[1], typs[7], typs[22]), nil)
+ typs[130] = newSig(params(typs[7], typs[22]), nil)
+ typs[131] = newSig(params(typs[1], typs[1], typs[13], typs[13]), params(typs[1], typs[13], typs[13]))
+ typs[132] = newSig(params(typs[5], typs[1], typs[13], typs[13]), params(typs[1], typs[13], typs[13]))
+ typs[133] = newSig(params(typs[1], typs[1], typs[13]), params(typs[1], typs[13], typs[13]))
+ typs[134] = newSig(params(typs[5], typs[1], typs[13]), params(typs[1], typs[13], typs[13]))
+ typs[135] = newSig(params(typs[3], typs[3], typs[5]), nil)
+ typs[136] = newSig(params(typs[7], typs[5]), nil)
+ typs[137] = newSig(params(typs[3], typs[3], typs[5]), params(typs[6]))
+ typs[138] = newSig(params(typs[3], typs[3]), params(typs[6]))
+ typs[139] = newSig(params(typs[7], typs[7]), params(typs[6]))
+ typs[140] = newSig(params(typs[3], typs[5], typs[5]), params(typs[5]))
+ typs[141] = newSig(params(typs[7], typs[5]), params(typs[5]))
+ typs[142] = newSig(params(typs[3], typs[5]), params(typs[5]))
+ typs[143] = newSig(params(typs[22], typs[22]), params(typs[22]))
+ typs[144] = newSig(params(typs[24], typs[24]), params(typs[24]))
+ typs[145] = newSig(params(typs[18]), params(typs[22]))
+ typs[146] = newSig(params(typs[18]), params(typs[24]))
+ typs[147] = newSig(params(typs[18]), params(typs[67]))
+ typs[148] = newSig(params(typs[22]), params(typs[18]))
+ typs[149] = newSig(params(typs[22]), params(typs[20]))
+ typs[150] = newSig(params(typs[24]), params(typs[18]))
+ typs[151] = newSig(params(typs[24]), params(typs[20]))
+ typs[152] = newSig(params(typs[67]), params(typs[18]))
+ typs[153] = newSig(params(typs[26], typs[26]), params(typs[26]))
+ typs[154] = newSig(params(typs[5], typs[5]), nil)
+ typs[155] = newSig(params(typs[5], typs[5], typs[5]), nil)
+ typs[156] = newSig(params(typs[7], typs[1], typs[5]), nil)
+ typs[157] = types.NewSlice(typs[7])
+ typs[158] = newSig(params(typs[7], typs[157]), nil)
+ typs[159] = newSig(params(typs[71], typs[71], typs[15]), nil)
+ typs[160] = newSig(params(typs[65], typs[65], typs[15]), nil)
+ typs[161] = newSig(params(typs[67], typs[67], typs[15]), nil)
+ typs[162] = newSig(params(typs[24], typs[24], typs[15]), nil)
+ typs[163] = newSig(params(typs[30], typs[30], typs[15]), nil)
+ typs[164] = types.NewArray(typs[0], 16)
+ typs[165] = newSig(params(typs[7], typs[67], typs[164], typs[30], typs[13], typs[71], typs[71]), params(typs[67]))
return typs[:]
}
diff --git a/src/cmd/compile/internal/types/type.go b/src/cmd/compile/internal/types/type.go
index e8aca90081..6663c49dd8 100644
--- a/src/cmd/compile/internal/types/type.go
+++ b/src/cmd/compile/internal/types/type.go
@@ -1842,26 +1842,7 @@ func IsReflexive(t *Type) bool {
// Can this type be stored directly in an interface word?
// Yes, if the representation is a single pointer.
func IsDirectIface(t *Type) bool {
- switch t.Kind() {
- case TPTR:
- // Pointers to notinheap types must be stored indirectly. See issue 42076.
- return !t.Elem().NotInHeap()
- case TCHAN,
- TMAP,
- TFUNC,
- TUNSAFEPTR:
- return true
-
- case TARRAY:
- // Array of 1 direct iface type can be direct.
- return t.NumElem() == 1 && IsDirectIface(t.Elem())
-
- case TSTRUCT:
- // Struct with 1 field of direct iface type can be direct.
- return t.NumFields() == 1 && IsDirectIface(t.Field(0).Type)
- }
-
- return false
+ return t.Size() == int64(PtrSize) && PtrDataSize(t) == int64(PtrSize)
}
// IsInterfaceMethod reports whether (field) m is
diff --git a/src/cmd/compile/internal/types2/check.go b/src/cmd/compile/internal/types2/check.go
index 25cda4f73d..42218b4caf 100644
--- a/src/cmd/compile/internal/types2/check.go
+++ b/src/cmd/compile/internal/types2/check.go
@@ -171,12 +171,13 @@ type Checker struct {
usedPkgNames map[*PkgName]bool // set of used package names
mono monoGraph // graph for detecting non-monomorphizable instantiation loops
- firstErr error // first error encountered
- methods map[*TypeName][]*Func // maps package scope type names to associated non-blank (non-interface) methods
- untyped map[syntax.Expr]exprInfo // map of expressions without final type
- delayed []action // stack of delayed action segments; segments are processed in FIFO order
- objPath []Object // path of object dependencies during type inference (for cycle reporting)
- cleaners []cleaner // list of types that may need a final cleanup at the end of type-checking
+ firstErr error // first error encountered
+ methods map[*TypeName][]*Func // maps package scope type names to associated non-blank (non-interface) methods
+ untyped map[syntax.Expr]exprInfo // map of expressions without final type
+ delayed []action // stack of delayed action segments; segments are processed in FIFO order
+ objPath []Object // path of object dependencies during type-checking (for cycle reporting)
+ objPathIdx map[Object]int // map of object to object path index during type-checking (for cycle reporting)
+ cleaners []cleaner // list of types that may need a final cleanup at the end of type-checking
// environment within which the current object is type-checked (valid only
// for the duration of type-checking a specific object)
@@ -248,19 +249,22 @@ func (check *Checker) later(f func()) *action {
return &check.delayed[i]
}
-// push pushes obj onto the object path and returns its index in the path.
-func (check *Checker) push(obj Object) int {
+// push pushes obj onto the object path and records its index in the path index map.
+func (check *Checker) push(obj Object) {
+ if check.objPathIdx == nil {
+ check.objPathIdx = make(map[Object]int)
+ }
+ check.objPathIdx[obj] = len(check.objPath)
check.objPath = append(check.objPath, obj)
- return len(check.objPath) - 1
}
-// pop pops and returns the topmost object from the object path.
-func (check *Checker) pop() Object {
+// pop pops an object from the object path and removes it from the path index map.
+func (check *Checker) pop() {
i := len(check.objPath) - 1
obj := check.objPath[i]
- check.objPath[i] = nil
+ check.objPath[i] = nil // help the garbage collector
check.objPath = check.objPath[:i]
- return obj
+ delete(check.objPathIdx, obj)
}
type cleaner interface {
@@ -319,6 +323,7 @@ func (check *Checker) initFiles(files []*syntax.File) {
check.untyped = nil
check.delayed = nil
check.objPath = nil
+ check.objPathIdx = nil
check.cleaners = nil
// We must initialize usedVars and usedPkgNames both here and in NewChecker,
diff --git a/src/cmd/compile/internal/types2/cycles.go b/src/cmd/compile/internal/types2/cycles.go
index fa739a2b84..b916219c97 100644
--- a/src/cmd/compile/internal/types2/cycles.go
+++ b/src/cmd/compile/internal/types2/cycles.go
@@ -54,7 +54,6 @@ func (check *Checker) directCycle(tname *TypeName, pathIdx map[*TypeName]int) {
// tname is marked grey - we have a cycle on the path beginning at start.
// Mark tname as invalid.
tname.setType(Typ[Invalid])
- tname.setColor(black)
// collect type names on cycle
var cycle []Object
diff --git a/src/cmd/compile/internal/types2/decl.go b/src/cmd/compile/internal/types2/decl.go
index 91d2492a53..5cb52fdbe4 100644
--- a/src/cmd/compile/internal/types2/decl.go
+++ b/src/cmd/compile/internal/types2/decl.go
@@ -62,114 +62,77 @@ func (check *Checker) objDecl(obj Object, def *TypeName) {
if check.indent == 0 {
fmt.Println() // empty line between top-level objects for readability
}
- check.trace(obj.Pos(), "-- checking %s (%s, objPath = %s)", obj, obj.color(), pathString(check.objPath))
+ check.trace(obj.Pos(), "-- checking %s (objPath = %s)", obj, pathString(check.objPath))
check.indent++
defer func() {
check.indent--
- check.trace(obj.Pos(), "=> %s (%s)", obj, obj.color())
+ check.trace(obj.Pos(), "=> %s", obj)
}()
}
- // Checking the declaration of obj means inferring its type
- // (and possibly its value, for constants).
- // An object's type (and thus the object) may be in one of
- // three states which are expressed by colors:
+ // Checking the declaration of an object means determining its type
+ // (and also its value for constants). An object (and thus its type)
+ // may be in 1 of 3 states:
//
- // - an object whose type is not yet known is painted white (initial color)
- // - an object whose type is in the process of being inferred is painted grey
- // - an object whose type is fully inferred is painted black
+ // - not in Checker.objPathIdx and type == nil : type is not yet known (white)
+ // - in Checker.objPathIdx : type is pending (grey)
+ // - not in Checker.objPathIdx and type != nil : type is known (black)
//
- // During type inference, an object's color changes from white to grey
- // to black (pre-declared objects are painted black from the start).
- // A black object (i.e., its type) can only depend on (refer to) other black
- // ones. White and grey objects may depend on white and black objects.
- // A dependency on a grey object indicates a cycle which may or may not be
- // valid.
+ // During type-checking, an object changes from white to grey to black.
+ // Predeclared objects start as black (their type is known without checking).
//
- // When objects turn grey, they are pushed on the object path (a stack);
- // they are popped again when they turn black. Thus, if a grey object (a
- // cycle) is encountered, it is on the object path, and all the objects
- // it depends on are the remaining objects on that path. Color encoding
- // is such that the color value of a grey object indicates the index of
- // that object in the object path.
-
- // During type-checking, white objects may be assigned a type without
- // traversing through objDecl; e.g., when initializing constants and
- // variables. Update the colors of those objects here (rather than
- // everywhere where we set the type) to satisfy the color invariants.
- if obj.color() == white && obj.Type() != nil {
- obj.setColor(black)
- return
- }
-
- switch obj.color() {
- case white:
- assert(obj.Type() == nil)
- // All color values other than white and black are considered grey.
- // Because black and white are < grey, all values >= grey are grey.
- // Use those values to encode the object's index into the object path.
- obj.setColor(grey + color(check.push(obj)))
- defer func() {
- check.pop().setColor(black)
- }()
-
- case black:
- assert(obj.Type() != nil)
- return
-
- default:
- // Color values other than white or black are considered grey.
- fallthrough
+ // A black object may only depend on (refer to) to other black objects. White
+ // and grey objects may depend on white or black objects. A dependency on a
+ // grey object indicates a (possibly invalid) cycle.
+ //
+ // When an object is marked grey, it is pushed onto the object path (a stack)
+ // and its index in the path is recorded in the path index map. It is popped
+ // and removed from the map when its type is determined (and marked black).
- case grey:
- // We have a (possibly invalid) cycle.
- // In the existing code, this is marked by a non-nil type
- // for the object except for constants and variables whose
- // type may be non-nil (known), or nil if it depends on the
- // not-yet known initialization value.
- // In the former case, set the type to Typ[Invalid] because
- // we have an initialization cycle. The cycle error will be
- // reported later, when determining initialization order.
- // TODO(gri) Report cycle here and simplify initialization
- // order code.
+ // If this object is grey, we have a (possibly invalid) cycle. This is signaled
+ // by a non-nil type for the object, except for constants and variables whose
+ // type may be non-nil (known), or nil if it depends on a not-yet known
+ // initialization value.
+ //
+ // In the former case, set the type to Typ[Invalid] because we have an
+ // initialization cycle. The cycle error will be reported later, when
+ // determining initialization order.
+ //
+ // TODO(gri) Report cycle here and simplify initialization order code.
+ if _, ok := check.objPathIdx[obj]; ok {
switch obj := obj.(type) {
- case *Const:
- if !check.validCycle(obj) || obj.typ == nil {
- obj.typ = Typ[Invalid]
- }
-
- case *Var:
- if !check.validCycle(obj) || obj.typ == nil {
- obj.typ = Typ[Invalid]
+ case *Const, *Var:
+ if !check.validCycle(obj) || obj.Type() == nil {
+ obj.setType(Typ[Invalid])
}
-
case *TypeName:
if !check.validCycle(obj) {
- // break cycle
- // (without this, calling underlying()
- // below may lead to an endless loop
- // if we have a cycle for a defined
- // (*Named) type)
- obj.typ = Typ[Invalid]
+ obj.setType(Typ[Invalid])
}
-
case *Func:
if !check.validCycle(obj) {
- // Don't set obj.typ to Typ[Invalid] here
- // because plenty of code type-asserts that
- // functions have a *Signature type. Grey
- // functions have their type set to an empty
- // signature which makes it impossible to
+ // Don't set type to Typ[Invalid]; plenty of code asserts that
+ // functions have a *Signature type. Instead, leave the type
+ // as an empty signature, which makes it impossible to
// initialize a variable with the function.
}
-
default:
panic("unreachable")
}
+
assert(obj.Type() != nil)
return
}
+ if obj.Type() != nil { // black, meaning it's already type-checked
+ return
+ }
+
+ // white, meaning it must be type-checked
+
+ check.push(obj)
+ defer check.pop()
+
d := check.objMap[obj]
if d == nil {
check.dump("%v: %s should have been declared", obj.Pos(), obj)
@@ -221,8 +184,8 @@ func (check *Checker) validCycle(obj Object) (valid bool) {
}
// Count cycle objects.
- assert(obj.color() >= grey)
- start := obj.color() - grey // index of obj in objPath
+ start, found := check.objPathIdx[obj]
+ assert(found)
cycle := check.objPath[start:]
tparCycle := false // if set, the cycle is through a type parameter list
nval := 0 // number of (constant or variable) values in the cycle
@@ -532,11 +495,16 @@ func (check *Checker) typeDecl(obj *TypeName, tdecl *syntax.TypeDecl, def *TypeN
check.collectTypeParams(&alias.tparams, tdecl.TParamList)
}
- rhs = check.definedType(tdecl.Type, obj)
+ rhs = check.declaredType(tdecl.Type, obj)
assert(rhs != nil)
-
alias.fromRHS = rhs
- unalias(alias) // populate alias.actual
+
+ // spec: In an alias declaration the given type cannot be a type parameter declared in the same declaration."
+ // (see also go.dev/issue/75884, go.dev/issue/#75885)
+ if tpar, ok := rhs.(*TypeParam); ok && alias.tparams != nil && slices.Index(alias.tparams.list(), tpar) >= 0 {
+ check.error(tdecl.Type, MisplacedTypeParam, "cannot use type parameter declared in alias declaration as RHS")
+ alias.fromRHS = Typ[Invalid]
+ }
} else {
if !versionErr && tparam0 != nil {
check.error(tdecl, UnsupportedFeature, "generic type alias requires GODEBUG=gotypesalias=1 or unset")
@@ -576,7 +544,7 @@ func (check *Checker) typeDecl(obj *TypeName, tdecl *syntax.TypeDecl, def *TypeN
check.collectTypeParams(&named.tparams, tdecl.TParamList)
}
- rhs = check.definedType(tdecl.Type, obj)
+ rhs = check.declaredType(tdecl.Type, obj)
assert(rhs != nil)
named.fromRHS = rhs
@@ -764,17 +732,8 @@ func (check *Checker) funcDecl(obj *Func, decl *declInfo) {
sig := new(Signature)
obj.typ = sig // guard against cycles
- // Avoid cycle error when referring to method while type-checking the signature.
- // This avoids a nuisance in the best case (non-parameterized receiver type) and
- // since the method is not a type, we get an error. If we have a parameterized
- // receiver type, instantiating the receiver type leads to the instantiation of
- // its methods, and we don't want a cycle error in that case.
- // TODO(gri) review if this is correct and/or whether we still need this?
- saved := obj.color_
- obj.color_ = black
fdecl := decl.fdecl
check.funcType(sig, fdecl.Recv, fdecl.TParamList, fdecl.Type)
- obj.color_ = saved
// Set the scope's extent to the complete "func (...) { ... }"
// so that Scope.Innermost works correctly.
@@ -921,10 +880,9 @@ func (check *Checker) declStmt(list []syntax.Decl) {
// the innermost containing block."
scopePos := s.Name.Pos()
check.declare(check.scope, s.Name, obj, scopePos)
- // mark and unmark type before calling typeDecl; its type is still nil (see Checker.objDecl)
- obj.setColor(grey + color(check.push(obj)))
+ check.push(obj) // mark as grey
check.typeDecl(obj, s, nil)
- check.pop().setColor(black)
+ check.pop()
default:
check.errorf(s, InvalidSyntaxTree, "unknown syntax.Decl node %T", s)
diff --git a/src/cmd/compile/internal/types2/object.go b/src/cmd/compile/internal/types2/object.go
index ce129dbf59..dd2d415790 100644
--- a/src/cmd/compile/internal/types2/object.go
+++ b/src/cmd/compile/internal/types2/object.go
@@ -42,18 +42,12 @@ type Object interface {
// 0 for all other objects (including objects in file scopes).
order() uint32
- // color returns the object's color.
- color() color
-
// setType sets the type of the object.
setType(Type)
// setOrder sets the order number of the object. It must be > 0.
setOrder(uint32)
- // setColor sets the object's color. It must not be white.
- setColor(color color)
-
// setParent sets the parent scope of the object.
setParent(*Scope)
@@ -102,41 +96,9 @@ type object struct {
name string
typ Type
order_ uint32
- color_ color
scopePos_ syntax.Pos
}
-// color encodes the color of an object (see Checker.objDecl for details).
-type color uint32
-
-// An object may be painted in one of three colors.
-// Color values other than white or black are considered grey.
-const (
- white color = iota
- black
- grey // must be > white and black
-)
-
-func (c color) String() string {
- switch c {
- case white:
- return "white"
- case black:
- return "black"
- default:
- return "grey"
- }
-}
-
-// colorFor returns the (initial) color for an object depending on
-// whether its type t is known or not.
-func colorFor(t Type) color {
- if t != nil {
- return black
- }
- return white
-}
-
// Parent returns the scope in which the object is declared.
// The result is nil for methods and struct fields.
func (obj *object) Parent() *Scope { return obj.parent }
@@ -164,13 +126,11 @@ func (obj *object) Id() string { return Id(obj.pkg, obj.name) }
func (obj *object) String() string { panic("abstract") }
func (obj *object) order() uint32 { return obj.order_ }
-func (obj *object) color() color { return obj.color_ }
func (obj *object) scopePos() syntax.Pos { return obj.scopePos_ }
func (obj *object) setParent(parent *Scope) { obj.parent = parent }
func (obj *object) setType(typ Type) { obj.typ = typ }
func (obj *object) setOrder(order uint32) { assert(order > 0); obj.order_ = order }
-func (obj *object) setColor(color color) { assert(color != white); obj.color_ = color }
func (obj *object) setScopePos(pos syntax.Pos) { obj.scopePos_ = pos }
func (obj *object) sameId(pkg *Package, name string, foldCase bool) bool {
@@ -247,7 +207,7 @@ type PkgName struct {
// NewPkgName returns a new PkgName object representing an imported package.
// The remaining arguments set the attributes found with all Objects.
func NewPkgName(pos syntax.Pos, pkg *Package, name string, imported *Package) *PkgName {
- return &PkgName{object{nil, pos, pkg, name, Typ[Invalid], 0, black, nopos}, imported}
+ return &PkgName{object{nil, pos, pkg, name, Typ[Invalid], 0, nopos}, imported}
}
// Imported returns the package that was imported.
@@ -263,7 +223,7 @@ type Const struct {
// NewConst returns a new constant with value val.
// The remaining arguments set the attributes found with all Objects.
func NewConst(pos syntax.Pos, pkg *Package, name string, typ Type, val constant.Value) *Const {
- return &Const{object{nil, pos, pkg, name, typ, 0, colorFor(typ), nopos}, val}
+ return &Const{object{nil, pos, pkg, name, typ, 0, nopos}, val}
}
// Val returns the constant's value.
@@ -288,7 +248,7 @@ type TypeName struct {
// argument for NewNamed, which will set the TypeName's type as a side-
// effect.
func NewTypeName(pos syntax.Pos, pkg *Package, name string, typ Type) *TypeName {
- return &TypeName{object{nil, pos, pkg, name, typ, 0, colorFor(typ), nopos}}
+ return &TypeName{object{nil, pos, pkg, name, typ, 0, nopos}}
}
// NewTypeNameLazy returns a new defined type like NewTypeName, but it
@@ -402,7 +362,7 @@ func NewField(pos syntax.Pos, pkg *Package, name string, typ Type, embedded bool
// newVar returns a new variable.
// The arguments set the attributes found with all Objects.
func newVar(kind VarKind, pos syntax.Pos, pkg *Package, name string, typ Type) *Var {
- return &Var{object: object{nil, pos, pkg, name, typ, 0, colorFor(typ), nopos}, kind: kind}
+ return &Var{object: object{nil, pos, pkg, name, typ, 0, nopos}, kind: kind}
}
// Anonymous reports whether the variable is an embedded field.
@@ -452,7 +412,7 @@ func NewFunc(pos syntax.Pos, pkg *Package, name string, sig *Signature) *Func {
// as this would violate object.{Type,color} invariants.
// TODO(adonovan): propose to disallow NewFunc with nil *Signature.
}
- return &Func{object{nil, pos, pkg, name, typ, 0, colorFor(typ), nopos}, false, nil}
+ return &Func{object{nil, pos, pkg, name, typ, 0, nopos}, false, nil}
}
// Signature returns the signature (type) of the function or method.
@@ -534,7 +494,7 @@ type Label struct {
// NewLabel returns a new label.
func NewLabel(pos syntax.Pos, pkg *Package, name string) *Label {
- return &Label{object{pos: pos, pkg: pkg, name: name, typ: Typ[Invalid], color_: black}, false}
+ return &Label{object{pos: pos, pkg: pkg, name: name, typ: Typ[Invalid]}, false}
}
// A Builtin represents a built-in function.
@@ -545,7 +505,7 @@ type Builtin struct {
}
func newBuiltin(id builtinId) *Builtin {
- return &Builtin{object{name: predeclaredFuncs[id].name, typ: Typ[Invalid], color_: black}, id}
+ return &Builtin{object{name: predeclaredFuncs[id].name, typ: Typ[Invalid]}, id}
}
// Nil represents the predeclared value nil.
diff --git a/src/cmd/compile/internal/types2/scope.go b/src/cmd/compile/internal/types2/scope.go
index 566184df73..10c624be2e 100644
--- a/src/cmd/compile/internal/types2/scope.go
+++ b/src/cmd/compile/internal/types2/scope.go
@@ -217,10 +217,8 @@ func (*lazyObject) Exported() bool { panic("unreachable") }
func (*lazyObject) Id() string { panic("unreachable") }
func (*lazyObject) String() string { panic("unreachable") }
func (*lazyObject) order() uint32 { panic("unreachable") }
-func (*lazyObject) color() color { panic("unreachable") }
func (*lazyObject) setType(Type) { panic("unreachable") }
func (*lazyObject) setOrder(uint32) { panic("unreachable") }
-func (*lazyObject) setColor(color color) { panic("unreachable") }
func (*lazyObject) setParent(*Scope) { panic("unreachable") }
func (*lazyObject) sameId(*Package, string, bool) bool { panic("unreachable") }
func (*lazyObject) scopePos() syntax.Pos { panic("unreachable") }
diff --git a/src/cmd/compile/internal/types2/sizeof_test.go b/src/cmd/compile/internal/types2/sizeof_test.go
index 092e82318a..f206c12fc3 100644
--- a/src/cmd/compile/internal/types2/sizeof_test.go
+++ b/src/cmd/compile/internal/types2/sizeof_test.go
@@ -36,14 +36,14 @@ func TestSizeof(t *testing.T) {
{term{}, 12, 24},
// Objects
- {PkgName{}, 60, 96},
- {Const{}, 64, 104},
- {TypeName{}, 56, 88},
- {Var{}, 64, 104},
- {Func{}, 64, 104},
- {Label{}, 60, 96},
- {Builtin{}, 60, 96},
- {Nil{}, 56, 88},
+ {PkgName{}, 56, 96},
+ {Const{}, 60, 104},
+ {TypeName{}, 52, 88},
+ {Var{}, 60, 104},
+ {Func{}, 60, 104},
+ {Label{}, 56, 96},
+ {Builtin{}, 56, 96},
+ {Nil{}, 52, 88},
// Misc
{Scope{}, 60, 104},
diff --git a/src/cmd/compile/internal/types2/typexpr.go b/src/cmd/compile/internal/types2/typexpr.go
index 8601ce6277..303f782ac4 100644
--- a/src/cmd/compile/internal/types2/typexpr.go
+++ b/src/cmd/compile/internal/types2/typexpr.go
@@ -16,7 +16,7 @@ import (
// ident type-checks identifier e and initializes x with the value or type of e.
// If an error occurred, x.mode is set to invalid.
-// For the meaning of def, see Checker.definedType, below.
+// For the meaning of def, see Checker.declaredType, below.
// If wantType is set, the identifier e is expected to denote a type.
func (check *Checker) ident(x *operand, e *syntax.Name, def *TypeName, wantType bool) {
x.mode = invalid
@@ -149,14 +149,14 @@ func (check *Checker) ident(x *operand, e *syntax.Name, def *TypeName, wantType
// typ type-checks the type expression e and returns its type, or Typ[Invalid].
// The type must not be an (uninstantiated) generic type.
func (check *Checker) typ(e syntax.Expr) Type {
- return check.definedType(e, nil)
+ return check.declaredType(e, nil)
}
// varType type-checks the type expression e and returns its type, or Typ[Invalid].
// The type must not be an (uninstantiated) generic type and it must not be a
// constraint interface.
func (check *Checker) varType(e syntax.Expr) Type {
- typ := check.definedType(e, nil)
+ typ := check.declaredType(e, nil)
check.validVarType(e, typ)
return typ
}
@@ -187,11 +187,11 @@ func (check *Checker) validVarType(e syntax.Expr, typ Type) {
}).describef(e, "check var type %s", typ)
}
-// definedType is like typ but also accepts a type name def.
-// If def != nil, e is the type specification for the type named def, declared
-// in a type declaration, and def.typ.underlying will be set to the type of e
-// before any components of e are type-checked.
-func (check *Checker) definedType(e syntax.Expr, def *TypeName) Type {
+// declaredType is like typ but also accepts a type name def.
+// If def != nil, e is the type specification for the [Alias] or [Named] type
+// named def, and def.typ.fromRHS will be set to the [Type] of e immediately
+// after its creation.
+func (check *Checker) declaredType(e syntax.Expr, def *TypeName) Type {
typ := check.typInternal(e, def)
assert(isTyped(typ))
if isGeneric(typ) {
@@ -230,7 +230,7 @@ func goTypeName(typ Type) string {
}
// typInternal drives type checking of types.
-// Must only be called by definedType or genericType.
+// Must only be called by declaredType or genericType.
func (check *Checker) typInternal(e0 syntax.Expr, def *TypeName) (T Type) {
if check.conf.Trace {
check.trace(e0.Pos(), "-- type %s", e0)
@@ -296,7 +296,7 @@ func (check *Checker) typInternal(e0 syntax.Expr, def *TypeName) (T Type) {
case *syntax.ParenExpr:
// Generic types must be instantiated before they can be used in any form.
// Consequently, generic types cannot be parenthesized.
- return check.definedType(e.X, def)
+ return check.declaredType(e.X, def)
case *syntax.ArrayType:
typ := new(Array)
diff --git a/src/cmd/compile/internal/types2/universe.go b/src/cmd/compile/internal/types2/universe.go
index 332cd174f9..1ecef97d51 100644
--- a/src/cmd/compile/internal/types2/universe.go
+++ b/src/cmd/compile/internal/types2/universe.go
@@ -98,7 +98,6 @@ func defPredeclaredTypes() {
// interface.
{
universeAnyNoAlias = NewTypeName(nopos, nil, "any", &Interface{complete: true, tset: &topTypeSet})
- universeAnyNoAlias.setColor(black)
// ensure that the any TypeName reports a consistent Parent, after
// hijacking Universe.Lookup with gotypesalias=0.
universeAnyNoAlias.setParent(Universe)
@@ -107,7 +106,6 @@ func defPredeclaredTypes() {
// into the Universe, but we lean toward the future and insert the Alias
// representation.
universeAnyAlias = NewTypeName(nopos, nil, "any", nil)
- universeAnyAlias.setColor(black)
_ = NewAlias(universeAnyAlias, universeAnyNoAlias.Type().Underlying()) // Link TypeName and Alias
def(universeAnyAlias)
}
@@ -115,7 +113,6 @@ func defPredeclaredTypes() {
// type error interface{ Error() string }
{
obj := NewTypeName(nopos, nil, "error", nil)
- obj.setColor(black)
typ := (*Checker)(nil).newNamed(obj, nil, nil)
// error.Error() string
@@ -136,7 +133,6 @@ func defPredeclaredTypes() {
// type comparable interface{} // marked as comparable
{
obj := NewTypeName(nopos, nil, "comparable", nil)
- obj.setColor(black)
typ := (*Checker)(nil).newNamed(obj, nil, nil)
// interface{} // marked as comparable
@@ -165,7 +161,7 @@ func defPredeclaredConsts() {
}
func defPredeclaredNil() {
- def(&Nil{object{name: "nil", typ: Typ[UntypedNil], color_: black}})
+ def(&Nil{object{name: "nil", typ: Typ[UntypedNil]}})
}
// A builtinId is the id of a builtin function.
@@ -289,7 +285,7 @@ func init() {
// a scope. Objects with exported names are inserted in the unsafe package
// scope; other objects are inserted in the universe scope.
func def(obj Object) {
- assert(obj.color() == black)
+ assert(obj.Type() != nil)
name := obj.Name()
if strings.Contains(name, " ") {
return // nothing to do
diff --git a/src/cmd/compile/internal/walk/expr.go b/src/cmd/compile/internal/walk/expr.go
index 989ae0a1db..2794671c73 100644
--- a/src/cmd/compile/internal/walk/expr.go
+++ b/src/cmd/compile/internal/walk/expr.go
@@ -351,6 +351,11 @@ func walkExpr1(n ir.Node, init *ir.Nodes) ir.Node {
case ir.OMETHVALUE:
return walkMethodValue(n.(*ir.SelectorExpr), init)
+
+ case ir.OMOVE2HEAP:
+ n := n.(*ir.MoveToHeapExpr)
+ n.Slice = walkExpr(n.Slice, init)
+ return n
}
// No return! Each case must return (or panic),